<?xml version="1.0" encoding="utf-8"?>
<?xml-stylesheet type="text/xsl" href="/global/feed/rss.xslt" ?>
<rss version="2.0" xmlns:atom="http://www.w3.org/2005/Atom" xmlns:googleplay="http://www.google.com/schemas/play-podcasts/1.0" xmlns:itunes="http://www.itunes.com/dtds/podcast-1.0.dtd" xmlns:media="http://search.yahoo.com/mrss/" xmlns:podaccess="https://access.acast.com/schema/1.0/" xmlns:acast="https://schema.acast.com/1.0/">
   <script src="https://feeds.acast.com/global/feed/xslt-polyfill.min.js" xmlns="http://www.w3.org/1999/xhtml"></script>
    <channel>
		<ttl>60</ttl>
		<generator>acast.com</generator>
		<title><![CDATA[Michael Calvin's Football People]]></title>
		<link>http://sport.bt.com</link>
		<atom:link href="https://feeds.acast.com/public/shows/c3d7e527-a19b-4b2e-a5ba-229c5d119435" rel="self" type="application/rss+xml"/>
		<language>en</language>
		<copyright>BT Sport</copyright>
		<itunes:keywords>Football,PremierLeague,ChampionsLeague,Manchester City,Manchester United,Chelsea,Tottenham,Liverpool,Newcastle,Arsenal,Fans,News</itunes:keywords>
		<itunes:author>BT Sport</itunes:author>
		<itunes:subtitle/>
		<itunes:summary><![CDATA[BT Sport brings you closer to the heart of the game with Michael Calvin's Football People, The weekly podcast features the best writers, addressing the biggest&nbsp;issues, and an in depth interview, conducted by the host, an award winning author and journalist.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		<description><![CDATA[BT Sport brings you closer to the heart of the game with Michael Calvin's Football People, The weekly podcast features the best writers, addressing the biggest&nbsp;issues, and an in depth interview, conducted by the host, an award winning author and journalist.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
		<itunes:explicit>false</itunes:explicit>
		<itunes:owner>
			<itunes:name> </itunes:name>
			<itunes:email>info+c3d7e527-a19b-4b2e-a5ba-229c5d119435@mg-eu.acast.com</itunes:email>
		</itunes:owner>
		<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
		<acast:showUrl>lifesapitch</acast:showUrl>
		<acast:signature key="EXAMPLE" algorithm="aes-256-cbc"><![CDATA[wbG1Z7+6h9QOi+CR1Dv0uQ==]]></acast:signature>
		<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmU13c0otUap75NIyVufnZVBoBcFwz3Y0zGA/pFjpP70+3oZt3+5O3uX8mfQZWzV35Kby8OfdHfDJlQAYxij1gc0J63rxgoMm4loq58gBzd9i]]></acast:settings>
        <acast:network id="16fece89-d8fe-76db-3175-9e3af1c48791" slug=""><![CDATA[British Telecommunications plc]]></acast:network>
		<acast:importedFeed>https://rss.acast.com/lifesapitch</acast:importedFeed>
		<itunes:type>episodic</itunes:type>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<image>
				<url>https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg</url>
				<link>http://sport.bt.com</link>
				<title><![CDATA[Michael Calvin's Football People]]></title>
			</image>
			<itunes:new-feed-url>https://feeds.acast.com/public/shows/c3d7e527-a19b-4b2e-a5ba-229c5d119435</itunes:new-feed-url>
		<item>
			<title>Joe Cole - An English double in Europe?</title>
			<itunes:title>Joe Cole - An English double in Europe?</itunes:title>
			<pubDate>Tue, 06 Jun 2023 11:57:28 GMT</pubDate>
			<itunes:duration>48:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/647f1f28524ab90011bdd76b/media.mp3" length="116867576" type="audio/mpeg"/>
			<guid isPermaLink="false">647f1f28524ab90011bdd76b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/joe-cole-an-english-double-in-europe</link>
			<acast:episodeId>647f1f28524ab90011bdd76b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>joe-cole-an-english-double-in-europe</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9VI99TxsCFZqNnZSEYAhGjaJKVBzVQ+gicgkvDPxNvC5agqe70biVse0zOjI5PrYYientSKcRghLu3mj7kWefOKxvT+NgXlh5NfhqkRyrXvHnXmR+i2ft74NtQdAx544HzzrpxPmINwL7O7d5u4UEXeEpgMGORxy0t1EXrk7s6d0xaEtOwYMY0aGJm3VbL/KwKSx9iFn+s0iYjjQSwUjWdFMsObuU11oRhKrOTUcSg3pBQHFj0Vn7GQRAlLZkKRQBnfWK5jl+00HiIOL0XCq2gQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Joe Cole joins Michael Calvin, Jonathan Northcroft and Miguel Delaney to discuss the Conference League and Champions League finals. They pay tribute&nbsp;to the tactical diversity&nbsp;of modern Italian&nbsp;teams, but foresee redemption for West Ham's David Moyes, and a milestone achievement by Pep Guardiola at Manchester City,&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Joe Cole joins Michael Calvin, Jonathan Northcroft and Miguel Delaney to discuss the Conference League and Champions League finals. They pay tribute&nbsp;to the tactical diversity&nbsp;of modern Italian&nbsp;teams, but foresee redemption for West Ham's David Moyes, and a milestone achievement by Pep Guardiola at Manchester City,&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Christian Eriksen - Football as Art</title>
			<itunes:title>Christian Eriksen - Football as Art</itunes:title>
			<pubDate>Thu, 01 Jun 2023 05:00:43 GMT</pubDate>
			<itunes:duration>57:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/64776c932db2b1001175b30b/media.mp3" length="137882252" type="audio/mpeg"/>
			<guid isPermaLink="false">64776c932db2b1001175b30b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/christian-eriksen-football-as-art</link>
			<acast:episodeId>64776c932db2b1001175b30b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>christian-eriksen-football-as-art</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9dn0o2/a1ulQrXsvokeGtuKaOMg5QvmeY7uknQPw0JEQu2KnxdSuJ+vcA5L916+DajVN++TQ5M1jpygGnOky6zmvklejNNA/zgOUS3NbJ4Yw7ouQEU72YWBUWsf0vKpab7JahkdntOy3DogWD7n9DsvikjDbtAKXRmBbK/BhNcld6ctqRpWZAZmaIV/XdovkRgRN5AFDNAEeJY1Ej6UeijHAOYQRKEURwfmdtKJFJm+OgveOHdfZfIgNpo2x4N6WAUJJQfPOdUjXY3AIuf2CpUg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Manchester United's Christian Eriksen joins Michael Calvin to look forward to the FA Cup final, and to give an insight into his instinctive&nbsp;approach to the game. Seb Stafford Bloor and Tony Hodson dwell on the implications of Manchester City's dominance, assess their&nbsp;natural challengers, and discuss the bouncebackability of this season's relegated clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Manchester United's Christian Eriksen joins Michael Calvin to look forward to the FA Cup final, and to give an insight into his instinctive&nbsp;approach to the game. Seb Stafford Bloor and Tony Hodson dwell on the implications of Manchester City's dominance, assess their&nbsp;natural challengers, and discuss the bouncebackability of this season's relegated clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Roy Hodgson - Lessons of a Lifetime</title>
			<itunes:title>Roy Hodgson - Lessons of a Lifetime</itunes:title>
			<pubDate>Wed, 24 May 2023 11:50:53 GMT</pubDate>
			<itunes:duration>1:01:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/646dfa1d72513c0011919e63/media.mp3" length="148614572" type="audio/mpeg"/>
			<guid isPermaLink="false">646dfa1d72513c0011919e63</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/roy-hodgson-lessons-of-a-lifetime</link>
			<acast:episodeId>646dfa1d72513c0011919e63</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>roy-hodgson-lessons-of-a-lifetime</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9x/38Mvb7mB+1hutz0+VB9OiRNP2XhS+tSSG4gR/99bEnFeHw32AB2nw0aHWyfDTu+nSk7z4J4KljoP1RBt5iV0lrDK/Rku0KvrgRmmuqF6mUaGWU/7tjIACO+32PUeBvTuQSo49muQFgNe+v2KPnguudlcRZdoUZkGCliXiHXNg6Oo7L7CmxiGvYgnhq+m2TP+BEtmPqvr85PJ8c23RmASG+/LlU9c5cQIHeOj2wULDzdRSzr/1lZWdffoYVWTal2NtxZ4Nxi7caD5Rg3h43ww==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[On the eve of perhaps the last game in a 47 year career, Roy Hodgson, at 75, offers Michael Calvin a masterclass in&nbsp;management and coaching. His impact on club and country is assessed by Paul Hayward and Dominic Fifield, who also discuss relegation, elite football's lack of romanticism, and the need for a militant approach to racial abuse.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[On the eve of perhaps the last game in a 47 year career, Roy Hodgson, at 75, offers Michael Calvin a masterclass in&nbsp;management and coaching. His impact on club and country is assessed by Paul Hayward and Dominic Fifield, who also discuss relegation, elite football's lack of romanticism, and the need for a militant approach to racial abuse.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Marco Silva - The Coming Man</title>
			<itunes:title>Marco Silva - The Coming Man</itunes:title>
			<pubDate>Fri, 19 May 2023 11:45:36 GMT</pubDate>
			<itunes:duration>57:29</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/646761606968910011530695/media.mp3" length="137960552" type="audio/mpeg"/>
			<guid isPermaLink="false">646761606968910011530695</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/marco-silva-the-coming-man</link>
			<acast:episodeId>646761606968910011530695</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>marco-silva-the-coming-man</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9/bv/HH27ku+xG4KKPljord/kvqnfjSQ0pMwJrbor7TawRIRbPvap3loQ92ujv1U9VI7eH0U6uRowhjLaSdiVu9K13DknqHW/0G67jfNRm3Skpf3dFueZt2oi9cyN9TKhcUPlU+hDTJZr1Zf9x0vLS8LSB03JPr+o4JAbQ+pUejVd34RLolu5PuBQ8t8wnuPh0cKnUzYdE2LfikjICa5DOlbpwLYIecWs789JdzwZAudXWDPw6xZlvkzDwTKLNY/C0prjR/iUKeFrYY/HVy34IQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Marco Silva, shortlisted for the Premier League Manager of the year award joins Michael Calvin to discuss his influences, achievements,&nbsp;and trademark intensity. John Cross and Miguel Delaney praise his&nbsp;maturity at Fulham, and take an all-encompassing look at the challenges facing modern football, in the light of Manchester City's domination.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Marco Silva, shortlisted for the Premier League Manager of the year award joins Michael Calvin to discuss his influences, achievements,&nbsp;and trademark intensity. John Cross and Miguel Delaney praise his&nbsp;maturity at Fulham, and take an all-encompassing look at the challenges facing modern football, in the light of Manchester City's domination.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Michail Antonio - Don't Crumble]]></title>
			<itunes:title><![CDATA[Michail Antonio - Don't Crumble]]></itunes:title>
			<pubDate>Thu, 11 May 2023 04:30:37 GMT</pubDate>
			<itunes:duration>52:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/645bbbfdf6507e00119469ab/media.mp3" length="125326064" type="audio/mpeg"/>
			<guid isPermaLink="false">645bbbfdf6507e00119469ab</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/michail-antonio-dont-crumble</link>
			<acast:episodeId>645bbbfdf6507e00119469ab</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>michail-antonio-dont-crumble</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9z8Lgog+D+GaUg+K/DbHU/yBqDvKrgX70OEv1Q/+nqmUClcyo9c7/tcLhnt1BKwhqKvXCfN/Hc5X9qKUelAA6Q2GZkyKYuOTdb05rMFfXqjW3mF3F1xa3UzZb017XkSFpXWSpJDICSdw+rWT3QUPet2aVxVXu2HiVaWD+VV3uafIG5vEC5bwUOGBGRWEQ2a3yvFLcDIFwSTxczZDi3f3LRi3s/5aTNVW/wmDuSE0XRzijxEKo0WXbl7WH3I0C/U+Xpnhz3FINji56I8Mp2/lbXg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[West Ham striker highlights the importance of winning a European&nbsp;trophy, and looks to the past and the future with Michael Calvin.. Paul Hayward and David Preece dwell on the lessons of his career, the significance of Manchester City's Champions League return leg against Real Madrid, and a rapidly developing race to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[West Ham striker highlights the importance of winning a European&nbsp;trophy, and looks to the past and the future with Michael Calvin.. Paul Hayward and David Preece dwell on the lessons of his career, the significance of Manchester City's Champions League return leg against Real Madrid, and a rapidly developing race to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Steve Cooper - Summoning the Spirit of Clough</title>
			<itunes:title>Steve Cooper - Summoning the Spirit of Clough</itunes:title>
			<pubDate>Thu, 04 May 2023 05:00:35 GMT</pubDate>
			<itunes:duration>57:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/64528a29e2c2230011ca94f8/media.mp3" length="137775764" type="audio/mpeg"/>
			<guid isPermaLink="false">64528a29e2c2230011ca94f8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/steve-cooper-summoning-the-spirit-of-clough</link>
			<acast:episodeId>64528a29e2c2230011ca94f8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>steve-cooper-summoning-the-spirit-of-clough</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9/mJS5uHCJ6FedLO6L4BTFi3A9P/mo+lviX5CIZ65fVFhg43UbNVi3LcUOP6Z64I7OZwrfHeCFqbMc2B3VqzrM9uunZ71QDsbISf7V7eW7uYymqSc7bvyS6H5v36eumSYRbOMgdgFSzuDvKpM0OA5MM+43nrdlhEBOCwh1iHuXH/bGSCdLBsqVd/hwTKZ2BKfLR40Mawuo0mSMI4L2nXMvi6Z0mWrpZSiLYdRyauNDEqXNUz3uXlTJ8DyEq8lscGhY6Zyvp12g1b12geUErUdrg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Nottingham Forest manager Steve Cooper gives Michael Calvin an insight into the principles and pressures involved in the attempt to stay in the Premier League. Jonathan Northcroft and Tony Hodson praise his approach, and assess Forest's relegation rivals before dwelling on the problems faced by Frank Lampard and Jurgen Klopp.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Nottingham Forest manager Steve Cooper gives Michael Calvin an insight into the principles and pressures involved in the attempt to stay in the Premier League. Jonathan Northcroft and Tony Hodson praise his approach, and assess Forest's relegation rivals before dwelling on the problems faced by Frank Lampard and Jurgen Klopp.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Patrick Bamford - Marching On Together</title>
			<itunes:title>Patrick Bamford - Marching On Together</itunes:title>
			<pubDate>Thu, 27 Apr 2023 11:00:22 GMT</pubDate>
			<itunes:duration>52:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/644a55c75de6ea0011e62761/media.mp3" length="124896980" type="audio/mpeg"/>
			<guid isPermaLink="false">644a55c75de6ea0011e62761</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/patrick-bamford-marching-on-together</link>
			<acast:episodeId>644a55c75de6ea0011e62761</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>patrick-bamford-marching-on-together</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9w5/7vZ0i/KeUH/Xb94C/4MBYWXu+t8p4R1HCSw/LWm08De4OvAizuef4r4daC3kw6CPMro/JtdxKolisnlp/vWJ4m1VV3g/A6Ax92RqexRXKZiLE1dZ46L5UL81NU4WDoQizqMhHXw/AaNuCJvHt0LsS3grCuBSaONM3NZvZ3Ioc8xC5Z6nBOYYMxwUhe8AO79wZsWqdkZ9WsU1/nQJhcJy/2IkaDSP4g9IGm4YjapBEYwcJis2tmk3VfkdEMH1MY5ROQGw3zI0NKay+xEkIKLjK+z1QmIKUBcxBAOShaFg=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Leeds striker Patrick Bamford gives Michael Calvin a timely insight into the strains of the scramble to avoid relegation. Lucy Ward and Adrian Clarke assess their chances of survival, and reach an identical conclusion : Manchester City will be Premier League champions for the third successive season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Leeds striker Patrick Bamford gives Michael Calvin a timely insight into the strains of the scramble to avoid relegation. Lucy Ward and Adrian Clarke assess their chances of survival, and reach an identical conclusion : Manchester City will be Premier League champions for the third successive season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Tyrone Mings - The Emery Effect</title>
			<itunes:title>Tyrone Mings - The Emery Effect</itunes:title>
			<pubDate>Thu, 20 Apr 2023 10:09:45 GMT</pubDate>
			<itunes:duration>51:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/64410f6ad18c13001125a99b/media.mp3" length="122895632" type="audio/mpeg"/>
			<guid isPermaLink="false">64410f6ad18c13001125a99b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/tyrone-mings-the-emery-effect</link>
			<acast:episodeId>64410f6ad18c13001125a99b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>tyrone-mings-the-emery-effect</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9TDqa+/pgvFDqYXVjaATvJOsT/AFEqnyi49HFGGl9ay+0t+NLKJy0ukDNoeB67XvDJZkNDapL0TCKwRSsZOcq5VMZyMTuLnhMwRrLFZcBPyAoKQzWVJSszfjJ4rq2fx7op/XgZJlHUpLiVJ+Mc+eBcdicWCG7pHSfOqqGFAQqRQx4FqQ+syeZTovdJy56su6Td7CyEjp1DowVi+a1TH5sxowsdauOcDrMCOUWJ1p8JcRPeToUFxncLHIvsWFckrmTqtQUdZQ7QldxjcHoGcJv9g==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Aston Villa defender Tyrone Mings joins Michael Calvin to discuss the impact of Unai Emery's coaching, and his rise from Academy reject to England international. John Cross and Richard Amofa assess Villa's chances of European qualification, look forward to the FA Cup semi finals, and&nbsp;suggest Arsenal will fail to prevent Manchester City winning a treble.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Aston Villa defender Tyrone Mings joins Michael Calvin to discuss the impact of Unai Emery's coaching, and his rise from Academy reject to England international. John Cross and Richard Amofa assess Villa's chances of European qualification, look forward to the FA Cup semi finals, and&nbsp;suggest Arsenal will fail to prevent Manchester City winning a treble.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Erik Ten Hag - Rebuilding Manchester United</title>
			<itunes:title>Erik Ten Hag - Rebuilding Manchester United</itunes:title>
			<pubDate>Thu, 13 Apr 2023 13:57:17 GMT</pubDate>
			<itunes:duration>51:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/64380a3ed4bc700011f8ba5f/media.mp3" length="124539932" type="audio/mpeg"/>
			<guid isPermaLink="false">64380a3ed4bc700011f8ba5f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/erik-ten-hag-rebuilding-manchester-united</link>
			<acast:episodeId>64380a3ed4bc700011f8ba5f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>erik-ten-hag-rebuilding-manchester-united</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9H2dlXDlhDJdqhnsmzuHujyQLc+0rTJ7OLgkusblfi6Rp2HvrW/9nEk/oEZT64HRvkEXnrUuV3X3CySyC6xB1MSq2SiRYo9abDFUZZ24iWROPlo4pv/Dcw3btdjmKafob3qK/iEL0JsuMcf1ZerQDojdzyRqF1VqKmqSTJB/SD2zzZIL5BDDP7gIo8C/FqRMmtJLU52TshwSoug7upGCVwm1WkTAjnjDoE2gHmvD+JIUf8nvWmin7dZRn6gYM/VKym00i/GRU7hQcEuDyT+i9BQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[With a treble still possible, Erik Ten Hag gives Michael Calvin an insight into the influences and philosophy shaping a successful first season as Manchester United manager. Jonathan Northcroft and David Preece assess his impact in the context of the unique threat represented by Manchester City, who will never have a better chance to win the Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[With a treble still possible, Erik Ten Hag gives Michael Calvin an insight into the influences and philosophy shaping a successful first season as Manchester United manager. Jonathan Northcroft and David Preece assess his impact in the context of the unique threat represented by Manchester City, who will never have a better chance to win the Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Sean Dyche - Survive And Thrive</title>
			<itunes:title>Sean Dyche - Survive And Thrive</itunes:title>
			<pubDate>Thu, 06 Apr 2023 16:24:52 GMT</pubDate>
			<itunes:duration>56:18</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/642ef255fe706300117e56fa/media.mp3" length="135141752" type="audio/mpeg"/>
			<guid isPermaLink="false">642ef255fe706300117e56fa</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/sean-dyche-survive-and-thrive</link>
			<acast:episodeId>642ef255fe706300117e56fa</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>sean-dyche-survive-and-thrive</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9iHoalxg0JAqh20ZIzAVD+uLGHiVAmo9IUqyp1nQR39wTKt4ZbOBo2Irgf1c5mcvIRxdnnmYqSqYxM0y/7PHtruJlUQEnIdikimL/77n6ydHFNwaQ2nT+QNwBHP5DammSO7mJ+YjnJRJJlyEGSyP4ZszXlTdOygFtCo5WRwrNhnUveEuvCg65JqJepwUdQStEadGJog+pwF9jNoLwmuYWN1PmhQCK+AniQl5NlIM76RaW9pkLZUyKjyvTD7UK723CIhKDI3CTcoZMUD0LB1ULEQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Everton manager Sean Dyche joins Michael Calvin to discuss the specifics of Premier League survival. Miguel Delaney and Dominic Fifield endorse his qualities, as they examine the nine team struggle to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Everton manager Sean Dyche joins Michael Calvin to discuss the specifics of Premier League survival. Miguel Delaney and Dominic Fifield endorse his qualities, as they examine the nine team struggle to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Paul Barber - Keeping the Dream Alive</title>
			<itunes:title>Paul Barber - Keeping the Dream Alive</itunes:title>
			<pubDate>Thu, 30 Mar 2023 13:00:00 GMT</pubDate>
			<itunes:duration>57:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/64257eff93caf000126ca86e/media.mp3" length="137643176" type="audio/mpeg"/>
			<guid isPermaLink="false">64257eff93caf000126ca86e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/paul-barber-keeping-the-dream-alive</link>
			<acast:episodeId>64257eff93caf000126ca86e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>paul-barber-keeping-the-dream-alive</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9QNQyQnf/r2CJcJ2TirXzoW0WRfzUmekz7wqcQpE+8bA0qRtd011tkqHPc3/o0e7qDWLnsmwlH0eYKRrUPal122mX4yKhw64yDHzLiHPDhFM0NJyw4QH4HODGG8Vlh+CMCQBK/T+t5i2cejYj+Cb3Dpbfr+6SLo73+Dbof76n2JJouzaSMEaRjBSuofdjzGOGVhWIUZrU2QaQuIDW7RtkvQUFQeDo8NEMc8cY5XZiFTO6HkufBoInKmKs/oG6R/VXS+T/pBavEalOgvkL1YWflw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Michael Calvin discusses the principles of football leadership, and Brighton's elevation from near-extinction with the club's chief executive, Paul Barber. They are joined by Paul Hayward and Tony Hodson, who examine the race for a top four place in the light of Tottenham's implosion.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Michael Calvin discusses the principles of football leadership, and Brighton's elevation from near-extinction with the club's chief executive, Paul Barber. They are joined by Paul Hayward and Tony Hodson, who examine the race for a top four place in the light of Tottenham's implosion.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Chris Wilder - The Fireman Manager</title>
			<itunes:title>Chris Wilder - The Fireman Manager</itunes:title>
			<pubDate>Thu, 23 Mar 2023 06:00:24 GMT</pubDate>
			<itunes:duration>53:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/641b28e2dadd1400112c5d24/media.mp3" length="128972756" type="audio/mpeg"/>
			<guid isPermaLink="false">641b28e2dadd1400112c5d24</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/chris-wilder-the-fireman-manager</link>
			<acast:episodeId>641b28e2dadd1400112c5d24</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>chris-wilder-the-fireman-manager</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9pe3GuMYlJtS5EEvZD+sbyDpE9fRwloOkrliAUxddh+sHlF/E5DptlYQDThMfcG2R3hfCGsJXWXFhbZdI8PgZ+8Gj6AD8ReuiO5vhyzMr6mNfF623vdOvYZz+oLDeTOzM5um5T04hFwvfYHWwe6ER5/zXVdyRls71m6kHIzW6lGFEpJoolTotjdfw8ouaxOTrfkQDZX3IKHsfA18Blm22rC/jDoUAteeHmoBbwUkn6wSCdVS3vkx3pmRmotaWrFKoCazK+k/iJe28o8hKD4ujEQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Chris Wilder joins Michael Calvin to discuss the role of Firemen managers, a role undertaken by him at Watford and by Roy Hodgson at Crystal Palace. Adrian Clarke and David Preece discuss the pressures and practicalities of the job, which reflects the increasing financial importance of promotion to, and survival in, the Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Chris Wilder joins Michael Calvin to discuss the role of Firemen managers, a role undertaken by him at Watford and by Roy Hodgson at Crystal Palace. Adrian Clarke and David Preece discuss the pressures and practicalities of the job, which reflects the increasing financial importance of promotion to, and survival in, the Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>James Milner - Manager in the Making</title>
			<itunes:title>James Milner - Manager in the Making</itunes:title>
			<pubDate>Thu, 16 Mar 2023 12:54:06 GMT</pubDate>
			<itunes:duration>1:01:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6413116f30d9d10011187512/media.mp3" length="147444248" type="audio/mpeg"/>
			<guid isPermaLink="false">6413116f30d9d10011187512</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/james-milner-manager-in-the-making</link>
			<acast:episodeId>6413116f30d9d10011187512</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>james-milner-manager-in-the-making</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9UtQderqgelVGTOxY8xmxdqS0moBH0oWJdoaDHJCnnaDTiVk8sCnzK/s5ceje67TaXw9oi6BaI7s7tZbSc1CfEQUh4zxGYCjRUq3jIOmn2q6DUPSTgiJ025xJh8yOrFMg+aB7LIQwBlWjJ9Qw6l+tJZ7G35ozrhaZdaEW148yX2zZMwjws9vOPc6euri482dQMcrW6Q97dtVyswKGcrwDelGI8uHrzjWT9viMapYaKq7tjOmItdeF03ZoRwqf2SU6M1z1QDdUCFmbrTVUyFaeiQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[James Milner discusses the pros and cons of a coaching career with Michael Calvin, as Liverpool face a summer of change. They're joined by Miguel Delaney and Dominic Fifield, who look forward to the quarter final draw in the Champions League, assess the last eight in the FA Cup, and criticise a bloated 2026 World Cup.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[James Milner discusses the pros and cons of a coaching career with Michael Calvin, as Liverpool face a summer of change. They're joined by Miguel Delaney and Dominic Fifield, who look forward to the quarter final draw in the Champions League, assess the last eight in the FA Cup, and criticise a bloated 2026 World Cup.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Marvin Sordell - Football's Fragile Mental Health]]></title>
			<itunes:title><![CDATA[Marvin Sordell - Football's Fragile Mental Health]]></itunes:title>
			<pubDate>Thu, 09 Mar 2023 13:21:32 GMT</pubDate>
			<itunes:duration>1:01:45</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6409dd5df918780011ce73ef/media.mp3" length="148216808" type="audio/mpeg"/>
			<guid isPermaLink="false">6409dd5df918780011ce73ef</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/marvin-sordell-footballs-fragile-mental-health</link>
			<acast:episodeId>6409dd5df918780011ce73ef</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>marvin-sordell-footballs-fragile-mental-health</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9P7sCZQMRIuJAJ77S7E5AoKC6Y9RksJKxpM/qtSn8vdxhSlJoCYQRVodjOT3MitPeYeOafPo43lT0knLmWHAAkFN3iqHp8FmOuVPLHQAWQWttKqutm+0LsAFamPHkYvpS4Pnp6lDd2nBxWh7pEx3YVbgHn+VcWQwZgBX7I5fj8BQLWb84wr68obhjfvQ3DuC8QTkPlUoo+NyBa1GpqiOWWo06++pRTzPfHy3ijG0AudDzHZbmkfBii2RzSGEgJ5itzLuEYgmcILaze+wlfqzp7gphTyNweCetuVM65Tz6iJo=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[With pressure on managers and players reaching unprecedented levels, campaigner Marvin Sordell joins Michael Calvin to discuss football's approach to mental health. Anne Marie Batson and Adrian Clarke offer their views, and also consider the fallout from the Champions League for Chelsea, Spurs and PSG.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[With pressure on managers and players reaching unprecedented levels, campaigner Marvin Sordell joins Michael Calvin to discuss football's approach to mental health. Anne Marie Batson and Adrian Clarke offer their views, and also consider the fallout from the Champions League for Chelsea, Spurs and PSG.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Emi Martinez - Touching the Sky</title>
			<itunes:title>Emi Martinez - Touching the Sky</itunes:title>
			<pubDate>Thu, 02 Mar 2023 06:00:13 GMT</pubDate>
			<itunes:duration>56:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63ff837b24a4200011e4a937/media.mp3" length="134951744" type="audio/mpeg"/>
			<guid isPermaLink="false">63ff837b24a4200011e4a937</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/emi-martinez-touching-the-sky</link>
			<acast:episodeId>63ff837b24a4200011e4a937</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>emi-martinez-touching-the-sky</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9vuMiDuir/ZuJAi+Evyh9NU12GJCNipWbbKFSlSNDao9lM7e8eaz/CNuBUoZDfrfViuBACk0OKu/k+Eg0OtdhAeHf+U3E6Gi85t0NXPMQeOS39fHW3YFGkZftili49acPPP5yCMt9LRyYyIcX1gZ+79yrE0224CYrG0OXQGybWDQfMzWAUyRYKWk1e7cURGlsYjtYRxX+sdR8+V+nA6vKz92LdA3TTDllnz+tCy9Jg3NNJgC6i0nTPe80SIoYGlEpG84G6aQNLB+sXu6TuYorKA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[World Cup winner Emi Martinez gives Michael Calvin a unique insight into the mentality that has made him, in the eyes of FIFA, the world's best goalkeeper. Goalkeeping coach David Preece and Richard Amofa assess his impact, and address a range of domestic issues, including the rise and rise of Manchester United under Erik Ten Hag.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[World Cup winner Emi Martinez gives Michael Calvin a unique insight into the mentality that has made him, in the eyes of FIFA, the world's best goalkeeper. Goalkeeping coach David Preece and Richard Amofa assess his impact, and address a range of domestic issues, including the rise and rise of Manchester United under Erik Ten Hag.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Unai Emery - Pride, Passion, And Purpose</title>
			<itunes:title>Unai Emery - Pride, Passion, And Purpose</itunes:title>
			<pubDate>Thu, 23 Feb 2023 07:00:49 GMT</pubDate>
			<itunes:duration>1:07:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63f656501561a70011a37950/media.mp3" length="162808796" type="audio/mpeg"/>
			<guid isPermaLink="false">63f656501561a70011a37950</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/unai-emery-pride-passion-and-purpose</link>
			<acast:episodeId>63f656501561a70011a37950</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>unai-emery-pride-passion-and-purpose</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz90bL23Pe1sUfoY00yUCCOjd7E5FzYBahZulPdcfceHnl72U1gJX0QwfvVlzAkci06IgtViEi9VHCGYK/nRsmKTYDYQyVEZ55epoSvNQmbjPIaspkaALZIZ2fb7QukaSNKp28PE5p+ribY3xuSsAT40C81/2NyCVRqNg6u+O+Sz/tvazgmk5UwYWBIfcGmOiNLT2NOcnr1bd0kaEbQTL1EXjKsTzrg3e/Jp+xqD/EVF64TmvYC74XdP6oCoM7/j/PtLApjZze5iTyxlpV5TgRjXg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Aston&nbsp;Villa manager Unai Emery gives Michael Calvin a fascinating insight into why the Basque region is producing so many influential coaches. John Cross and Tony Hodson assess his impact, and look at the background to Sunday's League Cup final between Newcastle and Manchester United.&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Aston&nbsp;Villa manager Unai Emery gives Michael Calvin a fascinating insight into why the Basque region is producing so many influential coaches. John Cross and Tony Hodson assess his impact, and look at the background to Sunday's League Cup final between Newcastle and Manchester United.&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>David Moyes - 25 years and counting</title>
			<itunes:title>David Moyes - 25 years and counting</itunes:title>
			<pubDate>Thu, 16 Feb 2023 13:17:45 GMT</pubDate>
			<itunes:duration>54:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63ee2cf94dcec10011aa5b8b/media.mp3" length="131481488" type="audio/mpeg"/>
			<guid isPermaLink="false">63ee2cf94dcec10011aa5b8b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/david-moyes-25-years-and-counting</link>
			<acast:episodeId>63ee2cf94dcec10011aa5b8b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>david-moyes-25-years-and-counting</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz98EbeP+HHOyCWj+sn5xRkg6lsgwyEYOHhSw3R/ZSbnFlytLbZ/A4Ff/o0TpYtkdCwYqxs4grHQ20Hev1gHHtC4kj+zLyfo4WLtOwwupBRxFS2vz2XZwameTjCyVGVKlK3ohdcmt8FLQUq7uXjRJuub2YmqkUsXLpCWL4NxDU0QQ/0ePDNF8DnSNexyxEz66/worp1qZt0a5n2TbV6NHd9BuDerzMkjh0wlpsf5WdIJPmf2QQizSm4npM02XlarzDp14EwV6y4K7oFrnk8HPesKw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[No current manager has been in charge&nbsp;of more Premier League games than David Moyes. He shares his unrivalled experience with Michael Calvin,&nbsp;Paul Hayward and Jonathan Northcroft in an episode&nbsp;that touches on Manchester City's title challenge, Liverpool's chance for renewal in the Champions League, and the need to address the increasingly obvious flaws of the VAR system.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[No current manager has been in charge&nbsp;of more Premier League games than David Moyes. He shares his unrivalled experience with Michael Calvin,&nbsp;Paul Hayward and Jonathan Northcroft in an episode&nbsp;that touches on Manchester City's title challenge, Liverpool's chance for renewal in the Champions League, and the need to address the increasingly obvious flaws of the VAR system.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Martin O'Neill - A Life in Football]]></title>
			<itunes:title><![CDATA[Martin O'Neill - A Life in Football]]></itunes:title>
			<pubDate>Thu, 09 Feb 2023 06:00:11 GMT</pubDate>
			<itunes:duration>55:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63e3e7b83f94ee0011d84e67/media.mp3" length="132884624" type="audio/mpeg"/>
			<guid isPermaLink="false">63e3e7b83f94ee0011d84e67</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/martin-oneill-a-life-in-football</link>
			<acast:episodeId>63e3e7b83f94ee0011d84e67</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>martin-oneill-a-life-in-football</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9MAGXTXQHkP0gyQIAflhhuQmdsxkH8DJV9U6hFx3nQXzdadWb5+O/Hv0gxHtJ9M6j2Js5L4xy0SuH/GFtpNVTHoqa8iRL0R+YoU+opY0obycHeX01R3xjVP7c3dNDJsSJ0lqOL3ytR6VogF6QIL6N4Tb8j6jeDyyJGLiglmNuKoT+L35KW5LuwBOUmIli89GzxvS8gEOp0ilHi/ACSLbqANm7O8fE7dBjRAlB0xGpLM9DYIPHBGpFIV7OJ+kESplqJPlMU5qbtO/gSmSeTtuldQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Michael Calvin, Miguel Delaney and Dominic Fifield discuss football's future, in the light of the charges laid against Manchester City. The return&nbsp;of the Champions League highlights the achievements of this week's guest Martin O'Neill, who won the European Cup with Nottingham Forest in successive seasons under Brian Clough before embarking on a stellar managerial career.&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Michael Calvin, Miguel Delaney and Dominic Fifield discuss football's future, in the light of the charges laid against Manchester City. The return&nbsp;of the Champions League highlights the achievements of this week's guest Martin O'Neill, who won the European Cup with Nottingham Forest in successive seasons under Brian Clough before embarking on a stellar managerial career.&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Aaron Ramsdale - The Art of Goalkeeping</title>
			<itunes:title>Aaron Ramsdale - The Art of Goalkeeping</itunes:title>
			<pubDate>Fri, 03 Feb 2023 06:00:15 GMT</pubDate>
			<itunes:duration>1:00:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63dc22189ad2830010de0e6b/media.mp3" length="145992044" type="audio/mpeg"/>
			<guid isPermaLink="false">63dc22189ad2830010de0e6b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/aaron-ramsdale-the-art-of-goalkeeping</link>
			<acast:episodeId>63dc22189ad2830010de0e6b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>aaron-ramsdale-the-art-of-goalkeeping</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9aIjQa7jz/FbX6QjrKVdzQTGFSkq3mXoCKWODRk0kbm2HcFF8GSxdhOnR+eZJG15dQDpzQp1YZXMTQ1KYO0RpZ0xZIktvVt24vK6c2nL1wq4CiS5zNU0iTRxpkKAZ8iYaHl8XXHdAhRkw9Uv5Q3NLL3cCzIHXhG7hQfsKRvxa+u/u7IEjEMPK9T8DYafJpQAPx/RJu+CMMhMthC6WEdk4lGe9NiC1KhMqFrzxSWk8zN4pxEREknMWdH+UJJgbGqTo0jXWeUcL0oMBKLK5RPCbEw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Arsenal goalkeeper Aaron Ramsdale joins Michael Calvin to discuss Mikel Arteta's empathetic management, his rivalry with Jordan Pickford, and daring to dream of a Premier League title. Goalkeeping coach David Preece and former Arsenal player Adrian Clarke add their expert opinion on a range of current issues.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Arsenal goalkeeper Aaron Ramsdale joins Michael Calvin to discuss Mikel Arteta's empathetic management, his rivalry with Jordan Pickford, and daring to dream of a Premier League title. Goalkeeping coach David Preece and former Arsenal player Adrian Clarke add their expert opinion on a range of current issues.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Jurgen Klopp - Life Lessons at Liverpool</title>
			<itunes:title>Jurgen Klopp - Life Lessons at Liverpool</itunes:title>
			<pubDate>Wed, 25 Jan 2023 06:00:40 GMT</pubDate>
			<itunes:duration>54:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63cfe9ef9632b700111ac0d8/media.mp3" length="130083968" type="audio/mpeg"/>
			<guid isPermaLink="false">63cfe9ef9632b700111ac0d8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/jurgen-klopp-life-lessons-at-liverpool</link>
			<acast:episodeId>63cfe9ef9632b700111ac0d8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>jurgen-klopp-life-lessons-at-liverpool</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9sW7MRVLzZDyabFKyjUTbRpCCXs7EMGVbCmRqToyM6RBLYek7Wt6jAb89jF9rEA82/s8m8zLa4jGrB/uudLySdcuhflKXucAJLMY5XX8YJIzBnTKCy1fjx8ZKfeshXTE/bUiSDvkSxltW32mRryod2FZ+9uRIeyS9+f5MvapownsJWuXepueBYR9RWiF7pqpadkbqr+o4wEQOLBabYihlP6WsyxDEY1mEKvXiXE+dx7ZoVyHA0KdwGLxvwRsP2JIuHWGw2RvTGZGjlmOJcDI3iA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Jurgen Klopp gives Michael Calvin an insight into the demands of modern football, and discusses the next phase of his management of Liverpool. Miguel Delaney and Tony Hodson offer their views on a potential rebuild, and compare Klopp with another recent guest on the Football People Podcast, Pep Guardiola.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Jurgen Klopp gives Michael Calvin an insight into the demands of modern football, and discusses the next phase of his management of Liverpool. Miguel Delaney and Tony Hodson offer their views on a potential rebuild, and compare Klopp with another recent guest on the Football People Podcast, Pep Guardiola.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Pep Guardiola - The Man Behind the Manager</title>
			<itunes:title>Pep Guardiola - The Man Behind the Manager</itunes:title>
			<pubDate>Thu, 19 Jan 2023 06:00:45 GMT</pubDate>
			<itunes:duration>51:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63c8126597a43d0011ce7dfa/media.mp3" length="124681088" type="audio/mpeg"/>
			<guid isPermaLink="false">63c8126597a43d0011ce7dfa</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/pep-guardiola-the-man-behind-the-manager</link>
			<acast:episodeId>63c8126597a43d0011ce7dfa</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>pep-guardiola-the-man-behind-the-manager</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz93h4Slq3pho6E1hrBsfKo/o+bfP1+nTzFeLamRNbWSAz3B4Qig5ZiKSE0/t/aMONTxjFoOm7f5Q8b0HA8TGzXrSTUSW9DIQQVDy/aBAkzCxDAFIWOupT0fVSVYbezpzyKOloSUfCZVCu6//r9f+vk61EPsrpP0fbx+vQC9cflhuYmn6lZ2/aEJjTnyVAb3Gfc/WjyoU2u8ll10lDZfj59++UYjqDM51ZVSo2XHPQ6xy9CzWY6lu0m1eWrw4AbmugbyDlOeWyLGo8ZONmK3LcxQw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Pep Guardiola gives Michael Calvin an intriguing insight into his personal and professional philosophies in the latest Football People Podcast. Paul Hayward and Jonathan Northcroft discuss his relationship with Mikel Arteta, the characteristics of great coaches,&nbsp;and the intensifying pressure on managers at the wrong end of the Premier League table.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Pep Guardiola gives Michael Calvin an intriguing insight into his personal and professional philosophies in the latest Football People Podcast. Paul Hayward and Jonathan Northcroft discuss his relationship with Mikel Arteta, the characteristics of great coaches,&nbsp;and the intensifying pressure on managers at the wrong end of the Premier League table.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Graham Potter - Football is Like Life</title>
			<itunes:title>Graham Potter - Football is Like Life</itunes:title>
			<pubDate>Thu, 12 Jan 2023 14:00:00 GMT</pubDate>
			<itunes:duration>57:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63c0032833f3c00011018063/media.mp3" length="138314048" type="audio/mpeg"/>
			<guid isPermaLink="false">63c0032833f3c00011018063</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/graham-potter-football-is-like-life</link>
			<acast:episodeId>63c0032833f3c00011018063</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>graham-potter-football-is-like-life</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9gCCbL5BPSNx6uhlaXbTdXnd/ZewC3KdduTIhS5SqP/4Mrc/tD4Hw+JoAwlDVDdV17VyTEWeXoh+Gf5bA5MDBuD239ilWN0UG+ozO8u+BB62ifq7ZJcsz8CyEOyla9PlhdpXj6GSfCpAR041mnfHzdzsAhwyea4NHFJbkHBZu5YTFfrSXXqZZE26B5bDcfTV0BY1RWBNYDivlHjneiLMFIrtIA6gOCABZ32qoEbMKQiygsSLr19CN2AoV7IZQfr3uanIxt7k19xgcYg1wg0Lp0w==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Graham Potter opens up on the pressures of managing&nbsp;Chelsea when he joins&nbsp;Michael Calvin on the latest Football People podcast. Dominic Fifield and Anne Marie Batson agree that he should be given time to build a new team. The panel also focuses on the Manchester and North London derbies.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Graham Potter opens up on the pressures of managing&nbsp;Chelsea when he joins&nbsp;Michael Calvin on the latest Football People podcast. Dominic Fifield and Anne Marie Batson agree that he should be given time to build a new team. The panel also focuses on the Manchester and North London derbies.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>End Of Year Review</title>
			<itunes:title>End Of Year Review</itunes:title>
			<pubDate>Tue, 20 Dec 2022 06:00:11 GMT</pubDate>
			<itunes:duration>1:01:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63a0a92668d14400110364d7/media.mp3" length="147328448" type="audio/mpeg"/>
			<guid isPermaLink="false">63a0a92668d14400110364d7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/end-of-year-review</link>
			<acast:episodeId>63a0a92668d14400110364d7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>end-of-year-review</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz96dpk7Lje9eXrOms6490/aQVR0/RKIXhcMUMlC+K+c+lzYrbctz6E/bRDxOqkZmQ7B5xkLzqXhTWslqnVe/Aer7Wch4c8tt84RyM9V+JpGjplKzeunG1DkkMNOFLesbt22o0+tPNp8xKmVs2mbsO0akBd2F7D0GIzrZ+Hlu3nPof2UYAKXJcyUlgO5buBroBJh8FHft3xx443BUkCkLB3h9VskDNXEANOGGAe9d9/7G9lTs0tRVC41QscYq9YJuxu6lU3PoHLkK3s8CBjDKhacw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Michael Calvin is joined by David Preece, Miguel Delaney and Adrian Clarke on a special edition of the Football People podcast. They reflect on the World Cup, and assess the season so far, with contributions from Mikel Arteta, Emma Hayes, Graham Potter, David Weir, Frank Lampard, Jamie Vardy, Brendan Rodgers, Patrick Vieira and Professor Simon Chadwick.&nbsp;</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Michael Calvin is joined by David Preece, Miguel Delaney and Adrian Clarke on a special edition of the Football People podcast. They reflect on the World Cup, and assess the season so far, with contributions from Mikel Arteta, Emma Hayes, Graham Potter, David Weir, Frank Lampard, Jamie Vardy, Brendan Rodgers, Patrick Vieira and Professor Simon Chadwick.&nbsp;</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Professor Simon Chadwick - An Era-Defining World Cup</title>
			<itunes:title>Professor Simon Chadwick - An Era-Defining World Cup</itunes:title>
			<pubDate>Thu, 15 Dec 2022 14:04:51 GMT</pubDate>
			<itunes:duration>57:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/639b2983691e1f00111ca7d5/media.mp3" length="137904128" type="audio/mpeg"/>
			<guid isPermaLink="false">639b2983691e1f00111ca7d5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/professor-simon-chadwick-an-era-defining-world-cup</link>
			<acast:episodeId>639b2983691e1f00111ca7d5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>professor-simon-chadwick-an-era-defining-world-cup</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Zqa8QSSoGpUw/jlBHOMRU2r23GIIsYn5kNy9FQ/NI0h0EuChV15jItTplg8uaUXny4yvDAC2Jr9aibdEjGnFDEM/DcgfELBESCRV59+4TmifWh2FT+mZ0ui3N+ytQMwZnsXW8NdtMq0XX4wX4H+D/9sIkUoQoFHyJOobgaaafqUQjSfeABNXaM6t4341o5nNzWRjfbP03cM9R82oCGL6acOQVLwe0EcONxNv+AbKr/QJuiwKq5qPXo2aw9zomuznDG/WW+s6xARgo5BEsQaPew==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Michael Calvin is joined on the Football People podcast by Professor Simon Chadwick, who outlines the game's future in the context of a hugely significant World Cup in Qatar. Paul Hayward and Dominic Fifield analyse his observations, and discuss the chances of Lionel Messi confirming&nbsp;his greatness in Sunday's final against France.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Michael Calvin is joined on the Football People podcast by Professor Simon Chadwick, who outlines the game's future in the context of a hugely significant World Cup in Qatar. Paul Hayward and Dominic Fifield analyse his observations, and discuss the chances of Lionel Messi confirming&nbsp;his greatness in Sunday's final against France.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[David Weir - Searching for Football's Raw Diamonds]]></title>
			<itunes:title><![CDATA[David Weir - Searching for Football's Raw Diamonds]]></itunes:title>
			<pubDate>Thu, 08 Dec 2022 13:20:09 GMT</pubDate>
			<itunes:duration>1:06:31</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6391e48ae4331300111e5b8c/media.mp3" length="159679808" type="audio/mpeg"/>
			<guid isPermaLink="false">6391e48ae4331300111e5b8c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/david-weir-searching-for-footballs-raw-diamonds</link>
			<acast:episodeId>6391e48ae4331300111e5b8c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>david-weir-searching-for-footballs-raw-diamonds</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Dw1gWWXOPwSbw5AUI/enEcWCbX+K0WQxuHQlRmhQeXXWWyd9eIopeVHkJZEEIaHuqcP79lbS6ethePVj0Ix6yuZnwuqf7Jfw3sY3daEdLDSwtjB1pjCYzNfQS6TAk1b3u9imrdtfF+IOQ2JKNisLqzw3FPY8Bak+ufQNDYpxPdhhwUG67JQ0qdLuXEJbDAqTcKyz/msUt5KUsZe0jRiVt2zaMettmkycIkVyyIu1cW0dnoV6EHajg1v5SsX0eP232JuQ7BlOphnQM4k3+mwrpg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[David Weir, Brighton's technical director, joins Michael Calvin to discuss the&nbsp;global search for football talent, in the context of the first Arab World Cup. Tony Hodson and Richard Amofa provide additional insight, previewing the quarter finals. Do you agree with the panel's predictions for the last four?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[David Weir, Brighton's technical director, joins Michael Calvin to discuss the&nbsp;global search for football talent, in the context of the first Arab World Cup. Tony Hodson and Richard Amofa provide additional insight, previewing the quarter finals. Do you agree with the panel's predictions for the last four?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Tom Young - Southgate's Winning Mindset]]></title>
			<itunes:title><![CDATA[Tom Young - Southgate's Winning Mindset]]></itunes:title>
			<pubDate>Thu, 01 Dec 2022 14:24:34 GMT</pubDate>
			<itunes:duration>58:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6388b922b5a6630010c46abe/media.mp3" length="139797248" type="audio/mpeg"/>
			<guid isPermaLink="false">6388b922b5a6630010c46abe</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/tom-young-southgates-winning-mindset</link>
			<acast:episodeId>6388b922b5a6630010c46abe</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>tom-young-southgates-winning-mindset</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9ZAPADBWi5zo90llYpi5gWX0kVfU8mkqnyLwpwlqCe8/pWa+BIE/MYoqNPqyyrJ2i7uDnENOlG6lnBLrxqxEz32hIu5TJtZrWfJyNHZ/nq1AwKebMqcTFQzaOmHGqyJk6q5Wmx7ZKSAhjoKqRoJHq9e/ceTWn6/vtptEXQi/mV32LHWFniQSxAc1YrgTXGXqZwSbmkyXv17LWpDAkZT0DQrqNyuAuX1Z83EiOC1cZNjE6KxhlX6rYCp/m4TxfCXoc0mffCkj+3PuJwYfT5UKN4Q==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[With England preparing to face Senegal in the knockout stages in Qatar, leading sports psychologist Tom Young joins Michael Calvin on the latest Football People podcast. Paul Hayward and Jonathan Northcroft concur with Young's positive assessment of Gareth Southgate's management, and name England among four teams who could win this World Cup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[With England preparing to face Senegal in the knockout stages in Qatar, leading sports psychologist Tom Young joins Michael Calvin on the latest Football People podcast. Paul Hayward and Jonathan Northcroft concur with Young's positive assessment of Gareth Southgate's management, and name England among four teams who could win this World Cup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Luke Williams - How the Other Half Live</title>
			<itunes:title>Luke Williams - How the Other Half Live</itunes:title>
			<pubDate>Thu, 24 Nov 2022 06:00:04 GMT</pubDate>
			<itunes:duration>57:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/637e4fa55b8fe10010aafa6b/media.mp3" length="138576128" type="audio/mpeg"/>
			<guid isPermaLink="false">637e4fa55b8fe10010aafa6b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/luke-williams-how-the-other-half-live</link>
			<acast:episodeId>637e4fa55b8fe10010aafa6b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>luke-williams-how-the-other-half-live</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9GK9sblaxlzqCok0/IHzFl71Rq8VgV1D3McUz/TF9ySA+68L6WQrZE5nCeRLIm53bzR+i0CLu94wb0GN7G8/JpstRNLqtcgy1p/JMa+974er7R8ct2EWoNeopJn/lxpWR8EvOCMlQVsPKprRWLYUkwXIRsWRCiMp1Tm0ewwjNFzXrdymHiXwiAs21TnwBOtaNAyA1C99MlT4wtgq3w8/ADzVSLpvU4SN1Ie/5K92KkruVdDTQKLZu244Bj/osXZ4qXvfxbpOlvovq7eN9AoNepg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Notts County attracted a sell out 16,500 crowd last weekend. Luke Williams, their head coach, joins Michael Calvin, David Preece and Adrian Clarke on the latest Football People podcast. They discuss County's analytical&nbsp;approach, FIFA's political power plays, Manchester United's sale and England and Wales' next games in Qatar.not<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Notts County attracted a sell out 16,500 crowd last weekend. Luke Williams, their head coach, joins Michael Calvin, David Preece and Adrian Clarke on the latest Football People podcast. They discuss County's analytical&nbsp;approach, FIFA's political power plays, Manchester United's sale and England and Wales' next games in Qatar.not<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Glenn Hoddle - World Cup Preview</title>
			<itunes:title>Glenn Hoddle - World Cup Preview</itunes:title>
			<pubDate>Thu, 17 Nov 2022 06:00:15 GMT</pubDate>
			<itunes:duration>1:04:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63750ba7a3f428001187e488/media.mp3" length="155838848" type="audio/mpeg"/>
			<guid isPermaLink="false">63750ba7a3f428001187e488</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/glenn-hoddle-world-cup-preview</link>
			<acast:episodeId>63750ba7a3f428001187e488</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>glenn-hoddle-world-cup-preview</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Sg+npGw7XZx9kyhC2fDDKWxK/ZSG9hDAap4EYJ79GiurpY0jgys5qEp/zF4U0yM6H9DSALYuX2MY9n0f/UDYYVhAc4ywzafFUuTwu6FmeZLAxqdevj1C/BcuZEX1oiNIMdH70weXqRcRzTE85PAAgMCn3V8HjzR7YO+/7UEE3L82zazuVAvkJbwe2WVSphHNZVZWA/UmzcumRpA7d/wm7c93WP6ThUNbUe5qGle+sTx8KkDlL6yhFiec9D5k2TQMC6ZVb8GW4fXH7aBaUJ2LiQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Glenn Hoddle shares World Cup memories, as a fan, player and manager, with Michael Calvin in the latest edition of the Football People podcast. Jonathan Northcroft, in Qatar, and Tony Hodson agree with Glenn's prediction that Brazil will win, and also examine the controversy swirling around the tournament.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Glenn Hoddle shares World Cup memories, as a fan, player and manager, with Michael Calvin in the latest edition of the Football People podcast. Jonathan Northcroft, in Qatar, and Tony Hodson agree with Glenn's prediction that Brazil will win, and also examine the controversy swirling around the tournament.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Owen Hargreaves - The Inside Track</title>
			<itunes:title>Owen Hargreaves - The Inside Track</itunes:title>
			<pubDate>Thu, 10 Nov 2022 06:00:07 GMT</pubDate>
			<itunes:duration>1:06:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/636bdd1958edfe001292e5d6/media.mp3" length="158595008" type="audio/mpeg"/>
			<guid isPermaLink="false">636bdd1958edfe001292e5d6</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/owen-hargreaves-the-inside-track</link>
			<acast:episodeId>636bdd1958edfe001292e5d6</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>owen-hargreaves-the-inside-track</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz92jqP7jHaRjihzWvPkvXhwrU2wn4f2MVNjlRqQF7/QWqx6nBZUQI5CGz4jFMudjhTqLpEjEnHF1ivedQGxj46Ss/5C9qGJax/3Zt5H0i4nRWu0Oz4OD1toJwyTf96EYbnmx9m8J6RmYzdM5Winye39RP/DGPPk69KwZrGE/g17V3VoBRi6fVU8xwwwzauuls+A5oLJPHjIOy5jcBBuuhXnwMoqZmYx97iWB95DsUxw324GqM3xFh2FMWPujYxJCeElpXvsvH3vxNMwkA2cMJ1lg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Owen Hargreaves joins Michael Calvin to discuss the mentality of England's Golden Generation, the breeding ground of the Bundesliga, and the prospects of Gareth Southgate's squad in Qatar. John Cross and Dominic Fifield add their insight into a controversial&nbsp;World Cup, and examine the implications of Liverpool being up for sale.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Owen Hargreaves joins Michael Calvin to discuss the mentality of England's Golden Generation, the breeding ground of the Bundesliga, and the prospects of Gareth Southgate's squad in Qatar. John Cross and Dominic Fifield add their insight into a controversial&nbsp;World Cup, and examine the implications of Liverpool being up for sale.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Jamie Vardy - Never Give Up</title>
			<itunes:title>Jamie Vardy - Never Give Up</itunes:title>
			<pubDate>Thu, 03 Nov 2022 06:00:49 GMT</pubDate>
			<itunes:duration>57:48</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63629f046c4c490011935f31/media.mp3" length="138746684" type="audio/mpeg"/>
			<guid isPermaLink="false">63629f046c4c490011935f31</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/jamie-vardy-never-give-up</link>
			<acast:episodeId>63629f046c4c490011935f31</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>jamie-vardy-never-give-up</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9/CLBZMF5p89EpDCIOZoxDz1edVm2SlUqliedX7QDLMmtO53bwhbPJdOyNnUOIx2U5HOIBUZ2bpuYPMeqlpQCovITDm/KKT3C/2TvQ8Xh9sr3u6BEKuK4W9i+n4WfI8DAQaWvZh+9NU1OmhsewAOyRiNyGhmhFqi5aDbu9Pztc90VMPo4KpgWDgT64vE1gfNevGLhLiwjlVtnXlQMDsxXUOzweuW6LcKKMqiVhSFkewn2k/bFbmdcHTe1w5t+d6Hoadg6PQMbKKRqhdyn+XZGgg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Jamie Vardy, released at 16, Premier League record breaker at 35, shares the secrets of his career with Michael Calvin in the latest Football People podcast. Ex-pros Adrian Clarke and David Preece assess his impact, and look forward to the knockout stages of the Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Jamie Vardy, released at 16, Premier League record breaker at 35, shares the secrets of his career with Michael Calvin in the latest Football People podcast. Ex-pros Adrian Clarke and David Preece assess his impact, and look forward to the knockout stages of the Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Patrick Vieira - Taking it to the Streets</title>
			<itunes:title>Patrick Vieira - Taking it to the Streets</itunes:title>
			<pubDate>Thu, 27 Oct 2022 05:00:13 GMT</pubDate>
			<itunes:duration>56:48</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6359580559af790011fca42d/media.mp3" length="136325888" type="audio/mpeg"/>
			<guid isPermaLink="false">6359580559af790011fca42d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/patrick-vieira-taking-it-to-the-streets</link>
			<acast:episodeId>6359580559af790011fca42d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>patrick-vieira-taking-it-to-the-streets</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz91H5tuYGMdKwrllllusxAcUN2elvezIUXE8RDTeZz4VssqBc5zm60zZw7J53Yv2+oZ/otPdXNJofMGvgOW35lkMtRQbZ3+2h+9pPE/Z6nFt8Zy/arDywm5LNSY/SZ3G4dzZ+41TFyiP4P6j+EHZ33y1I5CM7fkNGTu9EiRVif5k0Mcq974lcUKE4MMJpdhodZC3qPxbgMRXcMU9bozXHxR7IDFJot7cQjAB6pt997PSVG2wTJeGlJBZKKM566Al50nhEW0pf3ozZUHTBOxgfdVA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Crystal Palace manager Patrick Viera talks to Michael Calvin on the latest Football People podcast about the potential of the South London talent pool, and a new generation of street footballers. Miguel Delaney and Richard Amofa outline the value of his empathetic approach, and look at Unai Emery's replacement of Steven Gerrard at Aston Villa.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Crystal Palace manager Patrick Viera talks to Michael Calvin on the latest Football People podcast about the potential of the South London talent pool, and a new generation of street footballers. Miguel Delaney and Richard Amofa outline the value of his empathetic approach, and look at Unai Emery's replacement of Steven Gerrard at Aston Villa.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Brendan Rodgers - Managing Under Pressure</title>
			<itunes:title>Brendan Rodgers - Managing Under Pressure</itunes:title>
			<pubDate>Thu, 20 Oct 2022 05:00:35 GMT</pubDate>
			<itunes:duration>52:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63500b0509f152001117896b/media.mp3" length="125609408" type="audio/mpeg"/>
			<guid isPermaLink="false">63500b0509f152001117896b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/brendan-rodgers-managing-under-pressure</link>
			<acast:episodeId>63500b0509f152001117896b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>brendan-rodgers-managing-under-pressure</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9QqYFDfwHeONGyEJ+XBk0Yke7RsyNXjqjR+GnqdNz8nG3D/jIpz4TwsQzn10dNN21x5+frQL83StPLEh4r5Nr1RiYxAPf8/eI0wfIAivrfTIyFjXxXvqOl44GnVCe6zG6+D+VP/vRdgvV0r+m79F6C/5b8UTr1MvgnZ1I2L+Ff5q5/brk3UIOFlceIzGv1Lrjvf4UhH2SIOy86lqfr8ZOID/k9TiOGXFsEAuUucHhBhuPyq2+ZOSi6ykHETnf+fofSqQuG+rIeeqvxQtYxM97pQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Brendan Rodgers tells Michael Calvin how he deals with the constant&nbsp;pressure of people calling for him to be sacked at Leicester. Paul Hayward and David Preece join them in the latest edition of the&nbsp;Football People podcast to discuss intensity of expectation, and the way managers are sacrificed in the modern game.&nbsp;</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Brendan Rodgers tells Michael Calvin how he deals with the constant&nbsp;pressure of people calling for him to be sacked at Leicester. Paul Hayward and David Preece join them in the latest edition of the&nbsp;Football People podcast to discuss intensity of expectation, and the way managers are sacrificed in the modern game.&nbsp;</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Frank Lampard - Regret, Reflection & Renewal]]></title>
			<itunes:title><![CDATA[Frank Lampard - Regret, Reflection & Renewal]]></itunes:title>
			<pubDate>Thu, 13 Oct 2022 05:00:46 GMT</pubDate>
			<itunes:duration>55:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6346d8c1eb77e20011288afd/media.mp3" length="133071488" type="audio/mpeg"/>
			<guid isPermaLink="false">6346d8c1eb77e20011288afd</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/frank-lampard-regret-reflection-renewal</link>
			<acast:episodeId>6346d8c1eb77e20011288afd</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>frank-lampard-regret-reflection-renewal</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz95814T7uaVm63/NHlA0iRV6LvM8uZhSRD59znLgZYZWcbDa5vCXZva5Y++UvxQUKEScO/btIP80qha3nx9Gh8lqFs3v8QIC2p+qyxaq2DIjQIkMsboRUr726ENnUwtO4LbdWCJXwfGsrJ8JHkNRqjwNRrC+Qj7B/hevkHC/yJx5zcES2dIreyH6Gw1gF9vtQievV6i/8QVFR6r+g0eMaD1xVATBqa7aiE8H5pU3JF5PgBKjKoRmbllqHPF5BL98CL1LL37OUO6N9eweM8zjdpFA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Everton manager Frank Lampard joins Michael Calvin on the latest&nbsp;Football People podcast, to reflect on the lessons of his career. Jonathan Northcroft and Dominic Fifield assess his impact&nbsp;on Merseyside, and the implications of Newcastle applying new-found financial&nbsp;and political muscle.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Everton manager Frank Lampard joins Michael Calvin on the latest&nbsp;Football People podcast, to reflect on the lessons of his career. Jonathan Northcroft and Dominic Fifield assess his impact&nbsp;on Merseyside, and the implications of Newcastle applying new-found financial&nbsp;and political muscle.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Mikel Arteta - Rebuilding Arsenal in His Own Image</title>
			<itunes:title>Mikel Arteta - Rebuilding Arsenal in His Own Image</itunes:title>
			<pubDate>Thu, 06 Oct 2022 05:00:51 GMT</pubDate>
			<itunes:duration>1:01:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/633da7d868f5920011139c03/media.mp3" length="148064768" type="audio/mpeg"/>
			<guid isPermaLink="false">633da7d868f5920011139c03</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mikel-arteta-rebuilding-arsenal-in-his-own-image</link>
			<acast:episodeId>633da7d868f5920011139c03</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mikel-arteta-rebuilding-arsenal-in-his-own-image</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9/MILZpYPr/WdP747hRcS3SHc5VXdc1gu4fSy9H0unOSPR3LYKu2eay7MssEOWYPrIN1MnBzvbtNx9rlSY884/Sm78Yg0Pdaa3OVV+J3LpoMo0S6GSbs+mxCp4OKVH1G7lnFfKc6V6MeO6GSGaqn7mBqDbXQPjiztqX4K55mgOZLKFdkKVphu3ShDaXIk9Ablr7/oa7bpGPQ0vEHI0xI7KOFjHcvLslrJywD/PaaOW4OYjRVon1O/4YSuDN3tBcIq9dJ6c951mLu7awbo3mPKeg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mikel Arteta gives Michael Calvin a unique insight into his managerial style and philosophy in the latest Football People podcast. The Arsenal boss is praised by John Cross and Seb Stafford Bloor, who also dwell on Manchester City's potential dominance, and Liverpool's struggle to sustain their challenge.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mikel Arteta gives Michael Calvin a unique insight into his managerial style and philosophy in the latest Football People podcast. The Arsenal boss is praised by John Cross and Seb Stafford Bloor, who also dwell on Manchester City's potential dominance, and Liverpool's struggle to sustain their challenge.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Liam Manning - Education of a Coach</title>
			<itunes:title>Liam Manning - Education of a Coach</itunes:title>
			<pubDate>Thu, 29 Sep 2022 05:00:03 GMT</pubDate>
			<itunes:duration>54:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/633499c30d27d30012574a1a/media.mp3" length="130596608" type="audio/mpeg"/>
			<guid isPermaLink="false">633499c30d27d30012574a1a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/liam-manning-education-of-a-coach</link>
			<acast:episodeId>633499c30d27d30012574a1a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>liam-manning-education-of-a-coach</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9dsFSl1Sesxm4GnEOhzIMfmPx8c5ICB8JiWrIEA1MmIwOE8XA7PtP75B/zh6ViJsbMUjMix00KTgS9iw3FlvWCrlCkwLp1BHIDsMThqAAoP2pzvk+bCQBbbtHaQ7vks7sDx0xr8I9RhxWLt8v7/zEw+FjXTg9lvRG5QQvNxNX5GjNFmFOmMTg4hOa49cSRjQq75SHh25HGEtiova9Y/MTfSNHUqIAPNaR1QW/rJTyVi1brTH4rIWI0n308rUC+PvHVOU2B/0Rn+kvE2R0Zi8chA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Adrian Clarke and Tony Hodson to discuss the North London derby, Manchester City's dominance, and the coaching styles of Mikel Arteta, Antonio Conte, Roberto di Zerbi and Graham Potter. One of the game's brightest young managers, Liam Manning of MK Dons, is Mike's guest on the latest edition of the Football People podcast.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Adrian Clarke and Tony Hodson to discuss the North London derby, Manchester City's dominance, and the coaching styles of Mikel Arteta, Antonio Conte, Roberto di Zerbi and Graham Potter. One of the game's brightest young managers, Liam Manning of MK Dons, is Mike's guest on the latest edition of the Football People podcast.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Joey Barton - The strains and sacrifices of football management</title>
			<itunes:title>Joey Barton - The strains and sacrifices of football management</itunes:title>
			<pubDate>Thu, 22 Sep 2022 05:00:26 GMT</pubDate>
			<itunes:duration>58:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/632b1ec3afb41a00120ac92e/media.mp3" length="139912832" type="audio/mpeg"/>
			<guid isPermaLink="false">632b1ec3afb41a00120ac92e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/joey-barton-the-strains-and-sacrifices-of-football-managemen</link>
			<acast:episodeId>632b1ec3afb41a00120ac92e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>joey-barton-the-strains-and-sacrifices-of-football-managemen</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9LSEf1qF8hYEh9ME+sOXkjnau9BaK2x3ThorbiZuYcx0zGomfytSckmBklvbL3iwcyG5X5b+RoM3hk7yjRy9/COpJCN1U6yyP55ujVkd3juVjIkVFm1n9oVxa58hVQy4bZSCR2V5NX3fIui/xD02uONuBRoBjlPFdhsvL1FunlnMLZKr5xsIBCT7rtbTcitNG8WsjyO8kzZnfjNCKhQcMAeeJmPiUJdUwGZQ94oEJkLULEhr67BH67IIZrV3VNHV+QOJxORM044KKTGtxIGw5oA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Lucy Ward and David Preece dwell on the pressure of management in the latest&nbsp;edition of the Football People podcast. They respond to an in-depth conversation with Joey Barton, which&nbsp;touches on the strains of living away from home in a notoriously insecure profession.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Lucy Ward and David Preece dwell on the pressure of management in the latest&nbsp;edition of the Football People podcast. They respond to an in-depth conversation with Joey Barton, which&nbsp;touches on the strains of living away from home in a notoriously insecure profession.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Professor Simon Chadwick - Football Will Never Be The Same Again</title>
			<itunes:title>Professor Simon Chadwick - Football Will Never Be The Same Again</itunes:title>
			<pubDate>Thu, 15 Sep 2022 12:36:13 GMT</pubDate>
			<itunes:duration>56:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/63231c3dcf388e001522550b/media.mp3" length="136740608" type="audio/mpeg"/>
			<guid isPermaLink="false">63231c3dcf388e001522550b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/professor-simon-clifford-football-will-never-be-the-same-aga</link>
			<acast:episodeId>63231c3dcf388e001522550b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>professor-simon-clifford-football-will-never-be-the-same-aga</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9MnCZSYwDj0VM7G3mbI20tso+t50G8dEfz+SlC8p3vGaVN0E3UxnrnNeV03x+dBsCKGOjE3eRhIGAZLpWQUh9IiJqSlnz+j6WGge0Urro9JK+c2XUXcHM9LZ6Dn8OqIXDuH3MYKUdZxPvQIOmrtCaqdP9/CvbzXjbOmFnYQziO1xoS9cqTYOJPTsJl9wc2/c+Z3T057F77Wr4eiX22xR0uiHIgkRYjx8ZIEhgMC3C2Vd5Ew+vc4Cd/qSpDH5oFvMfMOX0AMR3RZphLzTdOviYzQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Michael Calvin gets a dispiriting glimpse into football's future from Professor Simon Chadwick, his latest guest on the Football People podcast. In addition to reviewing the&nbsp;Champions League, Miguel Delaney and Seb Stafford Bloor discuss the growing influence of Gulf states and the business principles of US investors on the global game.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Michael Calvin gets a dispiriting glimpse into football's future from Professor Simon Chadwick, his latest guest on the Football People podcast. In addition to reviewing the&nbsp;Champions League, Miguel Delaney and Seb Stafford Bloor discuss the growing influence of Gulf states and the business principles of US investors on the global game.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Andy Holt - Rich Men, Poor Men</title>
			<itunes:title>Andy Holt - Rich Men, Poor Men</itunes:title>
			<pubDate>Thu, 08 Sep 2022 11:16:42 GMT</pubDate>
			<itunes:duration>1:06:25</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6319cf1ae09d2c0013530745/media.mp3" length="159416840" type="audio/mpeg"/>
			<guid isPermaLink="false">6319cf1ae09d2c0013530745</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/rich-men-poor-men</link>
			<acast:episodeId>6319cf1ae09d2c0013530745</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>rich-men-poor-men</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9kOl23G4KZTiGUUfFHY228OL3SIuetpsMOe2dfsDaQ5Brst7ov0B9iiVGPKsTyb2FhMTenrDlS/x278e+uUGGeDV9DCdmcbbW1vgU5I0HL0/6Mdx3aU+sOuohrJzSgn0tfVvUXipt84wol4VBExB3a+j2PwiaruepheVTEvXB51yzT4KP90/LPff1BnJRPtdsqqOJuI63FKQhFAwjUqpZG7/eOX/n5MFl3I/x0hfkb53vICaUCLURjdj2qaYCl2tAA0/174IxwkrbSwStt1Ce1w==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Michael Calvin is joined by John&nbsp;Cross and Anne Marie Batson to discuss the fallout from the sacking of Thomas Tuchel, and Chelsea's move to replace him with Graham Potter. Michael finds an instructive contrast in the approach of Accrington Stanley owner Andy Holt, his special guest&nbsp;on the latest edition of the Football People podcast.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Michael Calvin is joined by John&nbsp;Cross and Anne Marie Batson to discuss the fallout from the sacking of Thomas Tuchel, and Chelsea's move to replace him with Graham Potter. Michael finds an instructive contrast in the approach of Accrington Stanley owner Andy Holt, his special guest&nbsp;on the latest edition of the Football People podcast.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Stuart Webber - Striking Out for the Summit</title>
			<itunes:title>Stuart Webber - Striking Out for the Summit</itunes:title>
			<pubDate>Thu, 01 Sep 2022 05:00:20 GMT</pubDate>
			<itunes:duration>1:05:51</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/630f85b599660b00132703f9/media.mp3" length="158047112" type="audio/mpeg"/>
			<guid isPermaLink="false">630f85b599660b00132703f9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/stuart-webber-striking-out-for-the-summit</link>
			<acast:episodeId>630f85b599660b00132703f9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>stuart-webber-striking-out-for-the-summit</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9peAWKmH7jLSONVqI1SUIYRYvUBNM/WO98uEhaNK3TjgvYWCQILugXyPDhMTfPSQdTMo7WCYd/PdV2pp7W8JHLU8RzUfSkznFtMMkuoazwrUqYf2TZKBXk3tUSTSmv0C2+PWn+2OCRTjMBbp8I/IC/is2y4N2wBV9ahfJUWBb0Wx/knJH5qg0KfE9GUQADIWyqpGqIYrxsE+XiL+zVYGsbgI9w2FQuHp9U/5w/AC7P9hiUeCxbtC1JV2oT4+bYN5VuM6ZcpkGUANfIi6WQI5VBw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Michael Calvin is joined by Stuart Webber, Norwich's Sporting Director, who is preparing to climb Mount Everest. He talks about the "blessing and the curse" of being a yo-yo club, and his vision for the future of the game in general. Paul Hayward and Richard Amofa discuss the influence of Sporting Directors, and also analyse the winners and losers in the summer transfer window.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Michael Calvin is joined by Stuart Webber, Norwich's Sporting Director, who is preparing to climb Mount Everest. He talks about the "blessing and the curse" of being a yo-yo club, and his vision for the future of the game in general. Paul Hayward and Richard Amofa discuss the influence of Sporting Directors, and also analyse the winners and losers in the summer transfer window.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Alan Redmond - The global search for young talent</title>
			<itunes:title>Alan Redmond - The global search for young talent</itunes:title>
			<pubDate>Thu, 25 Aug 2022 05:00:16 GMT</pubDate>
			<itunes:duration>1:06:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/630649eb9da665001389a42d/media.mp3" length="158428172" type="audio/mpeg"/>
			<guid isPermaLink="false">630649eb9da665001389a42d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/alan-redmond-the-global-search-for-young-talent</link>
			<acast:episodeId>630649eb9da665001389a42d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>alan-redmond-the-global-search-for-young-talent</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9+wwSr24t/YovZYRc7wyzvyJYc6gPOItQ4f7rny49+NLe2Nvze22I8nBAzseqtVHMYkUh26zdCauxUcyYQUaJZe9rqAsDDMvC/h3DYyGokLS8HJPK4tHXMtdA/HB2bvSqS2vyb2jraeMz9UBW0L7zbwy3UHsatU8QLIpySJZvqdyz22LAMTL4h4G9kNKS2PVQ5u6NL5xH1GUsKqvqMK3r5e/HESq6jECBiw9uFCSZ69asyk+vnwS3eMygUnabE6cD5+O7y2oJWoCL2K73wf31IA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Michael Calvin is joined by Alan Redmond, Global Head of Football for Roc Nation, to discuss the transfer market, and the global search for the best young footballers. Jonathan Northcroft and Dominic Fifield also appear in the&nbsp;latest Football People podcast, casting their expert eyes on potential winners and losers in the last week of the summer window.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Michael Calvin is joined by Alan Redmond, Global Head of Football for Roc Nation, to discuss the transfer market, and the global search for the best young footballers. Jonathan Northcroft and Dominic Fifield also appear in the&nbsp;latest Football People podcast, casting their expert eyes on potential winners and losers in the last week of the summer window.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Graham Potter - Money isn't everything]]></title>
			<itunes:title><![CDATA[Graham Potter - Money isn't everything]]></itunes:title>
			<pubDate>Thu, 18 Aug 2022 05:00:12 GMT</pubDate>
			<itunes:duration>1:04:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62fd0f2de0c13d001228f7e4/media.mp3" length="154135244" type="audio/mpeg"/>
			<guid isPermaLink="false">62fd0f2de0c13d001228f7e4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/graham-potter-money-isnt-everything</link>
			<acast:episodeId>62fd0f2de0c13d001228f7e4</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>graham-potter-money-isnt-everything</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9iEDTF7drLHoDWEvCXdtea0RQV608aCnIU19FLtHXdNRf7yDov2yaOrPLhhABpepNo8Qy1i7ox272o9cUvpPfrqilW7IzES2FUddXROK8wUx28m7w79Krr5YRAINXIwKOjZn0JyZQ8dIiI1Re6lR7IJmGZaqZfVU5AFc/PWCSCbQVQxh3JF2vqzZicJPC3I9gOcP34980VzqvujuWqCIMtgnzb5MtB97Nd0AA6A9MkV1L/EqHEe2BDaHC0yxU2mO3r3uSu42usDnerd2xonk3PA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Michael Calvin is joined by Graham Potter for a fascinating, far-reaching interview in the latest episode of the Football People Podcast. David Preece and Tony Hodson discuss his impact at Brighton, and the work of a range of coaches, from Antonio Conte to Eddie Howe and Erik Ten Hag.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Michael Calvin is joined by Graham Potter for a fascinating, far-reaching interview in the latest episode of the Football People Podcast. David Preece and Tony Hodson discuss his impact at Brighton, and the work of a range of coaches, from Antonio Conte to Eddie Howe and Erik Ten Hag.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Sean Dyche - Never Stop Learning</title>
			<itunes:title>Sean Dyche - Never Stop Learning</itunes:title>
			<pubDate>Thu, 11 Aug 2022 05:00:09 GMT</pubDate>
			<itunes:duration>1:07:16</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62f3d5ea90c08300133b1aaf/media.mp3" length="161463080" type="audio/mpeg"/>
			<guid isPermaLink="false">62f3d5ea90c08300133b1aaf</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-manchester-united-doomed-to-repeat-past-mistakes</link>
			<acast:episodeId>62f3d5ea90c08300133b1aaf</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-manchester-united-doomed-to-repeat-past-mistakes</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9gUHhkY8Ck4Z1i8cyph3vV/nOE5gpfykVp2UFPm5EAqmWFLZICMT+y0T23Lv/voSx+PrvB58VRpaFe/AL9VeYF3DULE23N/Ip5MozTZc05FcyMHgHCOsMS8xrYDx4xuH1HD4/PsMiBPr5a62y6+D1Vbh7BTY0aYGKEzZoF6vbUdRc1YQRiX9xBYR2pLCM5jOROXuO0+okqEXTvloo7vetx0p7GtnA3kv8ttWDCFQh/daQTpr1MY1VbNwAHMAgI1TZ36pvqitiH1eM6TJrFC/EZA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Michael Calvin, Lucy Ward and Seb Stafford-Bloor regard Manchester United as an object lesson in how not to run a football club, and contrast their approach with the clarity and innovation of Brighton and Brentford. The feature interview&nbsp;in this, the second episode of Michael Calvin's Football People, involves Sean Dyche talking about making the most of unemployment.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Michael Calvin, Lucy Ward and Seb Stafford-Bloor regard Manchester United as an object lesson in how not to run a football club, and contrast their approach with the clarity and innovation of Brighton and Brentford. The feature interview&nbsp;in this, the second episode of Michael Calvin's Football People, involves Sean Dyche talking about making the most of unemployment.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Emma Hayes - Time for Change</title>
			<itunes:title>Emma Hayes - Time for Change</itunes:title>
			<pubDate>Thu, 04 Aug 2022 05:00:37 GMT</pubDate>
			<itunes:duration>58:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62ea88e56c3e4e001294c21d/media.mp3" length="140574728" type="audio/mpeg"/>
			<guid isPermaLink="false">62ea88e56c3e4e001294c21d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/womens-football-will-never-be-the-same-again-but-will-a-fami</link>
			<acast:episodeId>62ea88e56c3e4e001294c21d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>womens-football-will-never-be-the-same-again-but-will-a-fami</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9wZMbIHwKJGGa7WC6Cy0QTy0JCXM6bvbtCr4yrhn4c+gId6vwzV1G/qyUaN/4t8kvoCJlFnGYcbaGedcyTX0k/DtwtydOyzu1NwuLWmoTsskO0H6W/4b1cSgbdtqt7R35ZFqYb0V9eNyg3t3k3yrhLiIfZLlg8aKKH5h0hdQfitHS5q/wZWt5z8zz6OucdeuwORtv0Q+jhU7G/7v6j1fgwSAuPbQ2i6FfHGVY5ObwAg5pGPa903iJTx1EPZC7LLr/WvWZ5WuS09hlok0B6gnKwg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[The first edition of Michael Calvin's Football People features leading sportswriters Paul Hayward and Miguel Delaney, on the scramble to keep up with Manchester City and Liverpool in a unique Premier League season. Emma Hayes is hailed for her wisdom, and talks about the need to revolutionise the women's game.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[The first edition of Michael Calvin's Football People features leading sportswriters Paul Hayward and Miguel Delaney, on the scramble to keep up with Manchester City and Liverpool in a unique Premier League season. Emma Hayes is hailed for her wisdom, and talks about the need to revolutionise the women's game.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Michael Calvin's Football People Trailer ]]></title>
			<itunes:title><![CDATA[Michael Calvin's Football People Trailer ]]></itunes:title>
			<pubDate>Tue, 02 Aug 2022 11:00:00 GMT</pubDate>
			<itunes:duration>1:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62e8fb7d5d91ec0014290995/media.mp3" length="2557928" type="audio/mpeg"/>
			<guid isPermaLink="false">62e8fb7d5d91ec0014290995</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/michael-calvins-football-people-trailer</link>
			<acast:episodeId>62e8fb7d5d91ec0014290995</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>michael-calvins-football-people-trailer</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9/MH8C3thgKz7xOQfr17/Js6vZThxpHYF+N81KgTa1n80Vq5MKYKgWrV0Tup+VP0OCxFmQJLvjVp9KtYwZMMFY5y71Pj+SyPJ+iKwt3SvLU/HjY/+n/LURbnljYKXH7b2AjtW+lkXbQrhZyU5L3whqqycDt1diMhog4+EqqIKQaoruJ2oyHn3IGoAjt+eMlg4eHjPYOxe0U0oQ7hLHo78MD18p1vNqK4rA6MueDofQHU=]]></acast:settings>
			<itunes:episodeType>trailer</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Michael Calvin’s Football People will retain the best features from the Football Writers Podcast, but take it closer to the heart of the game. Mike will still be hosting the best journalists, discussing the biggest issues. The tone won’t change. Informed, insightful, intelligent rather than inane. We'll also feature extended interviews with managers, coaches, players, support staff, club owners, scouts, &amp; agents. </p><br><p>First episode out on Thursday 4th August! </p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Michael Calvin’s Football People will retain the best features from the Football Writers Podcast, but take it closer to the heart of the game. Mike will still be hosting the best journalists, discussing the biggest issues. The tone won’t change. Informed, insightful, intelligent rather than inane. We'll also feature extended interviews with managers, coaches, players, support staff, club owners, scouts, &amp; agents. </p><br><p>First episode out on Thursday 4th August! </p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>What challenges must football confront, to secure its future?</title>
			<itunes:title>What challenges must football confront, to secure its future?</itunes:title>
			<pubDate>Mon, 30 May 2022 14:37:54 GMT</pubDate>
			<itunes:duration>54:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6294d6c249e3da0012fe2b23/media.mp3" length="130529360" type="audio/mpeg"/>
			<guid isPermaLink="false">6294d6c249e3da0012fe2b23</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/what-challenges-must-football-confront-to-secure-its-future</link>
			<acast:episodeId>6294d6c249e3da0012fe2b23</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>what-challenges-must-football-confront-to-secure-its-future</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9UxD+lXo9j7h6cmCeGCoi/7gqra2qCLNIcyUiEvmtErjfFlvAa+YF+UtDbVYI/HQKDk7WL7qkUjW3hHx6QGSrfylgKy7puD+nvOeDJPWA/0aFxxHfAIJ3qcIb7lWPlOOWJJyLCwRdekOLRYHNKkQIalLBlIe4nfttA6Sd4z2XeG0Kdl6ax5Bp7yDqDU8ElxCF+m21wBIc/9/QxmW8Z3VefQFmX36PCSOWZMeNu6WwpoPmK1YRurv4WviWfsKJZx9dmGj94OWYMe4wJPFt8dj2mA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, John Cross and Paul Hayward examine the chaos surrounding Liverpool's failure to win the Champions League. They consider the implications of Manchester City's dominance, from Under16 level upwards, and map out the evolution of Jurgen Klopp's next great team. They also look outside the top two, to name their alternative winners and losers of a significant season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Paul Hayward examine the chaos surrounding Liverpool's failure to win the Champions League. They consider the implications of Manchester City's dominance, from Under16 level upwards, and map out the evolution of Jurgen Klopp's next great team. They also look outside the top two, to name their alternative winners and losers of a significant season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Liverpool win the Champions League for the seventh time in Paris on Saturday night?</title>
			<itunes:title>Will Liverpool win the Champions League for the seventh time in Paris on Saturday night?</itunes:title>
			<pubDate>Thu, 26 May 2022 14:21:47 GMT</pubDate>
			<itunes:duration>53:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/628f8cd71c31270012968949/media.mp3" length="127381700" type="audio/mpeg"/>
			<guid isPermaLink="false">628f8cd71c31270012968949</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/will-liverpool-win-the-champions-league-for-the-seventh-time</link>
			<acast:episodeId>628f8cd71c31270012968949</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>will-liverpool-win-the-champions-league-for-the-seventh-time</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9TtKtRYQLU01F5xUo8r+hcuVcHPuHd3dCjrXP0Mbrd3tImLmhlLFI39BIrcRrtPe9YnDmjQhFMZH1BpZUG5uSrTAcQEFvq0XpH6tLqol1wjj6byx7cpBXDbGX1ko8lbNvw5v/VkwrKuYQYmKcg6zfE+pNScbFgUpT6Q+rkrl9ptTJ8MrGIHDmeAbm4iCsrPb4NWkZpuSXV6Wcv8Kt3x/oXVjpolCVZUMGTfGZSAxAPss4DiegltzsntOZXjJb3ia26WvF0lDqeCJ38amE/kKeMnV0X6L5YQj3cO/Ti+nHvr4=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Seb Stafford Bloor take an in-depth look at the Champions League final between Liverpool and Real Madrid. They assess the managerial battle between Jurgen Klopp and Carlo Ancelotti, the tactical contest between two experienced teams, and outline the ways Liverpool could win, or&nbsp;indeed lose, the final.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Seb Stafford Bloor take an in-depth look at the Champions League final between Liverpool and Real Madrid. They assess the managerial battle between Jurgen Klopp and Carlo Ancelotti, the tactical contest between two experienced teams, and outline the ways Liverpool could win, or&nbsp;indeed lose, the final.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Was this the best of Manchester City's six title wins in the last decade?]]></title>
			<itunes:title><![CDATA[Was this the best of Manchester City's six title wins in the last decade?]]></itunes:title>
			<pubDate>Mon, 23 May 2022 15:15:59 GMT</pubDate>
			<itunes:duration>57:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/628ba3c2c667fa0012ecaa3a/media.mp3" length="138165176" type="audio/mpeg"/>
			<guid isPermaLink="false">628ba3c2c667fa0012ecaa3a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/was-this-the-best-of-manchester-citys-six-title-wins-in-the-</link>
			<acast:episodeId>628ba3c2c667fa0012ecaa3a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>was-this-the-best-of-manchester-citys-six-title-wins-in-the-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz95u81S116h9uMZlR2o8W3Ur/FhsRZxtIVfFqZD5CmZ+Xa4oUQDNqou1p2SsX8nfzfEl0N2rLlNSycCoDNbat4ziYLBlV3H1xO5w0iR1dBgTqq18v+SwXio+5nYe+sLyAWHADwnRYAlybE9nZzZfjtydoR0z7Jz+ohPsZBYclcY3fgeLRXb9I7n/1vZb0wcqZDHyOv4nqtfFbr2otxNqIG3erh5IjKKuejmGRgUSbksSBpF/xU/XR9QpK/KfoD3bK260e3Da4YIThX7QQByYu+uw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Richard Amofa assess an unforgettable final day, and Manchester City's dominance of the Premier League over the last ten years. A treble for Liverpool, culminating in Saturday's Champions League final, would be appropriate compensation. Antonio Conte has galvanised Spurs, but Burnley's future is bleak following their relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Richard Amofa assess an unforgettable final day, and Manchester City's dominance of the Premier League over the last ten years. A treble for Liverpool, culminating in Saturday's Champions League final, would be appropriate compensation. Antonio Conte has galvanised Spurs, but Burnley's future is bleak following their relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Will the season's most unlikely dream, Rangers winning their first European title for fifty years, come true?]]></title>
			<itunes:title><![CDATA[Will the season's most unlikely dream, Rangers winning their first European title for fifty years, come true?]]></itunes:title>
			<pubDate>Wed, 18 May 2022 05:00:44 GMT</pubDate>
			<itunes:duration>35:16</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6283d0ca06015900139e2364/media.mp3" length="84660176" type="audio/mpeg"/>
			<guid isPermaLink="false">6283d0ca06015900139e2364</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/will-the-seasons-most-unlikely-dream-rangers-winning-their-</link>
			<acast:episodeId>6283d0ca06015900139e2364</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>will-the-seasons-most-unlikely-dream-rangers-winning-their-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9lfU4QDwoXcWOc8370c9b7Y5T0QFQivmDBzeKPWaKwo6E7sz12nXyJDMGfcfpWSGFYy+/gMPv+SSdqO02JhDpVNYaN7dZDTSu5/dmjDoLFep5r0uS2kA87LP9U2FVMkKHbWVu0VQq288zlp2LB0Jaa5NP4W6QSu3SOa0vE9h7YSzVmvY5SJYY59B4U2xYajer5c450bRypO7n/i9obV6Whb9OVETqoqbNDB/UtyeccZOrOpMPhoMBIisLAiF2XH3mVU50yqDR6UuCjcOtghtX2Q==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Patrick Barclay and Tony Hodson preview the final of the Europa League, a competition that has come of age. They recognise the youthful&nbsp;talent fuelling confidence in Eintracht Frankfurt's approach, but believed a combination of astute coaching, big game players and passionate support will lead to Rangers winning their first European trophy since the Cup Winners Cup in 1972.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Patrick Barclay and Tony Hodson preview the final of the Europa League, a competition that has come of age. They recognise the youthful&nbsp;talent fuelling confidence in Eintracht Frankfurt's approach, but believed a combination of astute coaching, big game players and passionate support will lead to Rangers winning their first European trophy since the Cup Winners Cup in 1972.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Steven Gerrard fated to help Liverpool win the Premier League?</title>
			<itunes:title>Is Steven Gerrard fated to help Liverpool win the Premier League?</itunes:title>
			<pubDate>Mon, 16 May 2022 15:35:49 GMT</pubDate>
			<itunes:duration>46:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62826f559e3d710014a9c569/media.mp3" length="112673828" type="audio/mpeg"/>
			<guid isPermaLink="false">62826f559e3d710014a9c569</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-steven-gerrard-fated-to-help-liverpool-win-the-premier-le</link>
			<acast:episodeId>62826f559e3d710014a9c569</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-steven-gerrard-fated-to-help-liverpool-win-the-premier-le</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9iEBDZtHLg2rjZO1wL78im/oJL+q3a9Y9K5R1XmxPy3nf/6J/CRfj4tLkHsZPX79XwtkggT0k1kCUd7pVU9P8ndPBd9SLpXnEwoayeKNpmjAxEy1+7pYbjKYxiZDks1jOmiczhs6DRVUS4Yc3YeUVTJIL5xnH5b8DMYeVmgPsLY5D1u98QqVvGCpJJrJE3zFgwuUx4/ZlalowAPQMy6dOcG6AieVJcbxySFw8b3eMy4Tne1L6VuiwjaM0RC73gjr13pBa1JFpV1u5KKBE7qmjsQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Patrick Barclay and Tony Hodson consider the prospect of Steven Gerrard's Aston Villa preventing Manchester City from winning their fourth Premier League title in five seasons. They dwell on the lessons of brain training, hail Jordan Henderson as one of the great leaders of the modern game, and wonder whether VAR will influence the battle against relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Patrick Barclay and Tony Hodson consider the prospect of Steven Gerrard's Aston Villa preventing Manchester City from winning their fourth Premier League title in five seasons. They dwell on the lessons of brain training, hail Jordan Henderson as one of the great leaders of the modern game, and wonder whether VAR will influence the battle against relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Chelsea end an era by winning the FA Cup final at Wembley on Saturday?</title>
			<itunes:title>Can Chelsea end an era by winning the FA Cup final at Wembley on Saturday?</itunes:title>
			<pubDate>Thu, 12 May 2022 05:00:22 GMT</pubDate>
			<itunes:duration>42:16</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/627bded2e0183e0012ae39b4/media.mp3" length="101451872" type="audio/mpeg"/>
			<guid isPermaLink="false">627bded2e0183e0012ae39b4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/can-chelsea-end-an-era-by-winning-the-fa-cup-final-at-wemble</link>
			<acast:episodeId>627bded2e0183e0012ae39b4</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>can-chelsea-end-an-era-by-winning-the-fa-cup-final-at-wemble</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9tc3IObfTS6AFBBp0Sd4NOP+r/pe70/4M178QlDsXjhnvTVIoL2rFf5Z2VP1xfLYhOl45ei9f11kOAUW75GxYSAMxzKpCfvf/C6H5eHJr1tPQLl6uaFTorxhp/WRE+k0MywVfCbOocTlWeAVAD7mzCTcINOJy+J5Nal4YlCd7e/n8uy8tv3caA3EdLJQL9qoG12KyUw4e82MDInsnlUGMgPaVx1+ZncBTCs5a37aaVY/MTcUOJOAcTNbDTxtJqYzvkkwhVGNfjx4MtBJHijOOCA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Seb Stafford Bloor take an in depth look at Saturday's FA Cup final. Chelsea, a club defined by&nbsp;trophy-winning, have their season, and most probably their short term future on the line at Wembley. Thomas Tuchel, like his squad, is at a crossroads. Liverpool, meanwhile, are ready to produce another signature performance on a big occasion.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Seb Stafford Bloor take an in depth look at Saturday's FA Cup final. Chelsea, a club defined by&nbsp;trophy-winning, have their season, and most probably their short term future on the line at Wembley. Thomas Tuchel, like his squad, is at a crossroads. Liverpool, meanwhile, are ready to produce another signature performance on a big occasion.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Manchester City a week away from clinching their fourth Premier League title in five seasons?</title>
			<itunes:title>Are Manchester City a week away from clinching their fourth Premier League title in five seasons?</itunes:title>
			<pubDate>Mon, 09 May 2022 14:44:05 GMT</pubDate>
			<itunes:duration>49:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62792959232f6d0015b3f21b/media.mp3" length="118722764" type="audio/mpeg"/>
			<guid isPermaLink="false">62792959232f6d0015b3f21b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-manchester-city-a-week-away-from-clinching-their-fourth-</link>
			<acast:episodeId>62792959232f6d0015b3f21b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-manchester-city-a-week-away-from-clinching-their-fourth-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Z3bYN3I6emLDLZfjYOdRrRxQDWx4YbI/D1w3ROapYeQqfYH75rXEocQC6nfcoeP4GnMNR7Z3fuoFnR0dX7JxTMOR+BSxBi/kSIm1EO1PNyy/iEw5A90WwP2IPIRzXB7uwmjWqEvMa8zoFbcf6ktQj6WEn4Fkl4DQr94YaMjpGRoCPo+c+Z7t2z7o1xISJeKSvgH40okre0YBBEUH+LAmA57cL2vJFC6SLdBlSpb4/LM/FlGEpM0m9blZKQI6FTwXrEIs5f8JLrQTT6iy2K10RNcTPwQ2ykzYJVzJZ0VlQQM=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Seb Stafford Bloor believe Manchester City will consolidate their advantage in the Premier League title race, and caution against reading too much into the Steven Gerrard factor when Liverpool visit Aston Villa on Tuesday. Thomas Frank is mentioned as a potential manager of the season : his Brentford side may well send Leeds United down on the final day of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Seb Stafford Bloor believe Manchester City will consolidate their advantage in the Premier League title race, and caution against reading too much into the Steven Gerrard factor when Liverpool visit Aston Villa on Tuesday. Thomas Frank is mentioned as a potential manager of the season : his Brentford side may well send Leeds United down on the final day of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Manchester City end the season without a trophy?</title>
			<itunes:title>Will Manchester City end the season without a trophy?</itunes:title>
			<pubDate>Fri, 06 May 2022 14:29:22 GMT</pubDate>
			<itunes:duration>52:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/627530c240897b001458d2bd/media.mp3" length="124965884" type="audio/mpeg"/>
			<guid isPermaLink="false">627530c240897b001458d2bd</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/will-manchester-city-end-the-season-without-a-trophy</link>
			<acast:episodeId>627530c240897b001458d2bd</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>will-manchester-city-end-the-season-without-a-trophy</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9+C8vfJgwUA15xjYoS79VWbQuac7jNquWHScKSTy70AozClKKAwa6j1rMUEaG5oBhDlzomk9M5LFF0RzXd/pHW96t0Md4F1kXdV/WvRVMhLSkLEeGbqz6y62hsLXk6OT2pm42nhsHxHWZjb/jIPpxivFrWqH1t7OhUHh35VcswEnCMg8mBSWV4hAr5Hcz2YPfounhN2XguVOH+X1yg3l10fU9LiX8gI4Ke+VPO/3QecrRy4mXdZ+W2TYNLVnvhNCYDRqSTxaE7frANi9qbMWemA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Glenn Moore and Jordan Jarrett Bryan discuss whether Manchester City can recover from Champions League disappointment, and prevent Liverpool winning the Premier League title. They fear for Leeds in the relegation&nbsp;battle, but hail Rangers for reaching the Europa League final.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Glenn Moore and Jordan Jarrett Bryan discuss whether Manchester City can recover from Champions League disappointment, and prevent Liverpool winning the Premier League title. They fear for Leeds in the relegation&nbsp;battle, but hail Rangers for reaching the Europa League final.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is the curse of the Champions League about to strike Manchester City again?</title>
			<itunes:title>Is the curse of the Champions League about to strike Manchester City again?</itunes:title>
			<pubDate>Mon, 02 May 2022 05:00:50 GMT</pubDate>
			<itunes:duration>41:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/626c07bbd559510012d3c3de/media.mp3" length="100485128" type="audio/mpeg"/>
			<guid isPermaLink="false">626c07bbd559510012d3c3de</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-the-curse-of-the-champions-league-about-to-strike-manches</link>
			<acast:episodeId>626c07bbd559510012d3c3de</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-the-curse-of-the-champions-league-about-to-strike-manches</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9uFxWoXtRPrzmXFJnjYUsUqD+aGTCcO4ZI7P7sT9Arv+lr2FViCd8LKERtWqUZvzK9SJxhOsy28srmryES2VV+q8W/G2Jw+Tcovpj+H3hQ51DMhyYaPFv6F9jKA+q1Ma900NMC7w8MeDens4wfQRg7d/Uailr3o1/cenJ/jAztmS848Uly81CD6QLFFxwYfiFf5lj4BLG3eUVjNHuVdOvLldpnUhLh0g8vFdpDsM1AygoQ6bMfyli3+i3fbhwl63wMzMPRQ4DLBwEZlHnoW7YUA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Adrian Clarke assess this week's European semi finals, They fear for Manchester City in the Bernabeu, and though Villareal are likely to lose to Liverpool, they deserve greater respect. The atmosphere generated at both Europa League ties, at Ibrox and at Eintracht Frankfurt, will be a revealing test of nerve.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Adrian Clarke assess this week's European semi finals, They fear for Manchester City in the Bernabeu, and though Villareal are likely to lose to Liverpool, they deserve greater respect. The atmosphere generated at both Europa League ties, at Ibrox and at Eintracht Frankfurt, will be a revealing test of nerve.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Jurgen Klopp build a dynasty at Liverpool?</title>
			<itunes:title>Will Jurgen Klopp build a dynasty at Liverpool?</itunes:title>
			<pubDate>Fri, 29 Apr 2022 13:46:00 GMT</pubDate>
			<itunes:duration>40:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/626bec18c1fd8500126e36aa/media.mp3" length="96144176" type="audio/mpeg"/>
			<guid isPermaLink="false">626bec18c1fd8500126e36aa</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/will-jurgen-klopp-build-a-dynasty-at-liverpool</link>
			<acast:episodeId>626bec18c1fd8500126e36aa</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>will-jurgen-klopp-build-a-dynasty-at-liverpool</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9sF/7UssyQUeUqLLqndoSMOrixzdMt5sijNgpzrK0zKrWrTgI1GXtZ2FnWHmDmvFJSs9jFxsB0REjO6IO9i+uA+zCGChmLX6LQl3QI8YasSqW6S1wH9bGByWOJ8ddaWfUMaTPy91XONUWE7u670tIeQCKLsqbf3LBHqGXm4MbRK1ewB8+l2WwKZBq6T8HybkfPnG7cF97VCHTxn5C4F7myH8z2nQK9Vqk72AmtrihjBpeqOhy9V3a9vSwMynHNmtW3q2bwPPSu3efOcqLul8bOg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Adrian Clarke assess the immediate and the long term impact of Jurgen Klopp's decision to sign a new contract at Liverpool. They also analyse the Premier League relegation battle. Survival is in Burnley's DNA and although Leeds might struggle to get the win they need, Everton are in real trouble.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Adrian Clarke assess the immediate and the long term impact of Jurgen Klopp's decision to sign a new contract at Liverpool. They also analyse the Premier League relegation battle. Survival is in Burnley's DNA and although Leeds might struggle to get the win they need, Everton are in real trouble.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is history beckoning Liverpool?</title>
			<itunes:title>Is history beckoning Liverpool?</itunes:title>
			<pubDate>Mon, 25 Apr 2022 14:11:55 GMT</pubDate>
			<itunes:duration>47:48</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6266ac2bec420f0012260636/media.mp3" length="114749300" type="audio/mpeg"/>
			<guid isPermaLink="false">6266ac2bec420f0012260636</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-history-beckoning-liverpool</link>
			<acast:episodeId>6266ac2bec420f0012260636</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-history-beckoning-liverpool</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz95m4cPX8Jqjq85aNah+5YIqwZ8nbCYSNGxUanbMCrSBONKCVUpy0xhTNWpLtCgaRboYgweG9gmQTVmkl6pJYTuF61JPUD6cL0UQ2koiOzJHv6fAPtV9Xm08DrgwazoakUac9jOLTwp8i1PlEc12Fkco0CM7R2BN9EBOUFiFVOW60bT0F3u8GvdSoB0HkmRNGogFjAr0PWdfFxZ4Y/+76Q5VBHC4dmloelv79zgNY+Y4YqXvDhfJgnL97sEtAOWhI8JuBtRvHRPyU4QXJktXVGjbRaQBmr19jBQEHcbW+SGKw=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Patrick Barclay and Tony Hodson envisage Liverpool and Manchester City ending a season for the ages in the Champions League final. A historic quadruple for Liverpool cannot be ruled out. The Europa League could be a farewell present to West Ham from Declan Rice, and Jose Mourinho's return to England is unlikely to go well at Leicester.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Patrick Barclay and Tony Hodson envisage Liverpool and Manchester City ending a season for the ages in the Champions League final. A historic quadruple for Liverpool cannot be ruled out. The Europa League could be a farewell present to West Ham from Declan Rice, and Jose Mourinho's return to England is unlikely to go well at Leicester.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is perfection the new normal in the Premier League title race?</title>
			<itunes:title>Is perfection the new normal in the Premier League title race?</itunes:title>
			<pubDate>Thu, 21 Apr 2022 14:42:49 GMT</pubDate>
			<itunes:duration>50:54</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62616d6aad40100013248ffe/media.mp3" length="122187800" type="audio/mpeg"/>
			<guid isPermaLink="false">62616d6aad40100013248ffe</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-perfection-the-new-normal-in-the-premier-league-title-rac</link>
			<acast:episodeId>62616d6aad40100013248ffe</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-perfection-the-new-normal-in-the-premier-league-title-rac</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9CJKZ+wb3zmwh8O24ZFmqFjwb7NP9NnUuya60zBs1x2PqRLhvPuoTsuxa4mLI68CVveHaFd5Y6DSYUeuJughtxC6KiSsZ3YFfvReOZCh69Puy3Ikt2Ze7QlEE9x2CTibkTQy0AE2qRqNU3/9DQNn1K6MBGRnRI/EU4ceb/ElepuWavN8I6pk0eUvSo803+Ip7ZiIJ4jOFAudIXILmOTT+iBjlQwxjXHdtaIXV8wKEVYrUF5DcYvixVKBAzTEbKmKZCE7pSwaxWqsUamNLJwzWgg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Glenn Moore and Seb Stafford Bloor struggle to see Liverpool and Manchester City dropping points in the Premier League run in. They examine the rebuild facing Manchester United, and their new manager Erik Ten Hag, and also consider the merits of a play off system.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Glenn Moore and Seb Stafford Bloor struggle to see Liverpool and Manchester City dropping points in the Premier League run in. They examine the rebuild facing Manchester United, and their new manager Erik Ten Hag, and also consider the merits of a play off system.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Manchester City summon the resilience to knock Liverpool out of the FA Cup?</title>
			<itunes:title>Can Manchester City summon the resilience to knock Liverpool out of the FA Cup?</itunes:title>
			<pubDate>Thu, 14 Apr 2022 14:04:16 GMT</pubDate>
			<itunes:duration>44:39</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/625829e0ad81df001788ec76/media.mp3" length="107177168" type="audio/mpeg"/>
			<guid isPermaLink="false">625829e0ad81df001788ec76</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/can-manchester-city-summon-the-resilience-to-knock-liverpool</link>
			<acast:episodeId>625829e0ad81df001788ec76</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>can-manchester-city-summon-the-resilience-to-knock-liverpool</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9X/glq42i6YdPiBNdCEqyHT2KhYbRb20pQfjPC+6wbSJyKMDB8Z1tHWe5eK8ptgLIwudWpt3JMnvC3HT3XvwG5690YAHyggEYZFMMbNyGY24Lb1LmoH73CkPT8op9gS/+pCSIYYxsNVBuf5N9JDGNClZOJLY+p6OhN1KpGBexEfnxmzzJxNjUPre5fXTfDbzJvibS70KzFleQ8MGyiqU5qaRjfdFeOmLFSDx4bohyIPt4W4KVknQomU/j0mej0gVqKpybXQvc50VsEfdj42ENQQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Adrian Clarke analyse the second instalment of the saga involving Manchester City and Liverpool, looking at the lingering impact of their midweek&nbsp;exertions. They are divided on whether Chelsea, whose defence of the Champions League ended in Madrid, should have allowed Connor Gallagher to play against them in their FA Cup semi final on Sunday.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Adrian Clarke analyse the second instalment of the saga involving Manchester City and Liverpool, looking at the lingering impact of their midweek&nbsp;exertions. They are divided on whether Chelsea, whose defence of the Champions League ended in Madrid, should have allowed Connor Gallagher to play against them in their FA Cup semi final on Sunday.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is it Advantage Liverpool in Europe?</title>
			<itunes:title>Is it Advantage Liverpool in Europe?</itunes:title>
			<pubDate>Mon, 11 Apr 2022 14:32:09 GMT</pubDate>
			<itunes:duration>46:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62543beac048360012e8f70a/media.mp3" length="110486648" type="audio/mpeg"/>
			<guid isPermaLink="false">62543beac048360012e8f70a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-it-advantage-liverpool-in-europe</link>
			<acast:episodeId>62543beac048360012e8f70a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-it-advantage-liverpool-in-europe</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9uXxwKIFYxqhBBenL7tMnNHQBW9rexiKsCflP9OZZ49cUFgQlUcxsSUhGjE5mz+7ToQvLlBSqQ9n2K7wRfR6WedeO9qawTTpcHW+cvizsMFaPw5FGuVuPEKbZF1a+kft6lPy8GJ9JXHGZmuELeV3FyWC6uRlF6XXitAIlI4sEOxEL6WuJhsZc2rKlhPLKLVOMrJiWjn433KXsfHqSPiSZg5qlkTY9UXlmRFCZSxTFxkIyQ4DguJqIlRIRNmNERjBquMO6UxjZYD3MaEmyDifenw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Richard Amofa reflect on the intensity of the rivalry between Manchester City and Liverpool, and how that might impact the midweek ties in the Champions League. They suggest Chelsea's defence will end in the Bernabeu, hail Leicester's Kiernan Dewsbury-Hall as one of the finds of the season, and believe Burnley's fate might have been sealed by their defeat at Norwich.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Richard Amofa reflect on the intensity of the rivalry between Manchester City and Liverpool, and how that might impact the midweek ties in the Champions League. They suggest Chelsea's defence will end in the Bernabeu, hail Leicester's Kiernan Dewsbury-Hall as one of the finds of the season, and believe Burnley's fate might have been sealed by their defeat at Norwich.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Who will win Sunday's showdown, Manchester City or Liverpool?]]></title>
			<itunes:title><![CDATA[Who will win Sunday's showdown, Manchester City or Liverpool?]]></itunes:title>
			<pubDate>Fri, 08 Apr 2022 13:43:57 GMT</pubDate>
			<itunes:duration>45:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62503c1da63c7000124a17f4/media.mp3" length="109338248" type="audio/mpeg"/>
			<guid isPermaLink="false">62503c1da63c7000124a17f4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/who-will-win-sundays-showdown-manchester-city-or-liverpool</link>
			<acast:episodeId>62503c1da63c7000124a17f4</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>who-will-win-sundays-showdown-manchester-city-or-liverpool</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9NKg6/8dweunWfyaGBkq4InORlJUHWrlpA8RjWYqwZe2M+blAz/FzbPtwCVhy+w2uWnUFRAqeglu0KIBgqy07DbLSwYyFHyCyglsQ4iqHCpkJfpVLFrTcAb3FGH7LFjc0BAA0U5dWx3jR7gLprKEBmc+vr73SVvBCrgGgXnLDolHH3bVsAkifl/pOQp/XlVqc3xBU0aDhfkTCLsr39FH8xZBs6xe3Iiz61O0+O/F3qFvy713UDA1kZwdK41S/Z14mWMOuIF7XlUT2u2Hs1EbylQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Dominic Fifield analyse all aspects of Liverpool's visit to Manchester City on Sunday, but cannot agree on the result, and its consequences in the Premier League title race. They discuss increasing elitism,&nbsp;dismiss&nbsp;UEFA's latest reform of the Champions League, and set a 35 point target to avoid relegation to the Championship.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Dominic Fifield analyse all aspects of Liverpool's visit to Manchester City on Sunday, but cannot agree on the result, and its consequences in the Premier League title race. They discuss increasing elitism,&nbsp;dismiss&nbsp;UEFA's latest reform of the Champions League, and set a 35 point target to avoid relegation to the Championship.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is a successful defence of the Champions League beyond Chelsea?</title>
			<itunes:title>Is a successful defence of the Champions League beyond Chelsea?</itunes:title>
			<pubDate>Mon, 04 Apr 2022 15:19:09 GMT</pubDate>
			<itunes:duration>51:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/624b0c6db2bc5000120305f7/media.mp3" length="122736944" type="audio/mpeg"/>
			<guid isPermaLink="false">624b0c6db2bc5000120305f7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-a-successful-defence-of-the-champions-league-beyond-chels</link>
			<acast:episodeId>624b0c6db2bc5000120305f7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-a-successful-defence-of-the-champions-league-beyond-chels</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9TGk/e5T5BiwvGpU//6mR0jwFuXH20YFHhZGq8xTeGXZxarBcO57YOhI8ce7Tm/BRDZKTg8U6gjX+6I5J2j/KiRnH5/wYGJxo+gbujNM2qpOV4s8a3r9CYo8IcEVyegexax6ysPk/gC9kVS1vLjM32+hDsghJrijC9ny5EwzCa4iPWmiYCcfJQbZL6tEm6ppruNNGsnDmiLPw8piO9ID1M4fuhyBLzYMT/yZwaVk/KuUf4O8CXQsbbuwtVFmN9Q9n3CM9jgr7wfMGS+rWS/k35g==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Tony Hodson cast doubts on Chelsea's ability to repeat last season's success in the Champions League. They foresee problems for Manchester City against Atletico Madrid, but suspect Liverpool will have their semi-final&nbsp;place secured by the end of Tuesday's first leg against Benfica in Lisbon. They also ask why Declan Rice would join Manchester United, when the club is in such turmoil.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Tony Hodson cast doubts on Chelsea's ability to repeat last season's success in the Champions League. They foresee problems for Manchester City against Atletico Madrid, but suspect Liverpool will have their semi-final&nbsp;place secured by the end of Tuesday's first leg against Benfica in Lisbon. They also ask why Declan Rice would join Manchester United, when the club is in such turmoil.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is it time to give Harry Maguire the support he deserves?</title>
			<itunes:title>Is it time to give Harry Maguire the support he deserves?</itunes:title>
			<pubDate>Thu, 31 Mar 2022 13:35:19 GMT</pubDate>
			<itunes:duration>52:11</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6245ae1793d8010014bcb8c5/media.mp3" length="125271776" type="audio/mpeg"/>
			<guid isPermaLink="false">6245ae1793d8010014bcb8c5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-it-time-to-give-harry-maguire-the-support-he-deserves</link>
			<acast:episodeId>6245ae1793d8010014bcb8c5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-it-time-to-give-harry-maguire-the-support-he-deserves</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9myfx4snek4lMlBxFp8pL+LCGyR3JVRjXgL5Xe7nGNQnqhZYRvnb7SSp8qCpXSEzNYWPBSVCmIlhDcHgMoHF9qHZwOLb79djss7k0q6OMMqo5+lJlnAz77B5iJD5apcP3IMJewcwSJz3x0nxDmAzIRKUfHFf/8BnRT6ch046mlKtOOhGhoTS3WYMs7CwiNsoFd6QvgTCOy7SXK8aII9jeU+zQOagAkINMz3R3xe/RnT++9lTrjMAow3mWr1NsHcmJkCpXZQoH5O74/MRK8m35QA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Adrian Clarke review Manchester United's issues, including the abuse of Harry Maguire, the form of Marcus Rashford, the appointment of a new manager and the need for a rebuild. They believe Jude Bellingham would turn Liverpool into a Hall of Fame team, and that Harry Kane would benefit from the resurrection of his proposed move to Manchester City. Everton's relegation worries, a defining day for women's football and the future of Gareth Bale are also on the agenda.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Adrian Clarke review Manchester United's issues, including the abuse of Harry Maguire, the form of Marcus Rashford, the appointment of a new manager and the need for a rebuild. They believe Jude Bellingham would turn Liverpool into a Hall of Fame team, and that Harry Kane would benefit from the resurrection of his proposed move to Manchester City. Everton's relegation worries, a defining day for women's football and the future of Gareth Bale are also on the agenda.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who will blink first, Liverpool or Manchester City?</title>
			<itunes:title>Who will blink first, Liverpool or Manchester City?</itunes:title>
			<pubDate>Mon, 21 Mar 2022 15:34:51 GMT</pubDate>
			<itunes:duration>47:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62389b1b3e62830013d1ee2c/media.mp3" length="113784644" type="audio/mpeg"/>
			<guid isPermaLink="false">62389b1b3e62830013d1ee2c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/who-will-blink-first-liverpool-or-manchester-city</link>
			<acast:episodeId>62389b1b3e62830013d1ee2c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>who-will-blink-first-liverpool-or-manchester-city</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9gcjbU0uvmlwZETCr8C7g5jhxhZOKqqEQCG4cRo/TSOzZX2LR/wWA8P7XhYzZzGFXfK+eN9M9vHgGAktfSyVrj2/XvBxWU/i1sDDnicV4OkpDa/engfN5vTMqCyVV15/OH5j8dhetNPLbY3CxvhSkvuKtEK5ZRP/AzanrUZfuU3dyP9CfRnOLwVUSTD3WYh1q2IATgiufsav8I2JdfdN6JkH85+RonJWNUIoPqWHlBjpfbODhGbxc0gzFzrtjGrsYZf9gIsnVDSwKALKmUchzkA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Glenn Moore and Jordan Jarrett Bryan discuss the relative merits of Liverpool and Manchester City, who are going for a quadruple and a treble respectively. Chelsea still seem capable of retaining the Champions League and Patrick Vieira is seen as a credible manager of the&nbsp;season candidate.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Glenn Moore and Jordan Jarrett Bryan discuss the relative merits of Liverpool and Manchester City, who are going for a quadruple and a treble respectively. Chelsea still seem capable of retaining the Champions League and Patrick Vieira is seen as a credible manager of the&nbsp;season candidate.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Liverpool the team to beat in the Champions League?</title>
			<itunes:title>Are Liverpool the team to beat in the Champions League?</itunes:title>
			<pubDate>Fri, 18 Mar 2022 16:06:13 GMT</pubDate>
			<itunes:duration>45:29</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6234adf5253989001392af38/media.mp3" length="109197308" type="audio/mpeg"/>
			<guid isPermaLink="false">6234adf5253989001392af38</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-liverpool-the-team-to-beat-in-the-champions-league</link>
			<acast:episodeId>6234adf5253989001392af38</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-liverpool-the-team-to-beat-in-the-champions-league</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9nTZMWI6DjpsF+F316BBfoHiZT+37QODAlgHHXRtoFlvwKferQYKS/365XFnxZtEuFtLNYoZ4mJeJ4j/Nzhz5A1t8FECcQBffwn31t9Vcc6eHjZBPeRtwmb27c/+6D6KzcQxwvQHAmq4D9kzlwktqdRERrZHwTgEyA5Swil/rC6miFVitw+AZdespe2NhgWxB+14zPCP1DR6ZDpPrzwVbjuNa4ZpvX2OGqG9odwVj19FETHvzPOYkQgDoYirnCrLEMqKcRCpEFBNBj9dZ89b0cPJOmHb5v4VopVW9VImv1Gw=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Miguel Delaney analyse the quarter final draw for the Champions League. Liverpool face outsiders Benfica, Carlo Ancelotti returns to Chelsea with Real Madrid, and Diego Simeone will attempt to get inside Pep Guardiola's head. The panel see West Ham as credible contenders in the Europa League, and also preview the FA Cup quarter finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Miguel Delaney analyse the quarter final draw for the Champions League. Liverpool face outsiders Benfica, Carlo Ancelotti returns to Chelsea with Real Madrid, and Diego Simeone will attempt to get inside Pep Guardiola's head. The panel see West Ham as credible contenders in the Europa League, and also preview the FA Cup quarter finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is a European Super League still on the agenda?</title>
			<itunes:title>Is a European Super League still on the agenda?</itunes:title>
			<pubDate>Mon, 14 Mar 2022 15:38:21 GMT</pubDate>
			<itunes:duration>48:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/622f616ec28a8000130f9539/media.mp3" length="116839388" type="audio/mpeg"/>
			<guid isPermaLink="false">622f616ec28a8000130f9539</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-a-european-super-league-still-on-the-agenda</link>
			<acast:episodeId>622f616ec28a8000130f9539</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-a-european-super-league-still-on-the-agenda</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9mBNQKmXwEqw7lj28VG+4CZ7+rvCF8P06TMQeRg0LHeKD+m69SMy0MNHy7zRkx/5c1fWDRZT1LsVJrO//SE+Xk0sWzFcKkLtyxu8t7kK/yEKAoVm1y8rIJS1sNM+yE4/GvXdTBZoUshZpvGo6mM5oyzJkjxeY5qaVmbaKZPSWjk0OuXV9f9ktsIWU8hFOCP96hQgpgn59KX5h5g1ucDRz17nsT4hJ4wc0c3UrRlfjGBK6TRKMAQ7WH/Xa5zhPmAeF8wDz+xOb0Qsy2hdLdweIqg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Paul Hayward discuss another turbulent weekend for football, and suggest the idea of a breakaway Super League has never really gone away. They believe Chelsea will progress to the quarter finals of the Champions League, and suspect Atletico Madrid's Ronaldo complex will tip Tuesday's&nbsp;tie at Old Trafford in Manchester United's favour. They also speak from the heart about what football means to them.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Paul Hayward discuss another turbulent weekend for football, and suggest the idea of a breakaway Super League has never really gone away. They believe Chelsea will progress to the quarter finals of the Champions League, and suspect Atletico Madrid's Ronaldo complex will tip Tuesday's&nbsp;tie at Old Trafford in Manchester United's favour. They also speak from the heart about what football means to them.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is the Chelsea crisis a game changer for football?</title>
			<itunes:title>Is the Chelsea crisis a game changer for football?</itunes:title>
			<pubDate>Fri, 11 Mar 2022 16:13:28 GMT</pubDate>
			<itunes:duration>50:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/622b75283226370012f851c9/media.mp3" length="120930824" type="audio/mpeg"/>
			<guid isPermaLink="false">622b75283226370012f851c9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-the-chelsea-crisis-a-game-changer-for-football</link>
			<acast:episodeId>622b75283226370012f851c9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-the-chelsea-crisis-a-game-changer-for-football</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9pzNsAbOcDdh+lKtBLyve4qKc6Epx4Mfrk2pFm/PddY/q+/Oji0FVJmaVFUuqqHJ6zavWrtCqyVoI+ekxutdv7AUpovvrxlX9i4vi/3dtHyq2j7bfVjv45R89XwTjN/3LvASpaOk0w9S4lpHIax1Wqj0poKBbZQa5LreCz6oYENqjt8avyJQ+NBhUPNQgOp+H21GEy/p5wPK6ZpZwXNptJUXJFQAgQU7w/jLPY5Odzital+e7B7bSuVNA+1Onj/7nE8GKho9psoh7BGEOyzb3AQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/f2db9cc5-cf79-4c63-a931-2a2f1df056c6.png"/>
			<description><![CDATA[Mike Calvin, John Cross and Patrick Barclay discuss the possibility of fundamental change in the wake of Chelsea's problems. Fan ownership, and an independent regulator, would be beneficial. Newcastle's visit to Stamford Bridge will be hugely symbolic, but the games of the weekend will be at Brighton, who face Liverpool, and at Leeds, who are in desperate need of a win against Norwich.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Patrick Barclay discuss the possibility of fundamental change in the wake of Chelsea's problems. Fan ownership, and an independent regulator, would be beneficial. Newcastle's visit to Stamford Bridge will be hugely symbolic, but the games of the weekend will be at Brighton, who face Liverpool, and at Leeds, who are in desperate need of a win against Norwich.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Manchester City and Liverpool delivering the best season in Premier League history?</title>
			<itunes:title>Are Manchester City and Liverpool delivering the best season in Premier League history?</itunes:title>
			<pubDate>Mon, 07 Mar 2022 15:03:27 GMT</pubDate>
			<itunes:duration>52:11</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62261ebfc9ba12001305da4c/media.mp3" length="125266556" type="audio/mpeg"/>
			<guid isPermaLink="false">62261ebfc9ba12001305da4c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-manchester-city-and-liverpool-delivering-the-best-season</link>
			<acast:episodeId>62261ebfc9ba12001305da4c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-manchester-city-and-liverpool-delivering-the-best-season</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9TObiq0SCtwWDv2kHkY+BCppZ8Cv4a1l8tQvdVT8gexvWThMlze3EPiRjx1u820BsYz/G6TPXS8OFDk7Ir218AvFMghSPaGUfQyEp/VlSUxnKx8/dbpkXV2bPsQr1zCLVpSYN/ePVaQHXOW9FE241YaXxaLyqChXuRdlRD02roYfdvLUubSVG3+11OqnyBRrXfIDcHBzjh8J2nVY/+Ei7zALU1I74UYYxhEtg6NRb9WxD+1kjEgJH595B2xuPW/SIw118J95cwx2FRqIODyvfrQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Adrian Clarke assess the balance&nbsp;of power between Manchester City and Liverpool, Premier League title rivals who should comfortably&nbsp;qualify for the Champions League quarter finals this week. They praise Thomas Tuchel for his dignity, sympathise with Ralf Rangnick's&nbsp;lack of authority, and suggest Arsenal may eventually win things with kids.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Adrian Clarke assess the balance&nbsp;of power between Manchester City and Liverpool, Premier League title rivals who should comfortably&nbsp;qualify for the Champions League quarter finals this week. They praise Thomas Tuchel for his dignity, sympathise with Ralf Rangnick's&nbsp;lack of authority, and suggest Arsenal may eventually win things with kids.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>As the Abramovich era ends, what does the future hold for Chelsea?</title>
			<itunes:title>As the Abramovich era ends, what does the future hold for Chelsea?</itunes:title>
			<pubDate>Thu, 03 Mar 2022 13:52:25 GMT</pubDate>
			<itunes:duration>52:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6220c8192c670c001400384a/media.mp3" length="126905636" type="audio/mpeg"/>
			<guid isPermaLink="false">6220c8192c670c001400384a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/as-the-abramovich-era-ends-what-does-the-future-hold-for-che</link>
			<acast:episodeId>6220c8192c670c001400384a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>as-the-abramovich-era-ends-what-does-the-future-hold-for-che</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz98kJgtvRm4U8yXgEMjs5hNu2JPv+sgk7fhh4NOklUOtYtPzLrq/IfZHC4ZbYn62nLYPIMFnpuWenMpvx9AhmJBQ+GlKr0uSqOuZ9adK8hHYu2dSIucqqN21FaT2gDhZThmpeSQUEUU1snpXMv5iqEFx2341dYpz9Qi5QgwsWSaqylyeHxTJi2S8t9NbO/8/bSxlqIf09Ys0vjS+1VNRL0g22fLnDT4rdk8c75c7EKy2KvWD3JlPwDAXBdXQAoEb/EYbtJpiucetKXyip0Y5Vt4Q==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Richard Amofa assess the fallout from Roman Abramovich's decision to sell Chelsea after nineteen consistently&nbsp;successful years. They highlight the gulf between Manchester City and Manchester United, suggest it is not too early to talk up Liverpool's chances of winning the&nbsp;quadruple,&nbsp;and feel Arsenal are 18 months&nbsp;away from being contenders.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Richard Amofa assess the fallout from Roman Abramovich's decision to sell Chelsea after nineteen consistently&nbsp;successful years. They highlight the gulf between Manchester City and Manchester United, suggest it is not too early to talk up Liverpool's chances of winning the&nbsp;quadruple,&nbsp;and feel Arsenal are 18 months&nbsp;away from being contenders.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>With England refusing to play Russia, is football on the verge of regime change?</title>
			<itunes:title>With England refusing to play Russia, is football on the verge of regime change?</itunes:title>
			<pubDate>Mon, 28 Feb 2022 15:51:21 GMT</pubDate>
			<itunes:duration>48:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/621cef795e883b00126c32fd/media.mp3" length="117503372" type="audio/mpeg"/>
			<guid isPermaLink="false">621cef795e883b00126c32fd</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/with-england-refusing-to-play-russia-is-football-on-the-verg</link>
			<acast:episodeId>621cef795e883b00126c32fd</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>with-england-refusing-to-play-russia-is-football-on-the-verg</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9lxmHYaLOoJswNEZ/KwsUexWn/GA4NURHPVdOHiFkQJByCjRBaZUVrkeoF+axsl8wpSvVrePgZX7GB9J0d8OljHom7VMspb4k6jz1JfzgsZOFg4lMkf7UAx2zHM/PY7BpUdx7P5tvArDcV2zMvlQDrRC29XYDhI6oLqYiuHPq2v4GFoogkqVnQdmn4Dhw4NWmh1OmBbFRd1/NEQgG5UCLpryRVi/Her7t+kzZV8sz2xwUzUMZ0/1MCQPKNU2iyvP37+Y0aKV5gboUbuRUCqq2ww==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Faye Carruthers and Glenn Moore analyse a tumultuous weekend for world football, and refuse to rule out the possibility of a boycott of the World Cup finals in Qatar. They celebrate the escapism of Liverpool's League Cup&nbsp;final win, mourn the departure of Marcelo Bielsa from Leeds, and look forward to the midweek FA Cup ties.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Faye Carruthers and Glenn Moore analyse a tumultuous weekend for world football, and refuse to rule out the possibility of a boycott of the World Cup finals in Qatar. They celebrate the escapism of Liverpool's League Cup&nbsp;final win, mourn the departure of Marcelo Bielsa from Leeds, and look forward to the midweek FA Cup ties.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>With UEFA moving the Champions League final from St Petersburg to Paris, do sporting sanctions work?</title>
			<itunes:title>With UEFA moving the Champions League final from St Petersburg to Paris, do sporting sanctions work?</itunes:title>
			<pubDate>Fri, 25 Feb 2022 14:49:19 GMT</pubDate>
			<itunes:duration>46:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6218ec6f5d72f5001499967f/media.mp3" length="112417004" type="audio/mpeg"/>
			<guid isPermaLink="false">6218ec6f5d72f5001499967f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/with-uefa-moving-the-champions-league-final-from-st-petersbu</link>
			<acast:episodeId>6218ec6f5d72f5001499967f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>with-uefa-moving-the-champions-league-final-from-st-petersbu</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9bzG1NhE59kUmZXHWSMC85IzDwqiHN0Do+Vejc1GtzPZG5QQWy3sWb3q5HysA0WARF2UPXSCGDe4uOhmervKtoKvNKrtvk8T7R+/oDd50WQZX9eSShgyfoT3tHqgcCqW4nD35B3P4uZ8XaPLkHxV9PowXIKeHdAwOVoVrFKpiADKD/E1kOOddjBhRE+coxI7zxyJHjw/VzQzUFrrWDm9E/h9jIgH907yPFXObZzV/3rigVijyFMwohk91eoreH7jK+7uHt7kJ9MI3WJFt3IqLDQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Tony Hodson widen the debate about UEFA's decision to move the Champions League final, and their insistence that Russian and Ukrainian teams play at neutral venues. The panel previews Sunday's League Cup final, and assess Saturday's BT Sport game at Elland Road, where Leeds and Spurs, together with their respective managers, are at a crossroads.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Tony Hodson widen the debate about UEFA's decision to move the Champions League final, and their insistence that Russian and Ukrainian teams play at neutral venues. The panel previews Sunday's League Cup final, and assess Saturday's BT Sport game at Elland Road, where Leeds and Spurs, together with their respective managers, are at a crossroads.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Manchester United win the Champions League?</title>
			<itunes:title>Can Manchester United win the Champions League?</itunes:title>
			<pubDate>Mon, 21 Feb 2022 14:52:56 GMT</pubDate>
			<itunes:duration>47:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6213a749b245de0012ae0b95/media.mp3" length="114462200" type="audio/mpeg"/>
			<guid isPermaLink="false">6213a749b245de0012ae0b95</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/can-manchester-united-win-the-champions-league</link>
			<acast:episodeId>6213a749b245de0012ae0b95</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>can-manchester-united-win-the-champions-league</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9GCP1RMHuHtBntxo2LfKmL2i+H+YeOzHkZh+dK8plnIhbHF/c2hncWkrvtCTNOfw1lMBjbV94/O9wV47vYB4Jn3hZBNQJkfkrddrBeA3lkjQSdKjPjV5XLU7ZNZtyi6JJIQB+WICSqePBSD7con5/D+yXNE9Kvgb/3havXA0NjpyCMZGCUIZnyQyb8SepOGVTU1vUMQCeHUAUu6Rnxup3WiulGsQavz4sk7IPUbrCtOmO+RLx61Zh3UYY/8Onbx1MJD56Lmb3l99pco7JSUAdyQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and John Cross discuss the Champions League challenges faced by Manchester United and Chelsea this week. They foresee Cristiano Ronaldo and Romelu Lukaku leaving their respective clubs in the summer, and focus on the revival of the Premier League title race.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and John Cross discuss the Champions League challenges faced by Manchester United and Chelsea this week. They foresee Cristiano Ronaldo and Romelu Lukaku leaving their respective clubs in the summer, and focus on the revival of the Premier League title race.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Antonio Conte have the patience to see through the job at Tottenham?</title>
			<itunes:title>Will Antonio Conte have the patience to see through the job at Tottenham?</itunes:title>
			<pubDate>Fri, 18 Feb 2022 14:32:50 GMT</pubDate>
			<itunes:duration>52:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/620fae128bf3bc0014a92dbe/media.mp3" length="124938740" type="audio/mpeg"/>
			<guid isPermaLink="false">620fae128bf3bc0014a92dbe</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/will-antonio-conte-have-the-patience-to-see-through-the-job</link>
			<acast:episodeId>620fae128bf3bc0014a92dbe</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>will-antonio-conte-have-the-patience-to-see-through-the-job</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9kVWfxyUA4wp75mMrWkKtRQ2fZEoNQFvjRITPnmR1K98lJiXS96YzfiIpbCzMVoHQMMKa27H72YxMS2JoO0OOSTlri2OPiBu9hEdyBfQfMDEdjNNBjHws8WXOToI3HUZgnZAf5iYqsi4EpT/uNVTpAAeMg4OgUb2NOjD7E99DUnolgXkuPa1LGBnnL8Y8b1sZejPriD0kib4GJdp5McMXpvuuB4Kt7oVA2Ah49Ohksl6nowofSGtIz7pB4WABzcGbFhO5U8NIE4kbUzt0VW+3PQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Anne Marie Batson question whether a high maintenance, high performance manager like Antonio Conte has a long term future at Spurs. They assess Tottenham's rivals for the final Champions League qualifying spot, Manchester United, Wolves, Arsenal and West Ham, for whom Jarrod Bowen is an unsung star of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Anne Marie Batson question whether a high maintenance, high performance manager like Antonio Conte has a long term future at Spurs. They assess Tottenham's rivals for the final Champions League qualifying spot, Manchester United, Wolves, Arsenal and West Ham, for whom Jarrod Bowen is an unsung star of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Manchester City and Liverpool the two best teams in Europe?</title>
			<itunes:title>Are Manchester City and Liverpool the two best teams in Europe?</itunes:title>
			<pubDate>Mon, 14 Feb 2022 15:27:50 GMT</pubDate>
			<itunes:duration>51:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/620a74f6068eb400129f123d/media.mp3" length="122758868" type="audio/mpeg"/>
			<guid isPermaLink="false">620a74f6068eb400129f123d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-manchester-city-and-liverpool-the-two-best-teams-in-euro</link>
			<acast:episodeId>620a74f6068eb400129f123d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-manchester-city-and-liverpool-the-two-best-teams-in-euro</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz94aqzYR/1FFY5gkL43GEsviyCzDwOIJsIlB6yksSPGYjU/5CusWuIR3Qx82aGgTNY6gDp/erqfqSvoDocHnfh9tnInBj0mADtXFvkx1ikXzH1rrj1R4UgmsI2InXIpxiVaa1snnW0GA96A5zdICTGo1ys5BerjZSi6o0WMjQSnpdKdTH1GSoURTVLB6v9YPLi8+rdSVf5q/QLirBcE7VdFTZattVIuJbTw1LWbbAX2RggvT+uwBKxaDacHO9zsnHxH/KVUrylqOeiZmAHKEdPFw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Tony Hodson assess the last 16 of the Champions League, and name their eventual winners. Chelsea's status as world champions underlines their potential in Cup&nbsp;competition, while Manchester United's recurring problems suggest they will struggle in Europe.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Tony Hodson assess the last 16 of the Champions League, and name their eventual winners. Chelsea's status as world champions underlines their potential in Cup&nbsp;competition, while Manchester United's recurring problems suggest they will struggle in Europe.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Frank Lampard facing the greatest challenge of his managerial career?</title>
			<itunes:title>Is Frank Lampard facing the greatest challenge of his managerial career?</itunes:title>
			<pubDate>Fri, 11 Feb 2022 15:07:18 GMT</pubDate>
			<itunes:duration>47:51</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/62067ba6b5f15c0013c097e3/media.mp3" length="114873536" type="audio/mpeg"/>
			<guid isPermaLink="false">62067ba6b5f15c0013c097e3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-frank-lampard-facing-the-greatest-challenge-of-his-manage</link>
			<acast:episodeId>62067ba6b5f15c0013c097e3</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-frank-lampard-facing-the-greatest-challenge-of-his-manage</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9cPz9eAyijexH3rmei0VYtEEsWnBSXKDFMJ/1iKWLPP4+VVPk9tIRJl1jU2j0T0hSiml8uIeyVp4YQjmPsBvULYl9ZpQw1TwMRqNjKiVLESaBY4tbANWdsYwoDjkaK/zsSYWQ7vVp1vFwFJfgqY0HGA/2TfwvUqKOEob9t5J9bB7FZTAFuaRyNdMJENRziw30yLclv3JZyGnF9UsKQSVe4R5Rg9AK/Zr8vthDyxyFE1fWLTqaQ8AJpQIR/oRG/Vh6+4YVZrTScfGk6CpUSLXJkg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Faye Carruthers and Glenn Moore use the challenges facing Frank Lampard and Marcelo Bielsa, who are in opposition on Saturday, to highlight the pressures of football management, which may force Southampton's Ralph Hassenhutl to retire at the end of his current contract. They focus on relegation issues, hail the seamless Liverpool debut of Luis Diaz, and consider football's moral responsibilities in the light of the Kurt Zouma controversy.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Faye Carruthers and Glenn Moore use the challenges facing Frank Lampard and Marcelo Bielsa, who are in opposition on Saturday, to highlight the pressures of football management, which may force Southampton's Ralph Hassenhutl to retire at the end of his current contract. They focus on relegation issues, hail the seamless Liverpool debut of Luis Diaz, and consider football's moral responsibilities in the light of the Kurt Zouma controversy.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Do Newcastle United have the quality to survive?</title>
			<itunes:title>Do Newcastle United have the quality to survive?</itunes:title>
			<pubDate>Mon, 07 Feb 2022 16:00:54 GMT</pubDate>
			<itunes:duration>46:16</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6201423686e62b0011d8d63f/media.mp3" length="111053540" type="audio/mpeg"/>
			<guid isPermaLink="false">6201423686e62b0011d8d63f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/do-newcastle-united-have-the-quality-to-survive</link>
			<acast:episodeId>6201423686e62b0011d8d63f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>do-newcastle-united-have-the-quality-to-survive</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9vP38M38gI0zibsArGRnZyKGdx3IoalKIJvsIPxKd9Jyx8Qh+nUNjJHtuXlM6gj/Wn+pg3f/0kALwrB2kr8kD3Ba+njDRn703hJcfQptKd1P03uryALtx5Ekg9MKj8EjFgah7TkC1W3Vdg8XicSzlS3XHeJx5HI94JOwc88BIr2a9CzMBDqMG9rGEO33jsi97RmXhDWR7YzayOgVg7VROhDwG3KdrANN60EP+qA927HtHuqewcbWBOcov8gUEuymAIr+H98QyYziF8ZttZiiQSg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Miguel Delaney discuss Newcastle's chances of avoiding relegation, and react to the breaking news that Dan Ashworth has resigned from Brighton to join them as Director&nbsp;of Football. They preview another key set of fixtures at the bottom of the Premier League, praise Crystal Palace for their generosity of spirit, and suggest Chelsea's trip to the World Club Cup is another vision of football's future.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Miguel Delaney discuss Newcastle's chances of avoiding relegation, and react to the breaking news that Dan Ashworth has resigned from Brighton to join them as Director&nbsp;of Football. They preview another key set of fixtures at the bottom of the Premier League, praise Crystal Palace for their generosity of spirit, and suggest Chelsea's trip to the World Club Cup is another vision of football's future.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who are the winners and losers from the transfer window?</title>
			<itunes:title>Who are the winners and losers from the transfer window?</itunes:title>
			<pubDate>Tue, 01 Feb 2022 16:24:49 GMT</pubDate>
			<itunes:duration>54:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61f95ed17d0e6d0012805974/media.mp3" length="130309076" type="audio/mpeg"/>
			<guid isPermaLink="false">61f95ed17d0e6d0012805974</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/who-are-the-winners-and-losers-from-the-transfer-window</link>
			<acast:episodeId>61f95ed17d0e6d0012805974</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>who-are-the-winners-and-losers-from-the-transfer-window</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9dbRpTGe24I1oYLx/+qTMPDUfsSUgwNkToRrO4h8kj6R5G0IeXXQFqlnu7HXuPwABP22KSf3zXbloj3DqOB7VFz7Tyq3PM9+oeumFC89JWqsTgcBszZEGGhacBJlHm1FsQ5FyBhBCID94hVCPy7AHFtIYjVH15CvYVfYBmEU9YdnJ07iOB6ysOflNU1D+B/LzusMRPiHqmFW7fkq3BVYRTDXavdvdEw7bFhrWHDQghllSYyieWxuL6NBUKosF9GgGcwh6EDVso0EpnsBM9EcgxA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Mike Calvin, John Cross and Seb Stafford Bloor believe Arsenal Spurs and West Ham missed a huge opportunity&nbsp;in the January transfer window. Newcastle's recruitment was flawed, but gives them a good chance of avoiding relegation. Aaron Ramsey's move to Rangers was a surprise, but Christian Eriksen at Brentford is the feelgood story football needs.&nbsp;</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Mike Calvin, John Cross and Seb Stafford Bloor believe Arsenal Spurs and West Ham missed a huge opportunity&nbsp;in the January transfer window. Newcastle's recruitment was flawed, but gives them a good chance of avoiding relegation. Aaron Ramsey's move to Rangers was a surprise, but Christian Eriksen at Brentford is the feelgood story football needs.&nbsp;</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Frank Lampard the right choice for Everton? </title>
			<itunes:title>Is Frank Lampard the right choice for Everton? </itunes:title>
			<pubDate>Thu, 27 Jan 2022 15:10:35 GMT</pubDate>
			<itunes:duration>46:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61f2b5ebb5ab510012c558e9/media.mp3" length="111169424" type="audio/mpeg"/>
			<guid isPermaLink="false">61f2b5ebb5ab510012c558e9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-everton-in-the-process-of-making-another-managerial-mist</link>
			<acast:episodeId>61f2b5ebb5ab510012c558e9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-everton-in-the-process-of-making-another-managerial-mist</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9mMS5q/xBILeKVCRPo/uQGkj2aw/v1p17Nzl6p+jqSE5nXep8jARHvFbKUkrXaHNaVYnpoO0QtbIsIO9Z9/jCezK1xofnEA2HEXKkiQDmE9T5LJM0vJmcSqvn0x04UQdYqVFaf2rKYMYq6KTNgFpQs97T0Qu1Qlijrsj0A2kX6nI8J9oW6zdCdQ11eqv2YxBSiN+9BTZz75FevjxKdqTHH7Gyc8csSKlAgT4pk/iELBp70vqDw1o7fVSmFRg8v5+yOFKPosFqF7QSwUSq96p2Lw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Glenn Moore and Adrian Clarke see Roy Hodgson as a no-risk option for Watford, but fear the&nbsp;consequences of Everton's chaotic search for a new manager. They assess the state of the transfer market, regard the exploitation of Newcastle's needs as inevitable, and name their players with most to gain from a move in the January window.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Glenn Moore and Adrian Clarke see Roy Hodgson as a no-risk option for Watford, but fear the&nbsp;consequences of Everton's chaotic search for a new manager. They assess the state of the transfer market, regard the exploitation of Newcastle's needs as inevitable, and name their players with most to gain from a move in the January window.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is the Premier League in danger of becoming a closed shop?</title>
			<itunes:title>Is the Premier League in danger of becoming a closed shop?</itunes:title>
			<pubDate>Mon, 24 Jan 2022 15:38:51 GMT</pubDate>
			<itunes:duration>56:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61eec80b0184db00132fc86e/media.mp3" length="135950852" type="audio/mpeg"/>
			<guid isPermaLink="false">61eec80b0184db00132fc86e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-the-premier-league-in-danger-of-becoming-a-closed-shop</link>
			<acast:episodeId>61eec80b0184db00132fc86e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-the-premier-league-in-danger-of-becoming-a-closed-shop</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz95NFNZ+1S+CJKJyXsK0tO1aQdVFmJkGxh2OVKdS9x4YoCwe+NSpo+AyUOkDmW8QAZIIDvxRPXk+D3H0RTPaeh6zDV2reUR/LfUFmNQRe1gamiDY7Zb4XEqc0a7n+BaGiU5LOWyqSn4j7wnYSPQIuAdEXA5wEqPWzPPdOhhAtSXrVqjf5DJw9ByJ0ujPhLci60FrWUfnHewLSkpkZElqZGH6nMelp+wq33t/PPUZ3f8AOZxvwqXao1zU5H2O7kY3LN/4aG/JoAhgIhBa789cGKAg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Seb Stafford Bloor assess the significance of Watford's widely-anticipated search for their third manager of the season. Everton, Leeds and Brentford could be dragged into the relegation battle, but parachute payments distort the system by assisting a rapid return. Five clubs are competing for the final Champions League place, but the top three are seemingly set.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Seb Stafford Bloor assess the significance of Watford's widely-anticipated search for their third manager of the season. Everton, Leeds and Brentford could be dragged into the relegation battle, but parachute payments distort the system by assisting a rapid return. Five clubs are competing for the final Champions League place, but the top three are seemingly set.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Liverpool at a crossroads?</title>
			<itunes:title>Are Liverpool at a crossroads?</itunes:title>
			<pubDate>Thu, 20 Jan 2022 15:33:30 GMT</pubDate>
			<itunes:duration>46:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61e980caae948b0012613912/media.mp3" length="112316780" type="audio/mpeg"/>
			<guid isPermaLink="false">61e980caae948b0012613912</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-liverpool-at-a-crossroads</link>
			<acast:episodeId>61e980caae948b0012613912</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-liverpool-at-a-crossroads</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdOCNtV6FtdneFpkr1yNl2+0r/0jfsyCGf0d6KB8Ch9I/6NgLb9qjKeBacfJ2lkgN1M3C/Mx84p7xVH766C8UZhre3Zdv5Pjcg+6Y2q4uTVHcdoBnSIdrePER8cAoIcYVK08jrFLhQLbdmFItvIuT1v+UCAzx7h/fidZDCUhBlVEEOgzkELquACIcLXiVAlxw1nnHuEH5+3PdYC1wpkswsDrerTLWYdProkBKsEGfdFpxg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Richard Amofa highlight Jurgen Klopp's sustained commitment as the&nbsp;key to Liverpol's&nbsp;capacity to respond to the challenge of more lavishly-funded clubs. They foresee successful managerial careers for Steven Gerrard and Wayne Rooney, and regard Brighton's Graham Potter as an England manager in waiting.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Richard Amofa highlight Jurgen Klopp's sustained commitment as the&nbsp;key to Liverpol's&nbsp;capacity to respond to the challenge of more lavishly-funded clubs. They foresee successful managerial careers for Steven Gerrard and Wayne Rooney, and regard Brighton's Graham Potter as an England manager in waiting.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Everton: an object lesson in how not to run a football club?</title>
			<itunes:title>Everton: an object lesson in how not to run a football club?</itunes:title>
			<pubDate>Mon, 17 Jan 2022 15:03:36 GMT</pubDate>
			<itunes:duration>57:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61e58548d9341b0012304373/media.mp3" length="138199628" type="audio/mpeg"/>
			<guid isPermaLink="false">61e58548d9341b0012304373</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/everton-an-object-lesson-in-how-not-to-run-a-football-club</link>
			<acast:episodeId>61e58548d9341b0012304373</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>everton-an-object-lesson-in-how-not-to-run-a-football-club</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdPCckpZHdJMteQlYxuK8O6F3A+Anc2seK76KdD0ADhSmFXBzncMFyAYYRbEaRQMcti31pFVB+kyJetksi3uKPu1SUNlUdWYMbaqM17x2OniSprajj/o2iDAWungN/9oiU58GtlHePWyM0oLlHEF0jtvVycRgAJIuDDB7S/EToM00vamLeSo+OoKI4oxsQVCBQDRVYeugwEgzOHqwHlN63osYSre5ARunbU52B8mG2Kppg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Faye Carruthers and Dominic Fifield sift through the wreckage&nbsp;of Rafa Benitez's brief reign at Everton, and doubt whether Roberto Martinez is the right man to succeed him. They see similar confusion at Newcastle, Manchester United and Spurs, focus on a key week in the relegation battle, and assess the damage caused by the chaotic postponement policy.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Faye Carruthers and Dominic Fifield sift through the wreckage&nbsp;of Rafa Benitez's brief reign at Everton, and doubt whether Roberto Martinez is the right man to succeed him. They see similar confusion at Newcastle, Manchester United and Spurs, focus on a key week in the relegation battle, and assess the damage caused by the chaotic postponement policy.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Another final for Chelsea, but can they sustain their challenge for the Premier League title?</title>
			<itunes:title>Another final for Chelsea, but can they sustain their challenge for the Premier League title?</itunes:title>
			<pubDate>Thu, 13 Jan 2022 15:24:54 GMT</pubDate>
			<itunes:duration>51:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61e04446a698a30012b39ed5/media.mp3" length="122982284" type="audio/mpeg"/>
			<guid isPermaLink="false">61e04446a698a30012b39ed5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/another-final-for-chelsea-but-can-they-sustain-their-challen</link>
			<acast:episodeId>61e04446a698a30012b39ed5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>another-final-for-chelsea-but-can-they-sustain-their-challen</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdMesv/I6A8+GyzKExQ4SuVW/6UV3+NHi79PofpiitjfIdquOBbUDXZFsKUZ1fdT2SaF+K9AL+Y0BZJzIPK+Uk/MD5IybrI/SBDe65z4pQjThPubkPL/wEhm2ElY0/F5YDyBx/X5jP2qDFjgWp+mf43GaR5Mmch6uCXwVr33tLsfS/o+ecoktMq2M+qd8UPOisPwstPRkCUkBi8jNUwYL3lgNJVHbjBAil4sBaSgQv+Y/Q==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Glenn Moore and Tony Hodson set the scene for Chelsea's visit to Manchester City, live on BT Sport on Saturday lunchtime. They agree with Cristiano Ronaldo that the top three should be Manchester United's minimum expectation, but see no real reason (apart from Liverpool potentially poaching Jarrod Bowen) that West Ham cannot claim the final Champions League qualification place.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Glenn Moore and Tony Hodson set the scene for Chelsea's visit to Manchester City, live on BT Sport on Saturday lunchtime. They agree with Cristiano Ronaldo that the top three should be Manchester United's minimum expectation, but see no real reason (apart from Liverpool potentially poaching Jarrod Bowen) that West Ham cannot claim the final Champions League qualification place.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Manchester City too good for the common good?</title>
			<itunes:title>Are Manchester City too good for the common good?</itunes:title>
			<pubDate>Mon, 10 Jan 2022 14:13:10 GMT</pubDate>
			<itunes:duration>56:51</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61dc3d8a4a70fd001375992f/media.mp3" length="81760736" type="audio/mpeg"/>
			<guid isPermaLink="false">61dc3d8a4a70fd001375992f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-manchester-city-too-good-for-the-common-good</link>
			<acast:episodeId>61dc3d8a4a70fd001375992f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-manchester-city-too-good-for-the-common-good</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdMxmBkNAL76s0LkiBY2MfXtgOUH/DMxYptifaP8SQZp5hhHqGqcIccgdLyDxdSiyO8NHjnibfjd3aLEmGVNh/icCnxiIpynv8mfsy1pOzCUXqH8M/cXjOMAhaOJHXXX02C2yDm2br0s1WhRdeOmEanHyYWprKKpbiEX3JmVvaCh1gV0LXtG4W8ftsgeqeKvbpHIYlVRVVMvwQ7bV0ZYh+Ipws1A9w+ppwYDiAH7fGuyFw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and John Cross dwell on the pros and cons of Manchester City's dominance. Newcastle&nbsp;will have to get used to similar levels of envy and resentment, Southampton's model makes them upwardly mobile, Everton are arguably the most dysfunctional club in the Premier League, but the platform the FA Cup provides emerging players must be cherished.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and John Cross dwell on the pros and cons of Manchester City's dominance. Newcastle&nbsp;will have to get used to similar levels of envy and resentment, Southampton's model makes them upwardly mobile, Everton are arguably the most dysfunctional club in the Premier League, but the platform the FA Cup provides emerging players must be cherished.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Ralf Rangnick on a hiding to nothing at Manchester United?</title>
			<itunes:title>Is Ralf Rangnick on a hiding to nothing at Manchester United?</itunes:title>
			<pubDate>Thu, 06 Jan 2022 16:05:25 GMT</pubDate>
			<itunes:duration>52:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61d71345738a080012384b2e/media.mp3" length="125817788" type="audio/mpeg"/>
			<guid isPermaLink="false">61d71345738a080012384b2e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-ralf-rangnick-on-a-hiding-to-nothing-at-manchester-united</link>
			<acast:episodeId>61d71345738a080012384b2e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-ralf-rangnick-on-a-hiding-to-nothing-at-manchester-united</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdN2XtI/Zbq9aYOo/pZt4a3x2v4Q5+kpzea0cmkU06mXhpAf/NMtMP02aRK/oJwePYU75FvZzr0nRt8iYIN2d8uM+eJt+TAatLjWAAkacLWdZn8IRt9WzUFnlbEfYi1xRkf9evw3kwV040qKPDrJ1CBpD4eKV3PjGGbgbxiIia5pCFiEjNwfRxb7b3Y6sRhEwrVWjDeN3c3cW1NY/v+p3xkSNcGRIqn0u3bxIw4proKcBw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor assess the cult of individualism at Manchester United. They praise the&nbsp;managerial authority of Thomas Tuchel, expect a clear out at Spurs, but have sympathy for Claudio Ranieri and Rafa Benitez. They also name their potential FA Cup giant killers.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor assess the cult of individualism at Manchester United. They praise the&nbsp;managerial authority of Thomas Tuchel, expect a clear out at Spurs, but have sympathy for Claudio Ranieri and Rafa Benitez. They also name their potential FA Cup giant killers.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who were your winners and losers in 2021?</title>
			<itunes:title>Who were your winners and losers in 2021?</itunes:title>
			<pubDate>Fri, 24 Dec 2021 06:00:00 GMT</pubDate>
			<itunes:duration>38:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61c1c5d0ad0cb30012231895/media.mp3" length="93248120" type="audio/mpeg"/>
			<guid isPermaLink="false">61c1c5d0ad0cb30012231895</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/who-were-your-winners-and-losers-in-2021</link>
			<acast:episodeId>61c1c5d0ad0cb30012231895</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>who-were-your-winners-and-losers-in-2021</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdMWwG2T1N7WPZkVpNMRVXI6TJwj42Nd02x7TNzR3bpxs4I5kfuf1FH6cia+qXT71XHzNq6IOFvFYyojvpqH/pZub8lphPdeVkDlJ15VgIpuVkRJ7KNbUw8VNODxCR814/l5wqTDUYCUVG+60ayUzoxNK8vfEkdwZJkPXq47WtVjWzROyxqe47NLQ1xz6LGQDGwgrWORZu3PBCtmg84Ru46bp3JU2jQcRSC3GReChh00jQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Dominic Fifield take an insightful, occasionally light-hearted, look back at football in 2021 There is good and bad news for Spurs, praise for the game's local heroes, and criticism for Arsenal, who made the most disappointing signing of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Dominic Fifield take an insightful, occasionally light-hearted, look back at football in 2021 There is good and bad news for Spurs, praise for the game's local heroes, and criticism for Arsenal, who made the most disappointing signing of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Was Thomas Tuchel right to suggest football needs to prioritise player safety?</title>
			<itunes:title>Was Thomas Tuchel right to suggest football needs to prioritise player safety?</itunes:title>
			<pubDate>Mon, 20 Dec 2021 15:24:11 GMT</pubDate>
			<itunes:duration>41:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61c0a01b74b619001285797b/media.mp3" length="100460072" type="audio/mpeg"/>
			<guid isPermaLink="false">61c0a01b74b619001285797b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/was-thomas-tuchel-right-to-suggest-football-needs-to-priorit</link>
			<acast:episodeId>61c0a01b74b619001285797b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>was-thomas-tuchel-right-to-suggest-football-needs-to-priorit</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdMQxBQSkWKZ084UIt9+eHuxVU96CCKBCwwcejfFCjY9JBXpC0p9eKyRAPE5lv4NMXpxQImxzOxmJheU7UXakU1sVGEIkUWtur3rIz+FOweCYgLOYw6nAcTLufX33+bSrhMH4kAZx4Rzuk7oneCHFkI9CO3GQU9tZSJ5Z0fR1K35cQSDVooLjtEJrOTyieTcd9H4W/UKH6GcWcIyyAlBRVmB1/EXZIHskX4AiaHvQ1wjBg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Jordan Jarrett-Bryan assess the challenges football faces in the current public health crisis. They expect Manchester City to eventually run away with the Premier League, suggest Aston Villa have a lot to look forward to in 2022, and, amidst a spate of poor refereeing performances, call for an immediate revision of VAR.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Jordan Jarrett-Bryan assess the challenges football faces in the current public health crisis. They expect Manchester City to eventually run away with the Premier League, suggest Aston Villa have a lot to look forward to in 2022, and, amidst a spate of poor refereeing performances, call for an immediate revision of VAR.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Leeds United Marching On, into the Championship?</title>
			<itunes:title>Are Leeds United Marching On, into the Championship?</itunes:title>
			<pubDate>Fri, 17 Dec 2021 16:05:12 GMT</pubDate>
			<itunes:duration>50:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61bcb53845cc69001462cfdb/media.mp3" length="120744992" type="audio/mpeg"/>
			<guid isPermaLink="false">61bcb53845cc69001462cfdb</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-leeds-united-marching-on-into-the-championship</link>
			<acast:episodeId>61bcb53845cc69001462cfdb</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-leeds-united-marching-on-into-the-championship</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdNZcRvMK6uW09x7ZQrRpEFdWcrFTWKaMOW4W8uftx8Fydc4EkF5xGO5C/PtPgRr5eJifIGh/Y542bVfIo/kE6rIAsILcRHtsf/sOT30KxTdEH6B1xdR8Wafh9Gq8sxWCskqocAEyiEtWzos4nBJXSs8A4mv3hkdAzFQwegFFEK+Mdcw7nPvjF/xoDnRurRh3/xDsTxpNcCInJXc9qiogPNhtJhDh1GL7tZ10yRT7nGShQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Richard Amofa and Glenn Moore use the precarious state of Leeds&nbsp;United's season as an example of the perils of a "big club&nbsp;" mentality, Expectation may also be counter productive&nbsp;at Newcastle, while Burnley are fighting the law of diminishing returns. At a time of renewed uncertainty, the panel also discuss worryingly low vaccination rates amongst players.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Richard Amofa and Glenn Moore use the precarious state of Leeds&nbsp;United's season as an example of the perils of a "big club&nbsp;" mentality, Expectation may also be counter productive&nbsp;at Newcastle, while Burnley are fighting the law of diminishing returns. At a time of renewed uncertainty, the panel also discuss worryingly low vaccination rates amongst players.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will English clubs continue to dominate the Champions League?</title>
			<itunes:title>Will English clubs continue to dominate the Champions League?</itunes:title>
			<pubDate>Mon, 13 Dec 2021 17:17:21 GMT</pubDate>
			<itunes:duration>46:32</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61b78025df4a05001385c6b0/media.mp3" length="111619388" type="audio/mpeg"/>
			<guid isPermaLink="false">61b78025df4a05001385c6b0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/will-english-clubs-continue-to-dominate-the-champions-league</link>
			<acast:episodeId>61b78025df4a05001385c6b0</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>will-english-clubs-continue-to-dominate-the-champions-league</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdMahassVIA7MZhSuZeomxzbCHOU6YMVOZCZOjVgHVouNyTjvNuzeA0YB5tM+IUB/56KdquT44caimanY4HOvNCpMBDIiIX3K6cf66tXB+KXz9XRY0v+ajfhk+0k/KcHh/aJjNjP4lRJeOP1Jm5Xbfla6SWXoetC0+B9W3boywFbDvnrrVoFXg6Y49fOz0kmxt3oBXHDTD/OzGmh1NlrePAt2woub3UrTLdP+CPgjtEb8Q==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Tony Hodson analyse the re-drawn last 16 in the Champions League. Liverpool and Manchester City have marginally tougher assignments, but Chelsea will be happy to be facing Lille. Instead of the projected Ronaldo-Messi shoot-out, Manchester United must&nbsp;overcome Atletico Madrid's pantomime villains, Diego Simeone and Luis Suarez.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Tony Hodson analyse the re-drawn last 16 in the Champions League. Liverpool and Manchester City have marginally tougher assignments, but Chelsea will be happy to be facing Lille. Instead of the projected Ronaldo-Messi shoot-out, Manchester United must&nbsp;overcome Atletico Madrid's pantomime villains, Diego Simeone and Luis Suarez.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Chelsea come from behind in the three horse race for the Premier League title?</title>
			<itunes:title>Can Chelsea come from behind in the three horse race for the Premier League title?</itunes:title>
			<pubDate>Fri, 10 Dec 2021 14:51:43 GMT</pubDate>
			<itunes:duration>58:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61b36980ba2eb70014a8bdb7/media.mp3" length="83730132" type="audio/mpeg"/>
			<guid isPermaLink="false">61b36980ba2eb70014a8bdb7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/can-chelsea-come-from-behind-in-the-three-horse-race-for-the</link>
			<acast:episodeId>61b36980ba2eb70014a8bdb7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>can-chelsea-come-from-behind-in-the-three-horse-race-for-the</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdN8Xfl2SukQDAXixqMK9wg+/zroNKJikh+kgalL4i3upDgYZNACxh5UxFYo9KwqCo/KtzkytBQYrUaUYyYKscpCz/oqGIOHDiSOcTBWfzTUGJDSuXLXMhWX/rmPV0wRvH8nqqjyMGYzaVvKx0dIpPOHDdM5nNEpbJL9u30Y+CJAmw2SCmLrB16W0QF1oplHTiVMd+/mkBr/OpgMcpAgtjVNrkPNWq9w/nlC92QnKHGRTQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Seb Stafford Bloor assess a critical six match sequence for contenders for the Premier League crown. Chelsea need to provide the right service to Romelu Lukaku, Manchester City require more from Jack Grealish and Liverpool can't be distracted by the Stevie G love in. The panel also look at Everton, Newcastle, Arsenal, Leicester and West Ham.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Seb Stafford Bloor assess a critical six match sequence for contenders for the Premier League crown. Chelsea need to provide the right service to Romelu Lukaku, Manchester City require more from Jack Grealish and Liverpool can't be distracted by the Stevie G love in. The panel also look at Everton, Newcastle, Arsenal, Leicester and West Ham.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>In an era of English dominance, are Chelsea capable of retaining the Champions League title?</title>
			<itunes:title>In an era of English dominance, are Chelsea capable of retaining the Champions League title?</itunes:title>
			<pubDate>Mon, 06 Dec 2021 07:00:20 GMT</pubDate>
			<itunes:duration>44:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61aa09969b26010013f96509/media.mp3" length="105746888" type="audio/mpeg"/>
			<guid isPermaLink="false">61aa09969b26010013f96509</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/in-an-era-of-english-dominance-are-chelsea-capable-of-retain</link>
			<acast:episodeId>61aa09969b26010013f96509</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>in-an-era-of-english-dominance-are-chelsea-capable-of-retain</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdPmxtINbXVJNTlP0I1OfRFCfUhc65IbXvp5Ao44amIq9eDnPn4DD9tIipSmhiLNtA4IVSISAjd0fNhSUkQsFln2S9UWHcfby91ukBGd8tskK2S5dHGZP3eLw+MtL2QQCF2mEQA1xJEWShKlgIO/z9n7CxOo/CgZtlKQ70Xj09NmIsLBoGmebeD0tA1x9TaRqzTbYmJRL4ocLSbr/3+R9xQqfkNrUj8VqBWXqG0q7i1rEA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Glenn Moore assess the balance of power in European club football as the Champions League enters its final round of fixtures in the group stages. They look at the&nbsp;relative merits of the Premier League, Bundesliga, La Liga and Serie A before choosing their eventual winner from a widely-accepted elite group of four teams.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Glenn Moore assess the balance of power in European club football as the Champions League enters its final round of fixtures in the group stages. They look at the&nbsp;relative merits of the Premier League, Bundesliga, La Liga and Serie A before choosing their eventual winner from a widely-accepted elite group of four teams.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has Rafa Benitez made the biggest mistake of a celebrated managerial career?</title>
			<itunes:title>Has Rafa Benitez made the biggest mistake of a celebrated managerial career?</itunes:title>
			<pubDate>Thu, 02 Dec 2021 15:10:11 GMT</pubDate>
			<itunes:duration>45:29</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61a8e1d3f7588d00146780b7/media.mp3" length="109076204" type="audio/mpeg"/>
			<guid isPermaLink="false">61a8e1d3f7588d00146780b7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/has-rafa-benitez-made-the-biggest-mistake-of-a-celebrated-ma</link>
			<acast:episodeId>61a8e1d3f7588d00146780b7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>has-rafa-benitez-made-the-biggest-mistake-of-a-celebrated-ma</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdMPBeYYp8gtdqErvkrqtDYfrRnZ9BputKNv5ClX18mhWSYK4ik4rdjMONzvT3dOS20WSCOEqW3rhbiU2yAGlndXDMeZLb3LbzYUD8g0Ivnpep2U3J99IWiNIxSpbari8dWfDss5rcEQWfQ/CZWyN7VAKg+t+vlYOOeiaCMnspsODCiz3rsnlv78f09b8hGwIYesC8PZWi0ghekU4gbHU3HjhJfY0oUKAeLLED7ps4qBgg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Glenn Moore question the wisdom of Rafa Benitez's decision to join Chelsea, and suggest he is a victim of generational change in football management. They examine Newcastle's plight, reflect on the dominance of the top three in the Premier League, and look forward to the women's FA Cup final&nbsp;between Arsenal and Chelsea on Sunday.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Glenn Moore question the wisdom of Rafa Benitez's decision to join Chelsea, and suggest he is a victim of generational change in football management. They examine Newcastle's plight, reflect on the dominance of the top three in the Premier League, and look forward to the women's FA Cup final&nbsp;between Arsenal and Chelsea on Sunday.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Liverpool destined to cost Rafa Benitez his job at Everton?</title>
			<itunes:title>Are Liverpool destined to cost Rafa Benitez his job at Everton?</itunes:title>
			<pubDate>Mon, 29 Nov 2021 15:04:04 GMT</pubDate>
			<itunes:duration>55:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61a4f106b8e4d60019459616/media.mp3" length="133018256" type="audio/mpeg"/>
			<guid isPermaLink="false">61a4f106b8e4d60019459616</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-liverpool-destined-to-cost-rafa-benitez-his-job-at-evert</link>
			<acast:episodeId>61a4f106b8e4d60019459616</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-liverpool-destined-to-cost-rafa-benitez-his-job-at-evert</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdP+4EXeLdcMdnoU42YK2A47Pipo4hw7ZhHgZc5Prx7Wwpu31ubJE5fxhFJZa73jmG+TD1Qah9+DZtjZGBPRRpiJ/BAgIodLStEobmEFYlUkJVQVkG6Os6moHSpPoXEq7dLs8TFNviUwIn11y3SszVUuGRP8dB3cIs9iI+d/aQgrXCFcV86RlRLTrZuB48xLMWv1rxhiHdMuv/cR9AqY6BaF256SvMDFt6iqzqW+6nlb+A==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and John Cross look forward to a hugely significant Merseyside derby, and suggest Rafa Benitez may be a prisoner of previous regimes at Goodison Park. They believe relegation would not necessarily be a bad thing for Newcastle, and wonder whether Manchester United are already being managed remotely by Ralf Rangnick.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and John Cross look forward to a hugely significant Merseyside derby, and suggest Rafa Benitez may be a prisoner of previous regimes at Goodison Park. They believe relegation would not necessarily be a bad thing for Newcastle, and wonder whether Manchester United are already being managed remotely by Ralf Rangnick.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Ralf Rangnick oversee a revolution at Manchester United?</title>
			<itunes:title>Will Ralf Rangnick oversee a revolution at Manchester United?</itunes:title>
			<pubDate>Fri, 26 Nov 2021 15:49:47 GMT</pubDate>
			<itunes:duration>51:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61a10307c655d200124a5abc/media.mp3" length="124655816" type="audio/mpeg"/>
			<guid isPermaLink="false">61a10307c655d200124a5abc</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/will-ralf-rangnick-oversee-a-revolution-at-manchester-united</link>
			<acast:episodeId>61a10307c655d200124a5abc</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>will-ralf-rangnick-oversee-a-revolution-at-manchester-united</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdNPtj3ULBTknBo53ehry+gJh4ClwlUStHPBDhWFjyNrUIAThRE4OzWMDLpNFIxpq52TsBRmlGhziN7bJbZ9OOFHCaVz1CNJvxJkap6Pumd02BTC3Mn8tDlChzOaeUqcqldA1Ly6frl5Pyq0KLKjUt4kGxyDMDdt9kT4S/bVDUUWtgfwpao0sdwU8mibrdxjepqEulk6jN1l8nJ4y0aTIVazTwZ582TIQXWHSrRVABwIzQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Dominic Fifield welcome Ralf Rangnick's arrival at Manchester United, but wonder whether he will be allowed to reshape the club in his own image, They praise Chelsea's youth development ,foresee problems for Antonio Conte at Tottenham, and believe the fan-led review of the game has the potential to be the catalyst for positive change.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Dominic Fifield welcome Ralf Rangnick's arrival at Manchester United, but wonder whether he will be allowed to reshape the club in his own image, They praise Chelsea's youth development ,foresee problems for Antonio Conte at Tottenham, and believe the fan-led review of the game has the potential to be the catalyst for positive change.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who can clear up the mess at Manchester United?</title>
			<itunes:title>Who can clear up the mess at Manchester United?</itunes:title>
			<pubDate>Mon, 22 Nov 2021 15:27:05 GMT</pubDate>
			<itunes:duration>53:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/619bb6c9919ddf0012fd31b6/media.mp3" length="129194084" type="audio/mpeg"/>
			<guid isPermaLink="false">619bb6c9919ddf0012fd31b6</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/who-can-clear-up-the-mess-at-manchester-united</link>
			<acast:episodeId>619bb6c9919ddf0012fd31b6</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>who-can-clear-up-the-mess-at-manchester-united</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdOEUxx8H6ekM6Gu2dyt3SWvYoijfkDv4hWn2FsoI1rM7ui1OEFLMuwkUysHwYY6dYdvcTlnG8MJehI+IFJ3IFo+/SSpojBrMXm9C6YK3+RT/6JHA8cztmE51agD7a+3CyDCtka+me38XJMEOXYJA+6CVeAkFqMp8sdwe4qi5zHaoZBeVOi5s/ad1qaGjexuZq6/oEqhdktsF77NeA1fPbAZlIrE7uzMcGc+TuIL/Zck2w==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Tony Hodson analyse Manchester United's long term problems, which may be too onerous, even for Mauricio Pochettino They praise the ruthless efficiency of the Premier League's top three, and, in Champions League week, highlight Xavi's shrewdness in taking charge of what could be another golden generation at Barcelona.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Tony Hodson analyse Manchester United's long term problems, which may be too onerous, even for Mauricio Pochettino They praise the ruthless efficiency of the Premier League's top three, and, in Champions League week, highlight Xavi's shrewdness in taking charge of what could be another golden generation at Barcelona.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Which of the new Premier League managers will be most successful?</title>
			<itunes:title>Which of the new Premier League managers will be most successful?</itunes:title>
			<pubDate>Thu, 18 Nov 2021 15:10:02 GMT</pubDate>
			<itunes:duration>49:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61966ccbcef9ae0014559870/media.mp3" length="119125748" type="audio/mpeg"/>
			<guid isPermaLink="false">61966ccbcef9ae0014559870</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/which-of-the-new-premier-league-managers-will-be-most-succes</link>
			<acast:episodeId>61966ccbcef9ae0014559870</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>which-of-the-new-premier-league-managers-will-be-most-succes</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdNFZzsodpQ8EF0b+HLRXtunJNi/EYrXj47JQsFEBP1C/pttlfB9voq1qQC0yO7SMWiWHwMPQD9z1DiTJpixMFykaCvnhbla61rjIus1NczYB4LnX0ORxslnJ4RdhQOpA63Fb+0McDsBZ1/TjV5C+3lFyAmsCjtNTRwMB4l7B2iDGYjWEdyli3JKd8xUTD+XZt01hIWpthmkVxokkr444pjfKorz5EGjpi/rlzslwEfZMg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Richard Amofa consider the consequences of change in the Premier League. They believe Steven Gerrard and Dean Smith are a perfect fit for their new clubs, Aston Villa and Norwich, but have reservations about Eddie Howe's impact at Newcastle. Leicester's Brendan Rodgers would be a significant managerial upgrade for Manchester United.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Richard Amofa consider the consequences of change in the Premier League. They believe Steven Gerrard and Dean Smith are a perfect fit for their new clubs, Aston Villa and Norwich, but have reservations about Eddie Howe's impact at Newcastle. Leicester's Brendan Rodgers would be a significant managerial upgrade for Manchester United.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Why aren't Manchester United acting as ruthlessly as other Premier League clubs?]]></title>
			<itunes:title><![CDATA[Why aren't Manchester United acting as ruthlessly as other Premier League clubs?]]></itunes:title>
			<pubDate>Mon, 08 Nov 2021 15:34:38 GMT</pubDate>
			<itunes:duration>54:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6189438e88f22a001a335585/media.mp3" length="129506240" type="audio/mpeg"/>
			<guid isPermaLink="false">6189438e88f22a001a335585</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/why-arent-manchester-united-acting-as-ruthlessly</link>
			<acast:episodeId>6189438e88f22a001a335585</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>why-arent-manchester-united-acting-as-ruthlessly</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdNZr9cNYc2kyGwdVtvMscyy69ozQb2iEIIQ8XMr+/9pazTsLbKFCnxBZr/NIjFrJRZd7SIh29AENM1zlsLV/vHUpFQvd7IVV+QqytZPjkBk+LT248PVcubcHYyOemYA9Legzx0zVEabcSgl8h05c6EN3mqJzFBzdLFcinBeOzg5dUVaUYon5V+KJREreLV8JEhYFIkaQcp7Ccsmwil8nGO7d/9nMPVTxxX02WL3QrAn3w==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Miguel Delaney assess football's sacking season. They suggest Ole Gunnar Soskjaer should be put out of his misery at Manchester United, feel Dean Smith was the victim of the cruellest cut at Aston Villa, and believe Norwich&nbsp;City, rather than Newcastle United, would be the best fit for Eddie Howe.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Miguel Delaney assess football's sacking season. They suggest Ole Gunnar Soskjaer should be put out of his misery at Manchester United, feel Dean Smith was the victim of the cruellest cut at Aston Villa, and believe Norwich&nbsp;City, rather than Newcastle United, would be the best fit for Eddie Howe.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>How far can Antonio Conte take Tottenham this season?</title>
			<itunes:title>How far can Antonio Conte take Tottenham this season?</itunes:title>
			<pubDate>Fri, 05 Nov 2021 14:38:36 GMT</pubDate>
			<itunes:duration>50:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/618541ecd3839a0013a89363/media.mp3" length="120094580" type="audio/mpeg"/>
			<guid isPermaLink="false">618541ecd3839a0013a89363</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/how-far-can-antonio-conte-take-tottenham-this-season</link>
			<acast:episodeId>618541ecd3839a0013a89363</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>how-far-can-antonio-conte-take-tottenham-this-season</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdPCotMZ1RTD2jHFx3UB7oK89refRo+dunrmlONpISzdJL9zsoRtF+fsvPcBgIlHQYgK8XAENQJae4h/wTm6RcAvYWSK3SfVXTHTkQPBEGuLHKkOBaAYJRvhJ9wLRVL0IPM3a2prnMX7JmAC8Ambp/Njjambru4K8gat1itWkJZPgMSjQ90JAkyv/Jf/Jx8mBdWX9/xVWIm3923flsEn2+uwl1JVAWzO3S8pYQv50KgNRA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Glenn Moore and Anne Marie Batson examine the challenges Antonio Conte faces at Spurs, and the realistic limits of his ambition this season. They suspect Rafa Benitez would have been a better fit at Newcastle than Eddie Howe, and have sympathy for the struggle of Jadon Sancho to establish himself at Manchester United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Glenn Moore and Anne Marie Batson examine the challenges Antonio Conte faces at Spurs, and the realistic limits of his ambition this season. They suspect Rafa Benitez would have been a better fit at Newcastle than Eddie Howe, and have sympathy for the struggle of Jadon Sancho to establish himself at Manchester United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Will Nuno be the only victim of football's sacking season?]]></title>
			<itunes:title><![CDATA[Will Nuno be the only victim of football's sacking season?]]></itunes:title>
			<pubDate>Mon, 01 Nov 2021 15:54:30 GMT</pubDate>
			<itunes:duration>53:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61800db6be2ac40012ea651e/media.mp3" length="129289088" type="audio/mpeg"/>
			<guid isPermaLink="false">61800db6be2ac40012ea651e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/will-nuno-be-the-only-victim-of-footballs-sacking-season</link>
			<acast:episodeId>61800db6be2ac40012ea651e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>will-nuno-be-the-only-victim-of-footballs-sacking-season</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9CxzCI55D73wNDl40aIpzackMb7c8AEhZYbjA26c3lo5Dq8ttVoAz7g+tQhslHnj3VtOoigLka4iNAp3CE0RIR9NYwRZvfi1Gr+gv6AhSm7X6CTqov4QGT4hnYSZkrI4JFdMLuR+AEv9EXOi4p7TGzqQLNrBFGjNxXflCJFBuha7iW481IX0dG1vLIU1DePog7K3Y+hAkAqbVnMh32yTbYieykESenYzvPyqkqFNGVbL94yTtp0iOD7XmZmTI6ogrU4dlWwKjBRU+sq70WoIKjQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Ade Oladipo and Seb Stafford Bloor analyse the departure of Nuno Espirito Santo after only 17 matches as Tottenham manager, and the initial links with Antonio Conte. They believe Aston Villa should stand by the under-pressure Dean Smith, and discuss another critical week at Manchester United for Ole Gunnar Solskjaer.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Ade Oladipo and Seb Stafford Bloor analyse the departure of Nuno Espirito Santo after only 17 matches as Tottenham manager, and the initial links with Antonio Conte. They believe Aston Villa should stand by the under-pressure Dean Smith, and discuss another critical week at Manchester United for Ole Gunnar Solskjaer.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Manchester United in danger of being left behind?</title>
			<itunes:title>Are Manchester United in danger of being left behind?</itunes:title>
			<pubDate>Thu, 28 Oct 2021 13:50:21 GMT</pubDate>
			<itunes:duration>47:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/617aaa9dc9247f0012c7e6ba/media.mp3" length="112861748" type="audio/mpeg"/>
			<guid isPermaLink="false">617aaa9dc9247f0012c7e6ba</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-manchester-united-in-danger-of-being-left-behind</link>
			<acast:episodeId>617aaa9dc9247f0012c7e6ba</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-manchester-united-in-danger-of-being-left-behind</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Z8gqAGxpoh2oY0xhqnwwPVK9t9XyT2b9Vvm6eAkGn+CnRkN5TprGasCj2zWkM4UhLuq0EM4Mepjijp5mZYdaUtuGM5CRVsH3qImuIan6IKyc2eEoY4viCHpQd0l90zfdTJWID6jRxumkTNlE5Gg5YfQueHDPR/o2aia/E5PxZnZdWRvWyHcd+UOhjYB689IXKiIMisFe5TAtloDR7hZJBUH3hoOFyeH+ksMRaDmlj1Tx/Hxqk2t3hF+Nd9Qjof1RlEKryliI7kMjIHjmaklBsr13ii3xG7BuuwHpqG4I9to=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Adrian Clarke suggest the plight of Ole Gunnar Solskjaer is a symbol of Manchester United's failure to move with the times. They highlight the contrasting&nbsp;fortunes of two former United managers, David Moyes and Jose Mourinho, and look at the limitations of Marcelo Bielsa's approach, at Leeds United. They also welcome the unanimous support for Australian player Josh Cavallo's decision to reveal his sexuality.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Adrian Clarke suggest the plight of Ole Gunnar Solskjaer is a symbol of Manchester United's failure to move with the times. They highlight the contrasting&nbsp;fortunes of two former United managers, David Moyes and Jose Mourinho, and look at the limitations of Marcelo Bielsa's approach, at Leeds United. They also welcome the unanimous support for Australian player Josh Cavallo's decision to reveal his sexuality.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is it time for Manchester United to move on from Ole Gunnar Solksjaer?</title>
			<itunes:title>Is it time for Manchester United to move on from Ole Gunnar Solksjaer?</itunes:title>
			<pubDate>Mon, 25 Oct 2021 12:03:14 GMT</pubDate>
			<itunes:duration>48:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61769d02d1762d00151d7c17/media.mp3" length="115866380" type="audio/mpeg"/>
			<guid isPermaLink="false">61769d02d1762d00151d7c17</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-it-time-for-manchester-united-to-move-from-ole-gunnar</link>
			<acast:episodeId>61769d02d1762d00151d7c17</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-it-time-for-manchester-united-to-move-from-ole-gunnar</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Zj2d7vDaBY1dxWQDkgupa6fi770wVc6uO+3pPxDgJ1JrC1ggFaOBWSbMsYq/x2Rfh/Zqw8dInkhigwFIu2cV2bFwNt9iTLJrwnzn1uLswQLmAswpPnLp/Zd4/Atn3jduBLE/bj+Q1x//l5BZ3plV+JDkaPNGrohkhvuqbJOKTqpEOnxa/WlBV0Yf/t8CzO5VCA11Yhm4vHICYIP1jEZYPszmqhwouDgbhdRtbX9v7W+Fbrql3c+hYIH22onTU4XNTe4Vmn9OPEmtP1FVcxpz6l361twMVEj0aNYjZfmy1T4=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Richard Amofa call for change at Old Trafford, following Manchester United's humiliation by Liverpool. They believe the gap between the top three and the rest of the Premier League will continue to widen, with clubs like Norwich simply unable to cope.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Richard Amofa call for change at Old Trafford, following Manchester United's humiliation by Liverpool. They believe the gap between the top three and the rest of the Premier League will continue to widen, with clubs like Norwich simply unable to cope.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is criticism of football managers out of control?</title>
			<itunes:title>Is criticism of football managers out of control?</itunes:title>
			<pubDate>Fri, 22 Oct 2021 12:58:13 GMT</pubDate>
			<itunes:duration>57:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6172b565935aad00146a2079/media.mp3" length="82580796" type="audio/mpeg"/>
			<guid isPermaLink="false">6172b565935aad00146a2079</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-criticism-of-football-managers-out-of-control</link>
			<acast:episodeId>6172b565935aad00146a2079</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-criticism-of-football-managers-out-of-control</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdNB4u1MbNygBgy4VtStsTGZDTm4svZmzStw+pmjnI3CvDVSxJNi0XoecF251QwStf2cTLruL/9ClcusF/ueq1NKiSnofn1BDrO3SF+lNlndVSbYDN2CxVjrSkb9BNbTRPS8hR2CtfEL/wg6e3Eu/TEtyB7FZB1m6ZiOeDg7J+srIA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Tony Hodson discuss the dehumanising nature of football management, and the pressure exerted on managers like Steve Bruce and Ole Gunnar Solksjaer. They examine Liverpool's chances of victory at Old Trafford, consider a challenging period for Thomas Tuchel, and suggest that coaches like Thomas Frank and Graham Potter have the ability to thrive at the biggest clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Tony Hodson discuss the dehumanising nature of football management, and the pressure exerted on managers like Steve Bruce and Ole Gunnar Solksjaer. They examine Liverpool's chances of victory at Old Trafford, consider a challenging period for Thomas Tuchel, and suggest that coaches like Thomas Frank and Graham Potter have the ability to thrive at the biggest clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will the Champions League eventually evolve into a Super League?</title>
			<itunes:title>Will the Champions League eventually evolve into a Super League?</itunes:title>
			<pubDate>Mon, 18 Oct 2021 12:42:27 GMT</pubDate>
			<itunes:duration>52:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/616d6bb43f687400146696bf/media.mp3" length="126299072" type="audio/mpeg"/>
			<guid isPermaLink="false">616d6bb43f687400146696bf</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/will-the-champions-league-eventually-evolve-into-a-super-lea</link>
			<acast:episodeId>616d6bb43f687400146696bf</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>will-the-champions-league-eventually-evolve-into-a-super-lea</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9eZkk+Kj+QttAJwPOH7nyNlD39VJ7VojMTOGQJkSS93nIEU+jw5QqGNhQykMAeHZdLBwRy7rBGQeTvUM1O7S8/2eWWbGuK9nGzsIBP81ACJxAm1Oh0BY/znRI2pHxkODVoMqwFxpzNQux9TwjrELAPoncUzKwoYaiXyG2JloUAlLpJ7ICL9jkBYpe0aNFpCp868F9pCFefRBiNaBeT1qzS+embSxvY0pDd5hEMfRJnqNYJjkyIjP6iJQbdRZjKbOQJpdCJC+VyPuY0IyzGHhbzD97Y1dfRj5mWNsfPpc0Ojw=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and John Cross look forward&nbsp;to the return of the&nbsp;Champions League, and discuss how it may eventually be reshaped by the financial and political pressures of modern football. They call for change at Manchester United, suggest Mo Salah's future should lie with Liverpool, and believe all is not well behind the scenes at Newcastle United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and John Cross look forward&nbsp;to the return of the&nbsp;Champions League, and discuss how it may eventually be reshaped by the financial and political pressures of modern football. They call for change at Manchester United, suggest Mo Salah's future should lie with Liverpool, and believe all is not well behind the scenes at Newcastle United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>How long will it take to turn Newcastle United into Premier League contenders?</title>
			<itunes:title>How long will it take to turn Newcastle United into Premier League contenders?</itunes:title>
			<pubDate>Thu, 14 Oct 2021 13:29:03 GMT</pubDate>
			<itunes:duration>52:54</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6168309f102fc20013c2bfea/media.mp3" length="126876404" type="audio/mpeg"/>
			<guid isPermaLink="false">6168309f102fc20013c2bfea</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/how-long-will-it-take-to-turn-newcastle-united-into-premier</link>
			<acast:episodeId>6168309f102fc20013c2bfea</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>how-long-will-it-take-to-turn-newcastle-united-into-premier</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9QLkPqozAcsLNa8VFZv9JjcMIt0rBbsnFFdBi4vcOTKV9xn46mqyPsXQpyT9yXAmFVm6D9MnqLEi1zsvODVgxjkOigbENhW78Dry4pvu5VJTUwh3BzefSw2B71Lt+FDHfuqJuRGT3a/+KjAU6w33Gth6IaBQVJTgWBrrXxC3RVI54oYti3JhQBcrubod6cA460RAkR1lGJHdKxohjYgxROZN9FYU61PwieO/uTVaJfUoXWLc4WPOnUFnKYNqmFm0kHNXDcCpcUHnRVQ8K28jyWg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Glenn Moore share the disquiet about the nature&nbsp;of Newcastle United's takeover, and warn the rebuild will take longer than the majority of fans appear to think. They welcome Claudio Ranieri back to the Premier League with Watford, suggest Leicester will reset their season at Manchester United's expense, and foresee&nbsp;sustained struggle for Norwich, Burnley and Southampton.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Glenn Moore share the disquiet about the nature&nbsp;of Newcastle United's takeover, and warn the rebuild will take longer than the majority of fans appear to think. They welcome Claudio Ranieri back to the Premier League with Watford, suggest Leicester will reset their season at Manchester United's expense, and foresee&nbsp;sustained struggle for Norwich, Burnley and Southampton.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is it a three horse race for the Premier League title?</title>
			<itunes:title>Is it a three horse race for the Premier League title?</itunes:title>
			<pubDate>Mon, 04 Oct 2021 14:03:01 GMT</pubDate>
			<itunes:duration>1:00:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/615b099550909b0013bab184/media.mp3" length="144161912" type="audio/mpeg"/>
			<guid isPermaLink="false">615b099550909b0013bab184</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-it-a-three-horse-race-for-the-premier-league-title</link>
			<acast:episodeId>615b099550909b0013bab184</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-it-a-three-horse-race-for-the-premier-league-title</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9TJ8c4ZztYuUQ6Xe2Uci682eRGx0DYdZMhaWW1C64dg9N2FDtlbZ8SqFN1BNwyENWIAugiGURyoLgVuodwJNmeQwQaVl+BbnDpt7tlovg8jIZVNn6yjtF1RMk0Lh3Hn8tx7JU615AeFCDQr2Tn8z0VTS9P3OqTE7DMB6jbZhZ8JxkXNYAIOd4OAQoQPGC0w3ejyYhA3BagTkTGMGHBE/omkLaldahvP4pqu6SUgPbuN/xXzMbIGrOhCFM1kieQq2yQtlNRfnBrNUO3UdBU/0lcg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Darren Lewis assess potential champions as the Premier League takes shape. They praise Brentford and Brighton for their distinctive approaches, appreciate the power of Rafa Benitez's pragmatism, but can see no end to the travails of one of his former clubs, Newcastle United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Darren Lewis assess potential champions as the Premier League takes shape. They praise Brentford and Brighton for their distinctive approaches, appreciate the power of Rafa Benitez's pragmatism, but can see no end to the travails of one of his former clubs, Newcastle United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Ole Gunnar Solksjaer survive as the Harry Houdini of modern football?</title>
			<itunes:title>Can Ole Gunnar Solksjaer survive as the Harry Houdini of modern football?</itunes:title>
			<pubDate>Fri, 01 Oct 2021 14:42:21 GMT</pubDate>
			<itunes:duration>52:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61571e4d5954b70012c6c3e9/media.mp3" length="125000336" type="audio/mpeg"/>
			<guid isPermaLink="false">61571e4d5954b70012c6c3e9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/can-ole-gunnar-solksjaer-survive-as-the-harry-houdini-of-mod</link>
			<acast:episodeId>61571e4d5954b70012c6c3e9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>can-ole-gunnar-solksjaer-survive-as-the-harry-houdini-of-mod</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9H4pFosNuBGzQo3HrCmuKwZYH+0A9uMvdl1mZlSx9xIh2trpKgXpYNGc56ocQP5HSApiByX9uFvkdOkgOsVpCXPZyo23PPNMWmwkv2XH6WCy8Uj8zI/ZB3Pb8NDchDSb8yz+OgUxVItkjKKIEq6KnXXC5GZqO7eqVDUFHq+ULuw+s+ICP5qrjl2MAo66FwvvQ31QVF4nC0IqEgoF+IcJYrLaPRJf9a6g6gFwo4R6mYLANxN+1HdcbuVPAowBbwcZOLuus1uD0fVr6sxmDeZhIWg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Dominic Fifield suggest Solksjaer&nbsp;has until the end of the&nbsp;season to prove himself as Manchester United manager, Seb makes a passionate plea for change at Spurs, Dom expects Chelsea to be tactically tweaked after the international break, and Mike speaks of his despair at the latest, most shocking, example of racial abuse in European football.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Dominic Fifield suggest Solksjaer&nbsp;has until the end of the&nbsp;season to prove himself as Manchester United manager, Seb makes a passionate plea for change at Spurs, Dom expects Chelsea to be tactically tweaked after the international break, and Mike speaks of his despair at the latest, most shocking, example of racial abuse in European football.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Is this the week that shapes Manchester City's season?]]></title>
			<itunes:title><![CDATA[Is this the week that shapes Manchester City's season?]]></itunes:title>
			<pubDate>Mon, 27 Sep 2021 15:02:34 GMT</pubDate>
			<itunes:duration>51:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6151dd0a509f3f00126165cb/media.mp3" length="124252832" type="audio/mpeg"/>
			<guid isPermaLink="false">6151dd0a509f3f00126165cb</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/is-this-the-week-that-shapes-manchester-citys-season</link>
			<acast:episodeId>6151dd0a509f3f00126165cb</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>is-this-the-week-that-shapes-manchester-citys-season</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9OjYGB4WafvbSxs1o7qMgYRv2+tiOApbowhvSMuTwrvgOEAv+WRXuMvw4f1mGD7v212MzT49b9EObk3dWmKtss8lNx7oZpJt9IQpWQ6lVsunYn1CLxKA4wHYHV7UM4hEAHfJYv7iOinLPTcw5cEQZS4s3TqOkFILCp+zDh1tTmhGrSFTiCort9T+ChqsayzCbB/pf/bpVWaV70KLaUHOMoisiGPRgBj9MV/Y/xyEYQUDufPlNbrkBiurw0o+A4RyE0pGezpPlQI+k2NROb0r+/g==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Glenn Moore look ahead&nbsp;to Manchester&nbsp;City's Champions League tie against PSG, sandwiched between pivotal Premier League games against Chelsea and Liverpool, who should prevail in their ties against Juventus and Porto respectively. Manchester United cannot afford defeat against&nbsp;Villareal at Old Trafford, and the success of David Moyes highlights Tottenham's folly in appointing Nuno.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Glenn Moore look ahead&nbsp;to Manchester&nbsp;City's Champions League tie against PSG, sandwiched between pivotal Premier League games against Chelsea and Liverpool, who should prevail in their ties against Juventus and Porto respectively. Manchester United cannot afford defeat against&nbsp;Villareal at Old Trafford, and the success of David Moyes highlights Tottenham's folly in appointing Nuno.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Has Thomas Tuchel got inside Pep Guardiola's head?]]></title>
			<itunes:title><![CDATA[Has Thomas Tuchel got inside Pep Guardiola's head?]]></itunes:title>
			<pubDate>Thu, 23 Sep 2021 14:06:41 GMT</pubDate>
			<itunes:duration>54:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/614c89f137e57b001214d2dd/media.mp3" length="129635696" type="audio/mpeg"/>
			<guid isPermaLink="false">614c89f137e57b001214d2dd</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/has-thomas-tuchel-got-inside-pep-guardiolas-head</link>
			<acast:episodeId>614c89f137e57b001214d2dd</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>has-thomas-tuchel-got-inside-pep-guardiolas-head</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Wr72vc2x+wMujoEuS9j/8Y0uQ1YALU7ZBiSqn3L08+lixYEgQfJCAwuoM5ql2WComVnKacumNu9bcaUs1wAvuhYjDHEIB1d8Z2NjRVJvyZEEWK0LqvL//IB6wyc5MHe4s4PcSO+1EeMYcpVIi5jVRUpW8hDycOALFexqe/813wyansgbTy2fHJeklcy9wGwd5IbjKnkOXoeB3Ta7oE47V0QMG/BXoI0tJFPgJwJ6PAm3ltAg2rHQrMAYMqwDth9DK9a0waCRSj95yPjpxGGuHw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Tony Hodson believe Thomas Tuchel's Chelsea will continue their recent domination of Pep Guardiola's Manchester City at Stamford Bridge on Saturday. They focus on the merits of a range of Premier League coaches, including Dean Smith, Thomas Franck, Nuno, Rafa Benitez and Daniel Farke, but disagree with Bayern Munich's Julian Nagelsman's campaign for football to undergo a technological revolution.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Tony Hodson believe Thomas Tuchel's Chelsea will continue their recent domination of Pep Guardiola's Manchester City at Stamford Bridge on Saturday. They focus on the merits of a range of Premier League coaches, including Dean Smith, Thomas Franck, Nuno, Rafa Benitez and Daniel Farke, but disagree with Bayern Munich's Julian Nagelsman's campaign for football to undergo a technological revolution.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Have Liverpool got their mojo back?</title>
			<itunes:title>Have Liverpool got their mojo back?</itunes:title>
			<pubDate>Mon, 20 Sep 2021 14:28:48 GMT</pubDate>
			<itunes:duration>56:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61489aa04cbe3100149a7f3a/media.mp3" length="134770088" type="audio/mpeg"/>
			<guid isPermaLink="false">61489aa04cbe3100149a7f3a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/have-liverpool-got-their-mojo-back</link>
			<acast:episodeId>61489aa04cbe3100149a7f3a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>have-liverpool-got-their-mojo-back</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9vf/JhV0KciIpAawVL/9csvlW+7AdLTDwYSvY+g39RjZ5j5sFCSNAlRnfBzg3LT8YCPChsCpTkQAqq+omDU3CMhvzrAm9RHfnzto/nR8qaUnE1x2z0CJAueF0LrveFaq8e8LAAo9hQk04M+1cN8rIMOab1XoGYVpeM5stHyi7GB1LRt2Z9RqXXiM7Bx+MfWwe1a7ioeTc4zuLU7ATf2D4XrjxhidsAQQLhZKFbGsRhE9gPrwioB9vjB96Rc34hD2Q8hKSDaCc1i3ukNTYQWaxgw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Faye Carruthers and John Cross discuss Liverpool's resurgence, and their ability to resist the remorselessness of Chelsea, who face Manchester City in a definitive fixture next weekend. They also dwell on the human side of football, praising Manchester United's Phil Jones for his candour, and Brighton for their concentration on the wellbeing of their players, Due tribute is also paid to the humanity of a timeless hero, Jimmy Greaves.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Faye Carruthers and John Cross discuss Liverpool's resurgence, and their ability to resist the remorselessness of Chelsea, who face Manchester City in a definitive fixture next weekend. They also dwell on the human side of football, praising Manchester United's Phil Jones for his candour, and Brighton for their concentration on the wellbeing of their players, Due tribute is also paid to the humanity of a timeless hero, Jimmy Greaves.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Ole Gunnar Solksjaer answer recurring doubts about his managerial quality? </title>
			<itunes:title>Can Ole Gunnar Solksjaer answer recurring doubts about his managerial quality? </itunes:title>
			<pubDate>Thu, 16 Sep 2021 13:37:50 GMT</pubDate>
			<itunes:duration>49:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/614348ae9b118800141e0959/media.mp3" length="118945136" type="audio/mpeg"/>
			<guid isPermaLink="false">614348ae9b118800141e0959</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/can-ole-gunnar-solksjaer-answer-recurring-doubts-about-his-m</link>
			<acast:episodeId>614348ae9b118800141e0959</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>can-ole-gunnar-solksjaer-answer-recurring-doubts-about-his-m</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9DeYIySr9iE7YZwUC5sJtEJ2Gn80tWHApfTdtq3IZ50YD8LTI7+ZZtINbyWkh9DYqD4GMLtTVzUXJKf4yX7bVrEHCCHWDWjSwX5bJ/D2PB/grWk/2T6YePuQyltPAolEPYNV5MOS01cJ6Llp2hppSE5tLqKFpoBJnw45A9UYMh0myn/Z/1RFbbbeqnsZNjcOcVQbT4veVt+tO53J5FQliH+NYQM0PZVFNEmuhp7LDH2UjmiHJYshvPrSBSRgrWsgtI819ScJO7sGtq57nHze84BTnxNf+IcRNsAVkz/cyZMI=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Richard Amofa assess Ole Gunnar Solksjaer's&nbsp;future at Manchester United in the light of the&nbsp;latest criticism of his approach. They sense similar issues with Mikel Arteta,praise&nbsp;the tactical acumen of Thomas Tuchel, and would love to see Robert Lewandowski at Liverpool.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Richard Amofa assess Ole Gunnar Solksjaer's&nbsp;future at Manchester United in the light of the&nbsp;latest criticism of his approach. They sense similar issues with Mikel Arteta,praise&nbsp;the tactical acumen of Thomas Tuchel, and would love to see Robert Lewandowski at Liverpool.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Chelsea successfully defend the Champions League title?</title>
			<itunes:title>Can Chelsea successfully defend the Champions League title?</itunes:title>
			<pubDate>Mon, 13 Sep 2021 14:00:21 GMT</pubDate>
			<itunes:duration>44:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/613f5975e8d2fd00138097ea/media.mp3" length="107875604" type="audio/mpeg"/>
			<guid isPermaLink="false">613f5975e8d2fd00138097ea</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/can-chelsea-successfully-defend-the-champions-league-title</link>
			<acast:episodeId>613f5975e8d2fd00138097ea</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>can-chelsea-successfully-defend-the-champions-league-title</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdMwbfVg/Xau17uXB453vBIDKf9hSIg/TguTqIUk5iG6tkdcl46w6yIsChMr9VVr713m4l3Kp+iqDOajM2QxPVrVt7B/UziTePgYoRTKYooLpOHQjIsbIlJuCCSrfQjVbNtr8FINHfq6a1shRDlJpuSL392GmD5PgX8PmEcjadHQnp1uQgdVpg1wZm1w6Qhg6xR0qUlp9QR0bNRWWrFfzPj0oah6ODSUwdrLKOsL4DoG7A==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Jordan Jarrett Bryan assess the contenders in this season's Champions League.: They acknowledge the threat represented by Bayern Munich and PSG, but forecast an English winner.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Jordan Jarrett Bryan assess the contenders in this season's Champions League.: They acknowledge the threat represented by Bayern Munich and PSG, but forecast an English winner.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Cristiano Ronaldo turn Manchester United into Premier League champions?</title>
			<itunes:title>Will Cristiano Ronaldo turn Manchester United into Premier League champions?</itunes:title>
			<pubDate>Thu, 09 Sep 2021 14:47:00 GMT</pubDate>
			<itunes:duration>52:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/613a1e64f7b81700133f934b/media.mp3" length="126020324" type="audio/mpeg"/>
			<guid isPermaLink="false">613a1e64f7b81700133f934b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/will-cristiano-ronaldo-turn-manchester-united-into-premier-l</link>
			<acast:episodeId>613a1e64f7b81700133f934b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>will-cristiano-ronaldo-turn-manchester-united-into-premier-l</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz92+XtCZdB0mddaoXyQ31/OTdo1a7F9CzCF8ZQJSi9nwIbklwuaK7KVxXHQrK/X0+BaQPiKEja+vRe4f1YOZ6MGaZ9kB1nzRT63ejckXGXZ+V6GUNl43335ufHiNoeL+WDJF7watu0blkFX8m0dLFsPQxhW0YTUV60+//pYG2Qvg1eh1ZEi43P7B1isRhx8l218cHmo1/DaOVZcsP3HFM2jUTCN0ouR5obCBGXsJu4xx64vW13K0LdM9ByjXRbJM6BWEGc2tZQvT5GJBuuYSE+VfxeC3+oWp64Z+7bXWeL+fs=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Seb Stafford Bloor look beyond the pomp and ceremony of Ronaldo's return to Old Trafford, and ask whether he can give United the title they crave. They expect a messy compromise in the stand off about FIFA's intention to ban Brazilian players this weekend, but believe more conflict is inevitable. Big tests await Spurs, Leicester and Leeds.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Seb Stafford Bloor look beyond the pomp and ceremony of Ronaldo's return to Old Trafford, and ask whether he can give United the title they crave. They expect a messy compromise in the stand off about FIFA's intention to ban Brazilian players this weekend, but believe more conflict is inevitable. Big tests await Spurs, Leicester and Leeds.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are England potential World Cup winners?</title>
			<itunes:title>Are England potential World Cup winners?</itunes:title>
			<pubDate>Mon, 06 Sep 2021 12:52:01 GMT</pubDate>
			<itunes:duration>42:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/61360ef15fa0bb0013a40b2d/media.mp3" length="100989380" type="audio/mpeg"/>
			<guid isPermaLink="false">61360ef15fa0bb0013a40b2d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/are-england-potential-world-cup-winners</link>
			<acast:episodeId>61360ef15fa0bb0013a40b2d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>are-england-potential-world-cup-winners</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9D78FcPfCeRfGIih+dnU8pswVaqwUBW86UM9o7kBY3p5ndGRWo1dkeCKC+oShRZpixMQ4eKZVdo3rHFXAe1F3uVwQR1SLksqSPRxzGsO1h2BWp4rH+6V5qaiwiMbBqZL0lPR+I8WXt5nZBqdOfKK2iNEYtTCpPVVqQkZr3/FLuQKA/n6FSWQhRrP+ui+gRStJVwU3Dkqbkt56XNkWXOWMFD1ETLB9gCJ34BaoyS21OxWOt1Qt30PW4mAWpVyQuFUW3RvUren3uV7VG4gj/RcPP0DwIynTwAWi1tcbgm7bqZA=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Glenn Moore insist that a rapidly-maturing England team is among the favorites&nbsp;to win the World Cup in Qatar next year. They question Arsene Wenger's support of FIFA's plans to have finals every two years, and, after a chaotic weekend,&nbsp;understand the opposition of leading clubs to the release of players to South American nations. They also condemn the FA for charging Middlesbrough's Marc Bola for social media posts, made when he was 14.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Glenn Moore insist that a rapidly-maturing England team is among the favorites&nbsp;to win the World Cup in Qatar next year. They question Arsene Wenger's support of FIFA's plans to have finals every two years, and, after a chaotic weekend,&nbsp;understand the opposition of leading clubs to the release of players to South American nations. They also condemn the FA for charging Middlesbrough's Marc Bola for social media posts, made when he was 14.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who were the winners and losers in the transfer window?</title>
			<itunes:title>Who were the winners and losers in the transfer window?</itunes:title>
			<pubDate>Wed, 01 Sep 2021 14:56:37 GMT</pubDate>
			<itunes:duration>54:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/612f94a63702d40019b5a6d2/media.mp3" length="129491624" type="audio/mpeg"/>
			<guid isPermaLink="false">612f94a63702d40019b5a6d2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/who-were-the-winners-and-losers-in-the-transfer-window</link>
			<acast:episodeId>612f94a63702d40019b5a6d2</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>who-were-the-winners-and-losers-in-the-transfer-window</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9i+jargxr+Z+jVE9yJC778zhTQHU6gZEVV13nQX7pAdPiYNwI8gM9IWy1DrZaRFwjMFM6XagKNPJ1c//IN8QFoI2o3jvQWzV6ZG9DuzjYxsRJueqm3i04qyZGZ4O7STUwmV/vp/9OVBP5Wu4vm8webNklge72ag4zEIaXu/D7dDsxa0dhhcIIASaNBpERvKmE92E5+jUFAABmynxfTgh6n8w0wT6hud1iyNT0Ca7rZsMkiMeFtfguC2a+qQS2J3CWKZgNNeuwRrtAJQYJf8FWMQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke praise Chelsea, Leicester, Brighton and West Ham for their transfer activity. The signing of Cristiano Ronaldo leaves Ole Gunnar Solksjaer&nbsp;without excuses, and Liverpool can ill-afford to lose Sporting&nbsp;Director Michael Edwards. Newcastle will pay a heavy&nbsp;price for their stagnation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke praise Chelsea, Leicester, Brighton and West Ham for their transfer activity. The signing of Cristiano Ronaldo leaves Ole Gunnar Solksjaer&nbsp;without excuses, and Liverpool can ill-afford to lose Sporting&nbsp;Director Michael Edwards. Newcastle will pay a heavy&nbsp;price for their stagnation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Cristiano Ronaldo make a success of his return to the Premier League?</title>
			<itunes:title>Can Cristiano Ronaldo make a success of his return to the Premier League?</itunes:title>
			<pubDate>Fri, 27 Aug 2021 14:46:28 GMT</pubDate>
			<itunes:duration>50:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/lifesapitch/e/6128fac57dc9170013ee35b0/media.mp3" length="121510244" type="audio/mpeg"/>
			<guid isPermaLink="false">6128fac57dc9170013ee35b0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/can-cristiano-ronaldo-make-a-success-of-his-return-to-the-pr</link>
			<acast:episodeId>6128fac57dc9170013ee35b0</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>can-cristiano-ronaldo-make-a-success-of-his-return-to-the-pr</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9TUAqrbFViiu8EGCIO3eIHKZITIzDDwqTt2REsdtByLdggOeK+CuqKMfwntjBEyNanRl+Sf7vkF6xFy2B06xYm6t1SnUm6Dy0moN5b+kWTN7hKOeyMLjy3BiFB0T9YKwYbllYSo/3DfGldtqYPxwIql6BGP0hGnvvWPzHrNy2QtPcJtjkDRG7WDTZTVdQhfaMTtutfun3HxAy3p3tTfTPfQYuwpySZVLRugQxns9YYw54huGLBAiS9T0rv5dAqtm5pRvMSskBK+YVJV1efe3JFeflHWQQ9lY12pjyfnqCKl4=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Recorded before news of Manchester United's attempt to re-sign Cristiano Ronaldo emerged, Mike Calvin, Miguel Delaney and Art de Roche considered what he would bring to the Premier League : goals, stardust but perhaps not titles. They assessed the Champions League draw, made sense of Kylian Mbappe moving to Real Madrid, and called time on the League Cup<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Recorded before news of Manchester United's attempt to re-sign Cristiano Ronaldo emerged, Mike Calvin, Miguel Delaney and Art de Roche considered what he would bring to the Premier League : goals, stardust but perhaps not titles. They assessed the Champions League draw, made sense of Kylian Mbappe moving to Real Madrid, and called time on the League Cup<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Harry Kane be a Tottenham player when the transfer window closes?</title>
			<itunes:title>Will Harry Kane be a Tottenham player when the transfer window closes?</itunes:title>
			<pubDate>Mon, 23 Aug 2021 14:52:52 GMT</pubDate>
			<itunes:duration>51:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willharrykanebeatottenhamplayerwhenthetransferwindowcloses-/media.mp3" length="124283108" type="audio/mpeg"/>
			<guid isPermaLink="false">11561d7d-1ee2-4a56-b0a4-98254d356d10</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willharrykanebeatottenhamplayerwhenthetransferwindowcloses-</link>
			<acast:episodeId>11561d7d-1ee2-4a56-b0a4-98254d356d10</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willharrykanebeatottenhamplayerwhenthetransferwindowcloses-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRMm5luzXc/sd2lhH6U5m/xPU3BQoFIEXrOg6j9z5Lfr+UAIiws9kfUtfl1wW6RSpUHmiXSxMk5MgDrtJo60OECGskg6UcvB+Aaw0X1u9kgirEQ5NgJ9bQp1WXHJcUIx9nHmMCOLMVsZSa/9LHLLS0bgMO9rCS5d9PspPFFGRi6YyItdnheouYIDxHY9RJKWmKtYpg0irfKxe0eFeYqCXapuqM0t2/owQTY8kexJfCT7w8fp8NPlnysqZ+JVDzVDVRbhUwPl0mGWJIA8NbcO3XRSZ1JmmrhsG9bOf8zfvJmSQ]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, John Cross and Darren Lewis discuss Harry Kane's future, and whether player power is a myth or reality. They hail Romelu Lukaku as a transformative signing, recognise Harvey Elliott's potential&nbsp;for club and country, and ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Darren Lewis discuss Harry Kane's future, and whether player power is a myth or reality. They hail Romelu Lukaku as a transformative signing, recognise Harvey Elliott's potential&nbsp;for club and country, and call for football to respond urgently to the dementia crisis.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Darren Lewis discuss Harry Kane's future, and whether player power is a myth or reality. They hail Romelu Lukaku as a transformative signing, recognise Harvey Elliott's potential&nbsp;for club and country, and call for football to respond urgently to the dementia crisis.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Paul Pogba leave Manchester United as Premier League champions?</title>
			<itunes:title>Will Paul Pogba leave Manchester United as Premier League champions?</itunes:title>
			<pubDate>Mon, 16 Aug 2021 12:35:54 GMT</pubDate>
			<itunes:duration>50:11</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willpaulpogbaleavemanchesterunitedaspremierleaguechampions-/media.mp3" length="120374372" type="audio/mpeg"/>
			<guid isPermaLink="false">378db851-9024-496d-84d0-278c940216e8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willpaulpogbaleavemanchesterunitedaspremierleaguechampions-</link>
			<acast:episodeId>378db851-9024-496d-84d0-278c940216e8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willpaulpogbaleavemanchesterunitedaspremierleaguechampions-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBocvwI8Pjv88lFmSieaQ6mPHNaf4nAK8eL0bl9dCTciKeixcZ5OQNbPhj0Im26Omb3zK+HsjpyQ+pps/FJh56quzHTQM1y8ym0S62Z2YrpTWyEk/8OG1Yq2n6USs0Sn0rNITR3lfWn1tlFnUYjp+KUfrYMVDCfAiR8vPInK+fXZQc5ps85B8q5kc4dOJQdb3znCvTPOM6HMdkCknCANaeaMqGnSXmYgErRi8/gQTrnJQpqlQR5d3WJeUNtsVe+8uh9wnVASCP4ofYXGoamctHeObRTN2Wr793iqoYpfPiif]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Anne Marie Batson and Glenn Moore consider Paul Pogba's impact in what seems likely to be his final season at Manchester United. They praise Academy products like Japhet Tanganga and Trevoh Chalobah, dwell on great starts for Brentfor...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Glenn Moore consider Paul Pogba's impact in what seems likely to be his final season at Manchester United. They praise Academy products like Japhet Tanganga and Trevoh Chalobah, dwell on great starts for Brentford and Watford, but fear for managers like Mikel Arteta and Steve Bruce.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Glenn Moore consider Paul Pogba's impact in what seems likely to be his final season at Manchester United. They praise Academy products like Japhet Tanganga and Trevoh Chalobah, dwell on great starts for Brentford and Watford, but fear for managers like Mikel Arteta and Steve Bruce.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Manchester United get their season off to a flying start?</title>
			<itunes:title>Can Manchester United get their season off to a flying start?</itunes:title>
			<pubDate>Sat, 14 Aug 2021 05:00:19 GMT</pubDate>
			<itunes:duration>8:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canmanchesterunitedgettheirseasonofftoaflyingstart-/media.mp3" length="19397648" type="audio/mpeg"/>
			<guid isPermaLink="false">04a2170b-89d3-4f5d-9b78-a48b1c7f8069</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canmanchesterunitedgettheirseasonofftoaflyingstart-</link>
			<acast:episodeId>04a2170b-89d3-4f5d-9b78-a48b1c7f8069</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canmanchesterunitedgettheirseasonofftoaflyingstart-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Ehjqrh7h2EagDI4HM9NkTilF+IRhGi4mmdD7MBfc81xJgTvoIwWcB3LYR8RqIeatfOjMjZUBtXanKsvvchj5T6uk4KTbTRO2IlF9JkRPXou/5IlH+8uR9VjhvMsR4s7RWMhhOY1rouDfvhU8tilyocG+dM1Kc+ScwkpUCQD7jQJkM4fb64cCp1zvuibuMytW]]></acast:settings>
			<itunes:subtitle>The Premier League season kicks off on BT Sport on Saturday lunchtime, when Manchester United host Leeds United. Mike Calvin, Miguel Delaney and Seb Stafford Bloor look forward to the latest instalment of a great tribal rivalry.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[The Premier League season kicks off on BT Sport on Saturday lunchtime, when Manchester United host Leeds United. Mike Calvin, Miguel Delaney and Seb Stafford Bloor look forward to the latest instalment of a great tribal rivalry.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[The Premier League season kicks off on BT Sport on Saturday lunchtime, when Manchester United host Leeds United. Mike Calvin, Miguel Delaney and Seb Stafford Bloor look forward to the latest instalment of a great tribal rivalry.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Chelsea complete their domination of Manchester City by winning the Premier League?</title>
			<itunes:title>Will Chelsea complete their domination of Manchester City by winning the Premier League?</itunes:title>
			<pubDate>Thu, 12 Aug 2021 14:16:27 GMT</pubDate>
			<itunes:duration>53:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willchelseacompletetheirdominationofmanchestercitybywinningthepremierleague-/media.mp3" length="127218836" type="audio/mpeg"/>
			<guid isPermaLink="false">01973159-0151-4043-8a01-27bc9f8830e5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willchelseacompletetheirdominationofmanchestercitybywinningthepremierleague-</link>
			<acast:episodeId>01973159-0151-4043-8a01-27bc9f8830e5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willchelseacompletetheirdominationofmanchestercitybywinningthepremierleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRI4l7qmvPMIPPnL92JdCuobNT6MGg2gR+eB8rNM2hvSBN8VdePojW9QuNGemk5i2p6r80+a9sTxrlIAeoUQeno1466DNk1DBPCjEkM4CYZGHJTfNhDe0ewSsApDw8I2LBMxwzU3KL6CT35zN36Yjee6B9+bWjDl6sSSurwQXz49KNHyfXSz5PiGTk2lAZjOOFQn+OCZCDbHtjux++9joIx0TiPkCQLBlo5eNqWQ3DiLnu/tLR1xWRU9b6JHE2RoQ4O2M2xv4RvU84g0o685WqKFj3QwL1Pf40u2nhOlbr7kA]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Miguel Delaney and Seb Stafford Bloor all expect Chelsea to win the Premier League title, at the expense of Manchester City. They unveil their predictions for the top six, and bottom three.Each believes at least one of the promoted teams w...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Seb Stafford Bloor all expect Chelsea to win the Premier League title, at the expense of Manchester City. They unveil their predictions for the top six, and bottom three.Each believes at least one of the promoted teams will survive.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Seb Stafford Bloor all expect Chelsea to win the Premier League title, at the expense of Manchester City. They unveil their predictions for the top six, and bottom three.Each believes at least one of the promoted teams will survive.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Could Manchester City switch their interest from Harry Kane to Erling Haaland?</title>
			<itunes:title>Could Manchester City switch their interest from Harry Kane to Erling Haaland?</itunes:title>
			<pubDate>Mon, 09 Aug 2021 13:35:55 GMT</pubDate>
			<itunes:duration>50:29</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/couldmanchestercityswitchtheirinterestfromharrykanetoerlinghaaland-/media.mp3" length="121064456" type="audio/mpeg"/>
			<guid isPermaLink="false">4b9d9838-00cb-4716-8aab-aa829c0cb1aa</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/couldmanchestercityswitchtheirinterestfromharrykanetoerlinghaaland-</link>
			<acast:episodeId>4b9d9838-00cb-4716-8aab-aa829c0cb1aa</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>couldmanchestercityswitchtheirinterestfromharrykanetoerlinghaaland-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRNbJUbO7xV93mnBCLtV3oaXi7aPlUbh0/mqlTFBNDIa8IbtR1oEJFt7S+jYVGaGxk16q6E6NUfCcF5HpMdsgznWBMcjNYPjdrDRhQbM30HbqwB3aRpY7iRqf6lrloq8XTcWQ5y9SwFbgtLTUHzo6A1upM/777rygctvgzH1ag3E/laENoZwovomePAt/UAAlzfAgdhV3IIRiboILSXPsD4se0CpWLv1tr4UoiKfxJjFFDwmr/Bv2knPIM7g3ugtsH2cz8oqfljBbQ8zaNBLibja5Ej3smstJ4i6sOd8cneRL]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Dominic Fifield and Adrian Clarke expect the unexpected in the aftermath of Lionel Messi's departure from Barcelona. They feel Jack Grealish will take time to fit in at City, believe Romelu Lukaku will add momentum to Chelsea's p...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Adrian Clarke expect the unexpected in the aftermath of Lionel Messi's departure from Barcelona. They feel Jack Grealish will take time to fit in at City, believe Romelu Lukaku will add momentum to Chelsea's push for the Premier League title, and insist United have a fundamental decision to make on Paul Pogba.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Adrian Clarke expect the unexpected in the aftermath of Lionel Messi's departure from Barcelona. They feel Jack Grealish will take time to fit in at City, believe Romelu Lukaku will add momentum to Chelsea's push for the Premier League title, and insist United have a fundamental decision to make on Paul Pogba.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Can England recover and respond at next year's World Cup finals?]]></title>
			<itunes:title><![CDATA[Can England recover and respond at next year's World Cup finals?]]></itunes:title>
			<pubDate>Mon, 12 Jul 2021 11:35:23 GMT</pubDate>
			<itunes:duration>38:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canenglandrecoverandrespondatnextyearsworldcupfinals-/media.mp3" length="92779364" type="audio/mpeg"/>
			<guid isPermaLink="false">7b03bc5f-bdd7-4777-962d-f3a9665c7069</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canenglandrecoverandrespondatnextyearsworldcupfinals-</link>
			<acast:episodeId>7b03bc5f-bdd7-4777-962d-f3a9665c7069</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canenglandrecoverandrespondatnextyearsworldcupfinals-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9prZ/lRGoueeWWHI8JeN+RLvn0YvA61ZtM+GcgjtyKEhJdWevZfApx9v+bhVXZvXXv1BN9NOgaERENJVZ6RFaILPnKfhQKARopyEgiS9+dpls6OsM1iyiafs6aypWFTO61IMQMReYY2Vp2HQOO7uJz5m7y3lHNQuqkt/kZugzHYw77Gjgre5uqCYkeFjsUPy+cijoHroJYTa803PUA03sMBykzjEL2wOwgRumRChqvdGibeOx8cNxs4yNKy/0HAQM]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Glenn Moore and Ade Oladipo believe Gareth Southgate's squad has the youth and depth of talent to be one of the favourites at Qatar 2022, alongside Italy, France and Argentina. They also dwell on disgraceful scenes at Wembley, and con...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Glenn Moore and Ade Oladipo believe Gareth Southgate's squad has the youth and depth of talent to be one of the favourites at Qatar 2022, alongside Italy, France and Argentina. They also dwell on disgraceful scenes at Wembley, and condemn the racial abuse endured by Marcus Rashford, Bukayo Saka and Jadon Sancho.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Glenn Moore and Ade Oladipo believe Gareth Southgate's squad has the youth and depth of talent to be one of the favourites at Qatar 2022, alongside Italy, France and Argentina. They also dwell on disgraceful scenes at Wembley, and condemn the racial abuse endured by Marcus Rashford, Bukayo Saka and Jadon Sancho.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>England will become European Champions on Sunday</title>
			<itunes:title>England will become European Champions on Sunday</itunes:title>
			<pubDate>Thu, 08 Jul 2021 12:07:39 GMT</pubDate>
			<itunes:duration>50:39</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/englandwillbecomeeuropeanchampionsonsunday/media.mp3" length="121457000" type="audio/mpeg"/>
			<guid isPermaLink="false">a85a9dbe-134f-4c71-9cab-a1f843bcc859</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/englandwillbecomeeuropeanchampionsonsunday</link>
			<acast:episodeId>a85a9dbe-134f-4c71-9cab-a1f843bcc859</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>englandwillbecomeeuropeanchampionsonsunday</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9pu6AzocA3DKSwoGP5wQkJuBebnDPwaMJJhuag1pRDlUP87WPoGJbNhkTDJq+xSGCSjYjwpqvGezVCU3tqjecaDXqpV0NQ+/iD/vEYZGwYU1UTnyCXHZI5j00m688RICs9naY5IBRBTZ9w74ZEBdCog3xpPp9L6Go/xo5MsPfWbDqeFU+/bE7Ih6rQbg32I2TdLOYEeaf8ciKCj7qhuJYpWcseFIqtkbcUbHyIAW6JWKsdP5Lne8dHPLVy74jy2uF]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Dominic Fifield believe England are destined to win their first major tournament since 1966. But Sunday's final is not about ending 55 years of hurt. It is set to be a celebration of the now, and the new. Gare...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Dominic Fifield believe England are destined to win their first major tournament since 1966. But Sunday's final is not about ending 55 years of hurt. It is set to be a celebration of the now, and the new. Gareth Southgate's squad will seize their chance to set the nation's mood.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Dominic Fifield believe England are destined to win their first major tournament since 1966. But Sunday's final is not about ending 55 years of hurt. It is set to be a celebration of the now, and the new. Gareth Southgate's squad will seize their chance to set the nation's mood.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are England favourites to become European Champions?</title>
			<itunes:title>Are England favourites to become European Champions?</itunes:title>
			<pubDate>Mon, 05 Jul 2021 13:49:42 GMT</pubDate>
			<itunes:duration>48:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/areenglandfavouritestobecomeeuropeanchampions-/media.mp3" length="116248484" type="audio/mpeg"/>
			<guid isPermaLink="false">c5488c6d-3c38-47f1-bf8c-2c0141933b79</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/areenglandfavouritestobecomeeuropeanchampions-</link>
			<acast:episodeId>c5488c6d-3c38-47f1-bf8c-2c0141933b79</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>areenglandfavouritestobecomeeuropeanchampions-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9gnuvbZrpC0BD9oaRsK1AtHmd+OMx73Gxusx17JaXPnvdMKclOAyYrjmzX4wS+ScHPZYVGEbsoBA58eCO/cAjax6gTpzmy5Y+v18UaZL+WZJFEXcWDZ6IWUifP6zL0zxW5fpyZV2QY5aMVbU+glWBg32pR7au6GiYj15V/dlpElqatTrFKAUaIa3wYJQBvfk1TncfzQRTle2v71F/cH2PD58bT2LM0QVCwN1FB61p8z4Ixhkwz1vZ2o16gJjUgqrj]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Miguel Delaney and David Preece take England&nbsp;to reach the final at Denmark's expense on Wednesday evening. Gareth Southgate's team feels different from previous incarnations, as do Italy, their probable opponents in the ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and David Preece take England&nbsp;to reach the final at Denmark's expense on Wednesday evening. Gareth Southgate's team feels different from previous incarnations, as do Italy, their probable opponents in the European Championship final.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and David Preece take England&nbsp;to reach the final at Denmark's expense on Wednesday evening. Gareth Southgate's team feels different from previous incarnations, as do Italy, their probable opponents in the European Championship final.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can England seize their best chance to win a major tournament since 1966?</title>
			<itunes:title>Can England seize their best chance to win a major tournament since 1966?</itunes:title>
			<pubDate>Thu, 01 Jul 2021 14:31:52 GMT</pubDate>
			<itunes:duration>48:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canenglandseizetheirbestchancetowinamajortournamentsince1966-/media.mp3" length="115358996" type="audio/mpeg"/>
			<guid isPermaLink="false">0cfc5876-9beb-4987-bbdb-80bc1bd4338c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canenglandseizetheirbestchancetowinamajortournamentsince1966-</link>
			<acast:episodeId>0cfc5876-9beb-4987-bbdb-80bc1bd4338c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canenglandseizetheirbestchancetowinamajortournamentsince1966-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRELORh/f3BzSORv04Of/DREsT0CcvBDU+bvVSVd15vq+YUTceEQ/uYYSWK3wFtBMZkn65EClWFroiS8Dh4XsKTvk6TSOOwYyyUms8YJxnkB8UhBwvvvw/NL8S8f9XrYyL4mDi9u5aFDqIxBgJVTixLI3dQymQqQxEZZRH/WRT6y8cIX3NnNEGN6Ph7gp0z+5Gn2VnfMu/zoC1DAM3dzIrfLgOVKy5XA+E3bIF3A2tDvBvVEuEYPv5yItZm54I7X8PKfIJGfgdtf4tjyh4xilnH5pP39oAMu992/RFUTtXLtR]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Paul Hayward and Glenn Moore foresee England at least reaching the final of the European Championship. Gareth Southgate is a shrewd, statesmanlike manager. His squad is deep, prepared in the modern manner, and is the most likeable in a gen...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Glenn Moore foresee England at least reaching the final of the European Championship. Gareth Southgate is a shrewd, statesmanlike manager. His squad is deep, prepared in the modern manner, and is the most likeable in a generation. Dare to dream.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Glenn Moore foresee England at least reaching the final of the European Championship. Gareth Southgate is a shrewd, statesmanlike manager. His squad is deep, prepared in the modern manner, and is the most likeable in a generation. Dare to dream.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can England withstand Germany, and the weight of football history?</title>
			<itunes:title>Can England withstand Germany, and the weight of football history?</itunes:title>
			<pubDate>Thu, 24 Jun 2021 15:08:12 GMT</pubDate>
			<itunes:duration>56:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canenglandwithstandgermany-andtheweightoffootballhistory-/media.mp3" length="135368300" type="audio/mpeg"/>
			<guid isPermaLink="false">014647b4-7a57-4cba-9e8b-05121241c51e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canenglandwithstandgermany-andtheweightoffootballhistory-</link>
			<acast:episodeId>014647b4-7a57-4cba-9e8b-05121241c51e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canenglandwithstandgermany-andtheweightoffootballhistory-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRDyrowmNTLVH6j4wdn4gKukzyU5WWk7LuZGbbDp3u5YeosuzObv60cPWyamqTju8VFojx3KIcBQ798BZ8mm4TK1xHaENCSs4xTFyZH3hXryPzBNyIaA7Q47SWM80cGwf+CWiAuCiFYW1J/j81dFdp74zCzyaCNYg45bMVKmO1yB/WL7WPJGFpUAxt4Ce4kVzXXkWnDUJ3u7Si4tuEw4j+TN6bG5dPFrJDHlhR9ldWclTMQRX68JjC2cD5mEkasneVc2AYdhzJQtFNuJ+SJzYzLKa6812fgqQdwYjDjAqlqJv]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jonathan Northcroft and Art de Roche predict a narrow England win at Wembley next Tuesday, if Gareth Southgate trusts in Bukayo Saka, and resists the temptation to be too conservative. Wales' team spirit will be tested to the limit ag...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Art de Roche predict a narrow England win at Wembley next Tuesday, if Gareth Southgate trusts in Bukayo Saka, and resists the temptation to be too conservative. Wales' team spirit will be tested to the limit against Denmark, and Romelu Lukaku will confirm his importance to Belgium in a potentially classic last 16 match up against Portugal.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Art de Roche predict a narrow England win at Wembley next Tuesday, if Gareth Southgate trusts in Bukayo Saka, and resists the temptation to be too conservative. Wales' team spirit will be tested to the limit against Denmark, and Romelu Lukaku will confirm his importance to Belgium in a potentially classic last 16 match up against Portugal.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>England expects, but is the rivalry with Scotland really relevant?</title>
			<itunes:title>England expects, but is the rivalry with Scotland really relevant?</itunes:title>
			<pubDate>Thu, 17 Jun 2021 14:12:49 GMT</pubDate>
			<itunes:duration>59:29</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/englandexpects-butistherivalrywithscotlandreallyrelevant-/media.mp3" length="142643936" type="audio/mpeg"/>
			<guid isPermaLink="false">11327f98-5f7f-4d01-befe-9135574574a6</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/englandexpects-butistherivalrywithscotlandreallyrelevant-</link>
			<acast:episodeId>11327f98-5f7f-4d01-befe-9135574574a6</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>englandexpects-butistherivalrywithscotlandreallyrelevant-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRL8GMcjxbxv8aOtRYO5xxM4Ze9pB0unni8Qo4PtzeRmd7ppMfn8WR5u32KS15ojzromLQjm1liPhTpbROkFxT6fgmVf79SpForBZ9nPgbEzq2BqgFkII8/DnAN5Uc/19Q9FhFV5FzY57PswmryzHDd7wTVL3mFw+VZkyPUqbUdXoHNIDdMny7Q8CPMjBrs4SXGfTtr8cCik4CnisnkOcRYDf0SAVhIg79KgjNqtVhnCOzFPZrxC57zrlC+f3kAmOyDv6GK2CI2W3Ki/r5GD6hBQTfGe4DWuU4aboOoAfCAxS]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jordan Jarrett Bryan and David Preece expect a comfortable England win at Wembley on Friday night. They praise the unlikely heroes of Italy's resurgence, hail Gareth Bale as the manifestation of Welsh spirit, and suggest Cristiano Ron...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and David Preece expect a comfortable England win at Wembley on Friday night. They praise the unlikely heroes of Italy's resurgence, hail Gareth Bale as the manifestation of Welsh spirit, and suggest Cristiano Ronaldo will win the Euros for Portugal, if he operates as an out and out striker.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and David Preece expect a comfortable England win at Wembley on Friday night. They praise the unlikely heroes of Italy's resurgence, hail Gareth Bale as the manifestation of Welsh spirit, and suggest Cristiano Ronaldo will win the Euros for Portugal, if he operates as an out and out striker.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can England win the Euros?</title>
			<itunes:title>Can England win the Euros?</itunes:title>
			<pubDate>Thu, 10 Jun 2021 14:41:26 GMT</pubDate>
			<itunes:duration>52:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canenglandwintheeuros-/media.mp3" length="126829424" type="audio/mpeg"/>
			<guid isPermaLink="false">c077c2ed-cc31-4c63-89b8-48ccb58bd375</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canenglandwintheeuros-</link>
			<acast:episodeId>c077c2ed-cc31-4c63-89b8-48ccb58bd375</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canenglandwintheeuros-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRH0nkzqv9Bl+nK9hyfo+E/p7kUKhW70ul0PA1aBXklJ7m6dIqNwdrw+n48yRrwqJjFc+XWwyLyRqZnknKBoi3eME7D2eTtRk42VO+lp3nyUZ6S3I4NVS/er8RzBofmkxMk/sbkQLW2DaCFlvErVXfsplCZhkAeiLd1VUrGOseyP/8sOcrtIMYSV7s1moo8N/RaM4UevYzWRI8v9IfK4LrkO8t9x5VAcXc4v8smJ33e8cMPoyAiwCaaTYgGkCB+DNOpJJUtVjJyX2I4DVDSNNL3wGChm/Sfph9C2+o5fzG/dv]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Ade Oladipo and Adrian Clarke assess England's chances on the eve of the European Championships. They make their predictions, point out the pitfalls and the potential surprises, and end with a powerful look at the debate triggered by ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Ade Oladipo and Adrian Clarke assess England's chances on the eve of the European Championships. They make their predictions, point out the pitfalls and the potential surprises, and end with a powerful look at the debate triggered by England players taking&nbsp;the knee.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Ade Oladipo and Adrian Clarke assess England's chances on the eve of the European Championships. They make their predictions, point out the pitfalls and the potential surprises, and end with a powerful look at the debate triggered by England players taking&nbsp;the knee.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Manchester City throw more money at their Champions League problem?</title>
			<itunes:title>Will Manchester City throw more money at their Champions League problem?</itunes:title>
			<pubDate>Tue, 01 Jun 2021 14:08:16 GMT</pubDate>
			<itunes:duration>43:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willmanchestercitythrowmoremoneyattheirchampionsleagueproblem-/media.mp3" length="103603556" type="audio/mpeg"/>
			<guid isPermaLink="false">5818021b-104a-429f-995e-62aabffb0bc7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willmanchestercitythrowmoremoneyattheirchampionsleagueproblem-</link>
			<acast:episodeId>5818021b-104a-429f-995e-62aabffb0bc7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willmanchestercitythrowmoremoneyattheirchampionsleagueproblem-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREGW08+djf5CS6GDiPR9wsajkbAqAQ+KQ6/I13wWe6drkIsoxuzbRRJz3vP7KJGrHYmv21l2/mPPpoYKB/8VuLSidyT5E2neLwyMp85XODTXVL9y+F5dinzqkx1ZRp7fOrT5JA+BPnWCnbyLtNomGTYJwNDVHr9f+PD1uVVId/SmXoA3tgDyU/conUMKrkJDYeZ9SAe6OKxQPUaZIqB84pZ17zgvZ9sqIrAabpYVb3oixIwyFNlxiMpqLoEJkgR24CEDfGG/hfJpqhOqTsOMPnWB8tNYpQB38f2X8lVKSk8t]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Glenn Moore and Seb Stafford Bloor expect&nbsp;English clubs to spend big this summer, and seal a spell of European domination. They discuss promoted clubs, their team of last season, and, as Gareth Southgate finalises his England squa...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Glenn Moore and Seb Stafford Bloor expect&nbsp;English clubs to spend big this summer, and seal a spell of European domination. They discuss promoted clubs, their team of last season, and, as Gareth Southgate finalises his England squad,&nbsp;name their winners of the European Championships.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Glenn Moore and Seb Stafford Bloor expect&nbsp;English clubs to spend big this summer, and seal a spell of European domination. They discuss promoted clubs, their team of last season, and, as Gareth Southgate finalises his England squad,&nbsp;name their winners of the European Championships.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Chelsea deny Pep Guardiola his signature achievement?</title>
			<itunes:title>Can Chelsea deny Pep Guardiola his signature achievement?</itunes:title>
			<pubDate>Thu, 27 May 2021 14:52:27 GMT</pubDate>
			<itunes:duration>53:01</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canchelseadenypepguardiolahissignatureachievement-/media.mp3" length="127147844" type="audio/mpeg"/>
			<guid isPermaLink="false">5ca3d611-6037-4b75-9fcd-f233de4cafbf</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canchelseadenypepguardiolahissignatureachievement-</link>
			<acast:episodeId>5ca3d611-6037-4b75-9fcd-f233de4cafbf</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canchelseadenypepguardiolahissignatureachievement-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREnS6dOhkPQUhGo034iJLy4WUYgsYQMsYcgcJXCpaZjpw30/cKho8o0Ql2jYLpVqlP4RNBiIUqRHgOFCLqEuI4W4bKbOAHidxBvrkr9aDt+Td5KuBklZo1948UrVm8m7/HhdoJIj7YeiOuruhBsdltMabJubh1KzllqmA4Ym7P3H7S7GMP/HZCUC/H6T96TGbcQ5f4KilLKzP+xS4op5eLiLrxDTk1WwwmKkkg9Ddi+fs6vpAWQKzfiHvzRTeWXbhER/er5uvjiwTFWq6bOIez1YJu8drVFD9fT0CIY3rdYr]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Miguel Delaney and Daniel Storey assess the Champions League final, and the potential of Chelsea's counter-attacking style against favourites Manchester City. They consider the implications of Manchester United's failure to win t...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Daniel Storey assess the Champions League final, and the potential of Chelsea's counter-attacking style against favourites Manchester City. They consider the implications of Manchester United's failure to win the Europa League, and raise questions about the management of Ole Gunnar Solksjaer.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Daniel Storey assess the Champions League final, and the potential of Chelsea's counter-attacking style against favourites Manchester City. They consider the implications of Manchester United's failure to win the Europa League, and raise questions about the management of Ole Gunnar Solksjaer.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Should Manchester United be judged on winning trophies?</title>
			<itunes:title>Should Manchester United be judged on winning trophies?</itunes:title>
			<pubDate>Mon, 24 May 2021 13:57:36 GMT</pubDate>
			<itunes:duration>56:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/shouldmanchesterunitedbejudgedonwinningtrophies-/media.mp3" length="136534448" type="audio/mpeg"/>
			<guid isPermaLink="false">22ed1024-fb19-4dae-8819-047b6f582219</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/shouldmanchesterunitedbejudgedonwinningtrophies-</link>
			<acast:episodeId>22ed1024-fb19-4dae-8819-047b6f582219</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>shouldmanchesterunitedbejudgedonwinningtrophies-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9OF908S+jLzvFHo2UwcA6YfBBUH6EaJewAkW82WzwbtJmGlEbuMy7kj6GSJIMrOwMP9l1HRQvDSftH99c/mDYfJWsG4tQ79J4JmM1iOpQlueSBC6MQ5yYy5tJmANiLk2kVFyLVRyJ/y0vU/obBi6Iu+UEnYG/10oUOTah5Vw6bOVXFeac8vYFll+qiIUnNUoDvipQ+QRkIyPI1UFlnT6AWoBHzMXuA7bYn0+cMOdEaHF9qLo/BY096QNXlS6K8k/6]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, John Cross and David Preece look forward to Wednesday's Europa League final, and the respective merits of rival managers, Ole Gunnar Solksjaer and Unair Emery. They name their England squad for the European Championships, which includ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and David Preece look forward to Wednesday's Europa League final, and the respective merits of rival managers, Ole Gunnar Solksjaer and Unair Emery. They name their England squad for the European Championships, which includes a surprise goalkeeping choice and an area of inevitable controversy. Finally, each panellist names his most memorable moment of a unique sqason.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and David Preece look forward to Wednesday's Europa League final, and the respective merits of rival managers, Ole Gunnar Solksjaer and Unair Emery. They name their England squad for the European Championships, which includes a surprise goalkeeping choice and an area of inevitable controversy. Finally, each panellist names his most memorable moment of a unique sqason.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Liverpool salvage their season?</title>
			<itunes:title>Can Liverpool salvage their season?</itunes:title>
			<pubDate>Thu, 20 May 2021 15:13:19 GMT</pubDate>
			<itunes:duration>51:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canliverpoolsalvagetheirseason-/media.mp3" length="123619124" type="audio/mpeg"/>
			<guid isPermaLink="false">688f7844-b891-4336-9df4-f1638c465da7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canliverpoolsalvagetheirseason-</link>
			<acast:episodeId>688f7844-b891-4336-9df4-f1638c465da7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canliverpoolsalvagetheirseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9lDzYclpbmdS21MBE74bwfUBy6xpGTVG8R7on8EulOGg00jGCoEUtGSyacnsS4q/Xp2WTLE+nQlQkJb9EwDXUObaryBuAV0ZCe9KziSA7pV8ZCtwOtknTa+Nzpy76F9TbRMfzpH6kxkEM5UzIxGaO4Asn+UbeFseoDcitISGCamR8/f61ZUlkIbm+NnIb7MAZ4rpHOyAUNksvggrjk5pSfA+UtNaiWX6EXQjHMd2Om/o=]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jordan Jarrett Bryan and Richard Amofa look forward to the final day of the Premier League season. They see Liverpool and Chelsea making the top four, but argue that Leicester represent a long term threat to the so-called big clubs. Harry ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Richard Amofa look forward to the final day of the Premier League season. They see Liverpool and Chelsea making the top four, but argue that Leicester represent a long term threat to the so-called big clubs. Harry Kane deserves his transfer from Spurs, who have many problems to solve.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Richard Amofa look forward to the final day of the Premier League season. They see Liverpool and Chelsea making the top four, but argue that Leicester represent a long term threat to the so-called big clubs. Harry Kane deserves his transfer from Spurs, who have many problems to solve.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Football. What would we do without it?</title>
			<itunes:title>Football. What would we do without it?</itunes:title>
			<pubDate>Mon, 17 May 2021 15:21:08 GMT</pubDate>
			<itunes:duration>57:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/football.whatwouldwedowithoutit-/media.mp3" length="137253764" type="audio/mpeg"/>
			<guid isPermaLink="false">1d06e560-d4e3-46f6-a071-e2445bd313d3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/football.whatwouldwedowithoutit-</link>
			<acast:episodeId>1d06e560-d4e3-46f6-a071-e2445bd313d3</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>football.whatwouldwedowithoutit-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9KnLsCX+/ryA6UcE5JkFyp8nnTS9Zx01G+Wun7DOE4hByIKSWyz5JXp2Up+htq/bibYK9TJZybxXeUT32PvO2w2vVe29C0LeZegLglvIrx8A3h2syjxhsTvHCjwHMYtGJGCXmaVdeJWzvGby/QtyIe5K81qPFq1/n6gP5+ExchfaTTQlSsfJxtMJ5R+wjf4ZxCMoIJYf1skWo+0rpennqbadIxcZiSpolmGGBHwE82NLpxf8odWffdJ89Np+GD1r2]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Paul Hayward and Art de Roche reflect on a weekend for the ages, Leicester's FA Cup win reminded us of the importance of fans, and the shallowness of the so-called Super League. Allison Becker's response to his headed goal for Li...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Art de Roche reflect on a weekend for the ages, Leicester's FA Cup win reminded us of the importance of fans, and the shallowness of the so-called Super League. Allison Becker's response to his headed goal for Liverpool emphasised football's humanity, and Chelsea Women discovered the harshest lessons are delivered on the biggest stages.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Art de Roche reflect on a weekend for the ages, Leicester's FA Cup win reminded us of the importance of fans, and the shallowness of the so-called Super League. Allison Becker's response to his headed goal for Liverpool emphasised football's humanity, and Chelsea Women discovered the harshest lessons are delivered on the biggest stages.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Leicester City find their Holy Grail at Wembley?</title>
			<itunes:title>Will Leicester City find their Holy Grail at Wembley?</itunes:title>
			<pubDate>Thu, 13 May 2021 05:00:00 GMT</pubDate>
			<itunes:duration>32:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willleicestercityfindtheirholygrailatwembley-/media.mp3" length="77952476" type="audio/mpeg"/>
			<guid isPermaLink="false">f876e3e0-43c2-4f68-bfa4-d637f9c19cb8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willleicestercityfindtheirholygrailatwembley-</link>
			<acast:episodeId>f876e3e0-43c2-4f68-bfa4-d637f9c19cb8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willleicestercityfindtheirholygrailatwembley-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRJfAqnG5HQkuKW6oaE2BpGm9Mmu4z4K+ajxl6mdqGwf7qh5hmRjTy4Bn/oKihg4vmKvfPHsYOwv/F6F/MdYXxUMQbxvrLimvshoRBjHA0uEBL/KHbjW9ZS6SZYruFiTHVc+m3vum2gtSRYJZMtbI3LYbgzGlfgffBNvGPhvIVksoLhs5DHDU0lbjzGXT1XSRFzqPN77riJNgsJOk6OhJIsyTEBp0mufPMPnpJKFtK19MZP+E+14jlVdUmaLPEkQ+jiMRiJd5/nCdtljXCdhTFzzlQRQNdzq7iIKY+Mg6fDg+]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and Seb Stafford Bloor reflect on the development of Brendan Rodgers, and the significance of the FA Cup to Leicester City, and their fans. They also dwell on the possibility of a distinctive double for Chelsea being co...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Seb Stafford Bloor reflect on the development of Brendan Rodgers, and the significance of the FA Cup to Leicester City, and their fans. They also dwell on the possibility of a distinctive double for Chelsea being completed in the women's Champions League final against Barcelona on Sunday.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Seb Stafford Bloor reflect on the development of Brendan Rodgers, and the significance of the FA Cup to Leicester City, and their fans. They also dwell on the possibility of a distinctive double for Chelsea being completed in the women's Champions League final against Barcelona on Sunday.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Time to give Chelsea's women's team the credit they deserve?]]></title>
			<itunes:title><![CDATA[Time to give Chelsea's women's team the credit they deserve?]]></itunes:title>
			<pubDate>Mon, 10 May 2021 15:41:41 GMT</pubDate>
			<itunes:duration>33:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/timetogivechelseaswomensteamthecredittheydeserve-/media.mp3" length="79494464" type="audio/mpeg"/>
			<guid isPermaLink="false">a85930b6-d986-41f8-9756-65d676a8af55</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/timetogivechelseaswomensteamthecredittheydeserve-</link>
			<acast:episodeId>a85930b6-d986-41f8-9756-65d676a8af55</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>timetogivechelseaswomensteamthecredittheydeserve-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFJ1rkVUZZf0WoF9zj6A81QA2jpm8BS3M4vLYqgMXKLahezPCTZ+I5yUEDpxXWaSbbYsizMEiF9jF7ckFOcsLFpk4gsDf8UT3mzek0Nl4CoBUn7Gn6hOQrX3k2btimZUFcCJhRSRCTQ4Wxz4LG7xlmmwBpHYNLICbZJYffPWXCtNczgv1dePvuVT4HL6f/GzChBQYaRPCYcU/HXOV9UrqvjaKYvyQ8PS1+PoczK++kzu9FvEvVmFQX2ecvqQHPHznLLhXdk5MJtC93CJKjtnvvGgydypIxozoxE0PM5dcjGX]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jonathan Northcroft and Seb Stafford Bloor reflect on Chelsea's third WSL title in four years, and hail Emma Hayes as one of the most influential coaches in English football. The rivalry with Manchester City, in both the men's an...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Seb Stafford Bloor reflect on Chelsea's third WSL title in four years, and hail Emma Hayes as one of the most influential coaches in English football. The rivalry with Manchester City, in both the men's and women's game, seems set to endure<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Seb Stafford Bloor reflect on Chelsea's third WSL title in four years, and hail Emma Hayes as one of the most influential coaches in English football. The rivalry with Manchester City, in both the men's and women's game, seems set to endure<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>...Are Chelsea and Manchester City set to serve up a classic Champions League final?</title>
			<itunes:title>...Are Chelsea and Manchester City set to serve up a classic Champions League final?</itunes:title>
			<pubDate>Thu, 06 May 2021 14:02:54 GMT</pubDate>
			<itunes:duration>50:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/...arechelseaandmanchestercitysettoserveupaclassicchampionsleaguefinal-/media.mp3" length="120019412" type="audio/mpeg"/>
			<guid isPermaLink="false">1675c102-0347-4e72-9eb3-28e3d5b06799</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/...arechelseaandmanchestercitysettoserveupaclassicchampionsleaguefinal-</link>
			<acast:episodeId>1675c102-0347-4e72-9eb3-28e3d5b06799</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>...arechelseaandmanchestercitysettoserveupaclassicchampionsleaguefinal-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBncZZEF6INuL+7QemMZ9vUznYxzru3vfNX5p8XWJZypXYJc2c0LycxnEvPBMSQOorjyk1IAhwC1lg1O74GM+sQ0E5Uzn6dSe+N7MJZ4TWNFWiEus4udvwAPjbopk2dXPbpWjYG4U7iksJpfCsxP8jN2NeQ+bAAO/0aTJH0JcuqLEYjZq/sf0mpis/2OTQhVvEMxS4/IQWQ+JHFrzOZyQTqqYYnAebos94Tg1fgR9Cc3nSZyy2apxfKMfM+8EftdxAWxW0d4A/VhtEs+VV4yVYTmsofV2uurI75LCiZ1PqHV]]></acast:settings>
			<itunes:subtitle>Mike Calvin Miguel Delaney and Dominic Fifield believe the final foreshadows another era of sustained rivalry between Chelsea and City. They contrast two coaches at the peak of their powers, Pep Guardiola and Thomas Tuchel, with one in gradual decline,...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin Miguel Delaney and Dominic Fifield believe the final foreshadows another era of sustained rivalry between Chelsea and City. They contrast two coaches at the peak of their powers, Pep Guardiola and Thomas Tuchel, with one in gradual decline, Jose Mourinho.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin Miguel Delaney and Dominic Fifield believe the final foreshadows another era of sustained rivalry between Chelsea and City. They contrast two coaches at the peak of their powers, Pep Guardiola and Thomas Tuchel, with one in gradual decline, Jose Mourinho.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Kevin de Bruyne : Footballer of the Year and Champions League winner?</title>
			<itunes:title>Kevin de Bruyne : Footballer of the Year and Champions League winner?</itunes:title>
			<pubDate>Tue, 04 May 2021 05:00:00 GMT</pubDate>
			<itunes:duration>35:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/kevindebruyne-footballeroftheyearandchampionsleaguewinner-/media.mp3" length="84274940" type="audio/mpeg"/>
			<guid isPermaLink="false">1ad15112-706f-483b-800b-57ed55ad1436</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/kevindebruyne-footballeroftheyearandchampionsleaguewinner-</link>
			<acast:episodeId>1ad15112-706f-483b-800b-57ed55ad1436</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>kevindebruyne-footballeroftheyearandchampionsleaguewinner-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz973HRdz8JwUTAIAY3d14UFErLivYctLGL1l+7GFIeA+3tUv8OqVk6ENO0aVtc9C+UXquzSa3h9yEqC6JKLq41px3Qj7iCjoqns82viY7wAgInXZlgvgkEK2kn2IloBUQs7i+IlDX6RVFP7Q9L3oR+fU9kOzukikmvvR+P7e9ZaCbDak7f7DipBbL1QFsRt7i/SY7BPIJzvHltQw547frQMaEORC7it021L9C5EVS9xCoC3fjCccPVwkhFo26Ow92J]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Anne Marie Batson and Adrian Clarke reveal who they are voting for in the FWA Footballer of the Year poll. They also dwell on the possibility of an all-English Champions League final,&nbsp;and welcome a huge cash boost for the women...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Adrian Clarke reveal who they are voting for in the FWA Footballer of the Year poll. They also dwell on the possibility of an all-English Champions League final,&nbsp;and welcome a huge cash boost for the women's version of the competition.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Adrian Clarke reveal who they are voting for in the FWA Footballer of the Year poll. They also dwell on the possibility of an all-English Champions League final,&nbsp;and welcome a huge cash boost for the women's version of the competition.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is it time to Draw the Line, and tackle online abuse, once and for all?</title>
			<itunes:title>Is it time to Draw the Line, and tackle online abuse, once and for all?</itunes:title>
			<pubDate>Thu, 29 Apr 2021 16:00:02 GMT</pubDate>
			<itunes:duration>29:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isittimetodrawtheline-andtackleonlineabuse-onceandforall-/media.mp3" length="70131872" type="audio/mpeg"/>
			<guid isPermaLink="false">2b6e5a5a-7493-4a90-adba-fe9a24c77d21</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isittimetodrawtheline-andtackleonlineabuse-onceandforall-</link>
			<acast:episodeId>2b6e5a5a-7493-4a90-adba-fe9a24c77d21</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isittimetodrawtheline-andtackleonlineabuse-onceandforall-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9mwPfxeY1nCL8euYyc1sGiYey4iUX8o18cpyF5EDoO+PoOyCkYLzLoocoq3nk1OL362h4IXGe6HJtCIIewsta/YdvdsY/gWy5G3y0PCDqtBZXleDbrsqsi93z46R5MCjFjqeQzKiJvIZPYqnxkEEuPuwdkW+wvJv9mRgVZNXBnXTMv9QntohDUyooHJA+vdH/PgKdF/EanpoFsefe4Kn8Q6JfM0cOnR8bU33rWbv1E9Y=]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Anne Marie Batson and Adrian Clarke mark the launch of BT & BT Sport's Draw the Line campaign, designed to tackle online abuse, by sharing their own experiences. They support a zero-tolerance policy, and will join this weekend...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Adrian Clarke mark the launch of BT &amp; BT Sport's Draw the Line campaign, designed to tackle online abuse, by sharing their own experiences. They support a zero-tolerance policy, and will join this weekend's Bboycott to pressurise social media companies into more effective&nbsp;action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Adrian Clarke mark the launch of BT &amp; BT Sport's Draw the Line campaign, designed to tackle online abuse, by sharing their own experiences. They support a zero-tolerance policy, and will join this weekend's Bboycott to pressurise social media companies into more effective&nbsp;action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Are Mauricio Pochettino and PSG the neutral's favourite for the Champions League?]]></title>
			<itunes:title><![CDATA[Are Mauricio Pochettino and PSG the neutral's favourite for the Champions League?]]></itunes:title>
			<pubDate>Mon, 26 Apr 2021 14:33:40 GMT</pubDate>
			<itunes:duration>55:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/aremauriciopochettinoandpsgtheneutralsfavouriteforthechampionsleague-/media.mp3" length="134038244" type="audio/mpeg"/>
			<guid isPermaLink="false">18da8bd5-1383-4269-8387-35dff6bd9cb8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/aremauriciopochettinoandpsgtheneutralsfavouriteforthechampionsleague-</link>
			<acast:episodeId>18da8bd5-1383-4269-8387-35dff6bd9cb8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>aremauriciopochettinoandpsgtheneutralsfavouriteforthechampionsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREQgr1vXwodX5fT7LlTDx3/U1oARZK2sErJ36gULxEsv5Jilwg3cMA1NFU7uKq0PdK5f3/2mAUMvVzePLiL4OL4CvSrscyKP7KEh012mMgqjwUtJfIsd/Sxd2xsRiX+rTz0nnZ4TQ6IuKuCL7XiHOGM9bm8OX4aiO8m4LRJ5+I4bN0WidcpLRNx/TV87UwWt0SDm9dQOgPVn/KQyDQYapS+h5xIKMHxZU58sfeDu5OEDPWSpkN4XrPELfGk029khFFitl494hzHQq5bd13Psy1sdgBmhoAQRqVAsajolmMN7]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, John Cross and Paul Hayward stress the importance of the Champions League at a time in which football&nbsp;has the chance to benefit from fundamental change. They believe Thomas Tuchel will steer Chelsea to this season's final, bu...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Paul Hayward stress the importance of the Champions League at a time in which football&nbsp;has the chance to benefit from fundamental change. They believe Thomas Tuchel will steer Chelsea to this season's final, but suggest that PSG, the only semi finalists not to support the Super League, have been galvanised under Mauricio&nbsp;Pochettino.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Paul Hayward stress the importance of the Champions League at a time in which football&nbsp;has the chance to benefit from fundamental change. They believe Thomas Tuchel will steer Chelsea to this season's final, but suggest that PSG, the only semi finalists not to support the Super League, have been galvanised under Mauricio&nbsp;Pochettino.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>An important battle has been won. Will the war against greed in football be lost?</title>
			<itunes:title>An important battle has been won. Will the war against greed in football be lost?</itunes:title>
			<pubDate>Thu, 22 Apr 2021 15:57:46 GMT</pubDate>
			<itunes:duration>54:31</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/animportantbattlehasbeenwon.willthewaragainstgreedinfootballbelost-/media.mp3" length="130729808" type="audio/mpeg"/>
			<guid isPermaLink="false">5779165b-8098-4a2e-a94e-416f15c3c48c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/animportantbattlehasbeenwon.willthewaragainstgreedinfootballbelost-</link>
			<acast:episodeId>5779165b-8098-4a2e-a94e-416f15c3c48c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>animportantbattlehasbeenwon.willthewaragainstgreedinfootballbelost-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRDb9OFlj9e+QBURDcJfQsBr66+eW3mJRulaZQsI3//K+iqJ4tKWxP7RtKEER2O+B6T9TczIfypsGVzvVvr1vAr9oPvip6EZE2dOHzQTcThF0nrT1al2lnWVuXQqNUUsWFXcSXLqeZkHJXuUmBwU6v7HtSFua04uv/werNHaqHFmRNweHUCqdQm4lzSQthB18WZZ8IWs4XqNHtYSkhvsZkOovhsEDtSvmeKD0tyZVcxtxdjW+guux/HQCozncxDcFSJMDNX4D9S6RKaVdF2UzLKUV680b7KHkimWMcTddJpLR]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jordan Jarrett Bryan and Seb Stafford Bloor assess the fallout from the collapse of the planned Super League. Liverpool have come out of the controversy most badly, though fan protests, like those against the Glazers, Manchester United...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Seb Stafford Bloor assess the fallout from the collapse of the planned Super League. Liverpool have come out of the controversy most badly, though fan protests, like those against the Glazers, Manchester United's owners, must continue at all six clubs. Tottenham can't expect redemption in the League Cup final at the end of one of the most 'Spursy' weeks in their history.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Seb Stafford Bloor assess the fallout from the collapse of the planned Super League. Liverpool have come out of the controversy most badly, though fan protests, like those against the Glazers, Manchester United's owners, must continue at all six clubs. Tottenham can't expect redemption in the League Cup final at the end of one of the most 'Spursy' weeks in their history.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Is Jose Mourinho's sacking by Spurs related to the Super League announcement?]]></title>
			<itunes:title><![CDATA[Is Jose Mourinho's sacking by Spurs related to the Super League announcement?]]></itunes:title>
			<pubDate>Mon, 19 Apr 2021 15:15:07 GMT</pubDate>
			<itunes:duration>55:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isjosemourinhossackingbyspursrelatedtothesuperleagueannouncement-/media.mp3" length="134101928" type="audio/mpeg"/>
			<guid isPermaLink="false">62bbcccf-8e53-49b0-81ab-0ac21df74554</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isjosemourinhossackingbyspursrelatedtothesuperleagueannouncement-</link>
			<acast:episodeId>62bbcccf-8e53-49b0-81ab-0ac21df74554</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isjosemourinhossackingbyspursrelatedtothesuperleagueannouncement-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPxH7fvBp2Lw2/PN9jeymzyLrfnwu9ldGeqgN3O8E7SaHTNW/u5q4ZFw8ZwwCQtp+YByJ1mMoaz+UtAdC6nBK97f6uZuCT5nFzQStZvLE3BUUmMlGMjpJhfQucwklw+0oTYoVwKixBpsfq6EMxrYfhBPxfKgqatffpccxZJpiJkCIJzUxl5CKCBr/iKKiVqC1mbcrO4LpXe+GlyNn/PMY/hgj/ZU0BVIG/jz73bs5PBD0Ql1QMpczDYF6OzD70y/LyXJST/YdTxKOMVUdbGw4Y08h58wv/jL4Kij7EsnMu+7]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Darren Lewis and Ade Oladipo mull over a momentous few hours for football. They react to shock news of Jose Mourinho's departure from Tottenham, and doubt whether he will manage in the Premier League again. The rest of this edition is...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Ade Oladipo mull over a momentous few hours for football. They react to shock news of Jose Mourinho's departure from Tottenham, and doubt whether he will manage in the Premier League again. The rest of this edition is devoted to an impassioned debate about plans for a Super League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Ade Oladipo mull over a momentous few hours for football. They react to shock news of Jose Mourinho's departure from Tottenham, and doubt whether he will manage in the Premier League again. The rest of this edition is devoted to an impassioned debate about plans for a Super League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Do Leicester's players owe Brendan Rodgers a place in the FA Cup final?]]></title>
			<itunes:title><![CDATA[Do Leicester's players owe Brendan Rodgers a place in the FA Cup final?]]></itunes:title>
			<pubDate>Thu, 15 Apr 2021 14:26:27 GMT</pubDate>
			<itunes:duration>54:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/doleicestersplayersowebrendanrodgersaplaceinthefacupfinal-/media.mp3" length="129629432" type="audio/mpeg"/>
			<guid isPermaLink="false">08904e73-7c7d-4a7d-a304-b0888746ab39</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/doleicestersplayersowebrendanrodgersaplaceinthefacupfinal-</link>
			<acast:episodeId>08904e73-7c7d-4a7d-a304-b0888746ab39</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>doleicestersplayersowebrendanrodgersaplaceinthefacupfinal-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFAxddUfN/gXXNNcfJqBr+SMuteOsLWCBzIxEoPj/Ry1lyuLLnKUCemR9eYQkTdpV+fgR7DDxso0SHK2z9FIlhVIqdR3z84R9AfgeyqNZrms5z8BImSaEfsd2PtRahfxLSuKYSkBllGl5wjNPa1iUE1pbl2/sHyT3+rItjqNpfl64bieh+pTUdDmDfNDav1llxdJt+6Rp/AzGSF5X9G5mbe3GZsfIjfUIWCrDm7eJ6E9Ez+Bf/xNxHSMcWyEheoRMtutRM5mB6HvHI9zrHV/cLIr4h4JIILYZxXajx6Ltk38]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Dominic Fifield and Miguel Delaney assess Leicester's challenging build&nbsp;up to Sunday's FA Cup semi final against Southampton. and praise the strength of Brendan Rodgers' management,They preview&nbsp;a potential ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Miguel Delaney assess Leicester's challenging build&nbsp;up to Sunday's FA Cup semi final against Southampton. and praise the strength of Brendan Rodgers' management,They preview&nbsp;a potential Champions League final between Chelsea and Manchester City, and believe Jose Mourinho will probably be replaced in the summer, when Liverpool's squad must be overhauled.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Miguel Delaney assess Leicester's challenging build&nbsp;up to Sunday's FA Cup semi final against Southampton. and praise the strength of Brendan Rodgers' management,They preview&nbsp;a potential Champions League final between Chelsea and Manchester City, and believe Jose Mourinho will probably be replaced in the summer, when Liverpool's squad must be overhauled.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Liverpool save their season?</title>
			<itunes:title>Can Liverpool save their season?</itunes:title>
			<pubDate>Mon, 12 Apr 2021 14:45:25 GMT</pubDate>
			<itunes:duration>51:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canliverpoolsavetheirseason-/media.mp3" length="122669084" type="audio/mpeg"/>
			<guid isPermaLink="false">d2217ba7-efef-4d76-a043-e2860eeab048</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canliverpoolsavetheirseason-</link>
			<acast:episodeId>d2217ba7-efef-4d76-a043-e2860eeab048</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canliverpoolsavetheirseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRLEIZ50bKWzlBu1T9rSoskoE/Udip9N4qzFOuWWahHqFdxeDqY2CnRW5lA1U2uiVuJbMDXitXsPIS5lohCuoiw7C3hvpgghAvOCt4tlLjSyyJPbD3F7tdtXfk+zmZcniCKP20Bz9FovboCRAsy/OMvO/YT77yAelvZEkTw6mmLsfYSigXjTgkXxH9B/fn4Xp/MzzMPn0A8WeTQng7btRiiQPLqCQw6nJSdvZgWs7b48suT3cmwCktaeP9/nMYqUnpm6qh9T9dzya9hBwoEnDtRcPkeKEUhLm6nMdeSA9uKrG]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Art de Roche and David Preece discuss whether Liverpool can make the Champions League semi finals without the emotional intensity traditionally supplied&nbsp;by their fans. Will there be another twist in Paris, where PSG protect their ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Art de Roche and David Preece discuss whether Liverpool can make the Champions League semi finals without the emotional intensity traditionally supplied&nbsp;by their fans. Will there be another twist in Paris, where PSG protect their lead against&nbsp;Bayern Munich? Manchester United are tipped to win the Europa League, but , like Liverpool, Arsenal have their season on the line.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Art de Roche and David Preece discuss whether Liverpool can make the Champions League semi finals without the emotional intensity traditionally supplied&nbsp;by their fans. Will there be another twist in Paris, where PSG protect their lead against&nbsp;Bayern Munich? Manchester United are tipped to win the Europa League, but , like Liverpool, Arsenal have their season on the line.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Manchester City meet the pressure of expectation?</title>
			<itunes:title>Can Manchester City meet the pressure of expectation?</itunes:title>
			<pubDate>Thu, 08 Apr 2021 15:08:24 GMT</pubDate>
			<itunes:duration>51:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canmanchestercitymeetthepressureofexpectation-/media.mp3" length="122392424" type="audio/mpeg"/>
			<guid isPermaLink="false">ca811057-f3bd-4380-bd8e-72c8993ff568</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canmanchestercitymeetthepressureofexpectation-</link>
			<acast:episodeId>ca811057-f3bd-4380-bd8e-72c8993ff568</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canmanchestercitymeetthepressureofexpectation-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRMiZhGraRvK8quxAL/u6n26GLFjmlYkfXAJLPdfCBAmtEk0dm+7/FRPIFd/hXtcjvp8UJNJQq4eyshBvozBdywkRf2hw7BO1mffHMiDqwwFu2SSOWnxdywRs3HBKxE/4VywlBQ+MbBFZ2M3n6ustjtkO7bBXBUtPyt4QyBxc+IzbqMBsvLCKqrTM7Uk7OGntIflPQsTHWox+/SexYrVgAr3AZUqULMSbqbo4SI/R2kU5jd0dj7K1XpSEP/fVL67vM6Z4dF10NBazVZaBWlPlGUfRjMH7+qN8Kzr7CEn4era/]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Richard Amofa and Glenn Moore put Saturday's coaching match-up between Pep Guardiola and Marcelo Bielsa into the context of Manchester City's attempt to win four trophies this season. They feel Liverpool can still make the top fo...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Richard Amofa and Glenn Moore put Saturday's coaching match-up between Pep Guardiola and Marcelo Bielsa into the context of Manchester City's attempt to win four trophies this season. They feel Liverpool can still make the top four, hail Mason Mount's increasing&nbsp;impact, and warn that time is running out if Fulham are to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Richard Amofa and Glenn Moore put Saturday's coaching match-up between Pep Guardiola and Marcelo Bielsa into the context of Manchester City's attempt to win four trophies this season. They feel Liverpool can still make the top four, hail Mason Mount's increasing&nbsp;impact, and warn that time is running out if Fulham are to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Manchester City afford not to sign Erling Haaland?</title>
			<itunes:title>Can Manchester City afford not to sign Erling Haaland?</itunes:title>
			<pubDate>Tue, 06 Apr 2021 14:19:02 GMT</pubDate>
			<itunes:duration>51:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canmanchestercityaffordnottosignerlinghaaland-/media.mp3" length="123088772" type="audio/mpeg"/>
			<guid isPermaLink="false">f7e4aad2-b5cd-4a7d-b94c-a1b0b5ca6ae3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canmanchestercityaffordnottosignerlinghaaland-</link>
			<acast:episodeId>f7e4aad2-b5cd-4a7d-b94c-a1b0b5ca6ae3</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canmanchestercityaffordnottosignerlinghaaland-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRNPvbXK+SLN5busxxwpJDMlkW7W9LM2FJWS39Kmu7NAdVU+xbAz7LX6Zd+kLhYRi88oqiOq+3dpNjQUp4VtAoFnEOhYpWeCrY6gESLrGZtj3A7DOUzWJx1hJNiMvqZotB2IuyOLapLEsLdUucdzQIHoeb/wWaoZiczWzn/4GhD3fxGTQqY3DJs3PF/Cdc51e6Ly0sHyH9cDqU2bit6tw+YDWJITaiD6pXyUfsQi95AH1ozSfaNLJFIQqCzYu7axMWRQXo97x8WuQW2fEEIFUw+c7/xmGcwj9K4Bjw4O0X5OB]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and Seb Staford Bloor discuss the circus surrounding Erling Haaland, and his seemingly inevitable move from Borussia Dortmund. They believe Harry Kane should push to leave Tottenham, that Arsenal need to back Mikel Arteta by ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Staford Bloor discuss the circus surrounding Erling Haaland, and his seemingly inevitable move from Borussia Dortmund. They believe Harry Kane should push to leave Tottenham, that Arsenal need to back Mikel Arteta by sanctioning summer sales, and reveal their best potential signings, from Barnsley to the Bundesliga.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Staford Bloor discuss the circus surrounding Erling Haaland, and his seemingly inevitable move from Borussia Dortmund. They believe Harry Kane should push to leave Tottenham, that Arsenal need to back Mikel Arteta by sanctioning summer sales, and reveal their best potential signings, from Barnsley to the Bundesliga.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Bayern Munich prevent English domination of the Champions League?</title>
			<itunes:title>Can Bayern Munich prevent English domination of the Champions League?</itunes:title>
			<pubDate>Thu, 01 Apr 2021 14:02:27 GMT</pubDate>
			<itunes:duration>52:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canbayernmunichpreventenglishdominationofthechampionsleague-/media.mp3" length="125824052" type="audio/mpeg"/>
			<guid isPermaLink="false">ce3a9cb9-597d-4dae-9c81-cdc72a4eef0d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canbayernmunichpreventenglishdominationofthechampionsleague-</link>
			<acast:episodeId>ce3a9cb9-597d-4dae-9c81-cdc72a4eef0d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canbayernmunichpreventenglishdominationofthechampionsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRDSkeV/hm3AbLSG/83a2qGWJywIDNfeeeZHay65+ZBcJFLwfuTYVuw2Q3zTrbiCqNxLSTBW+qI6aQTrZghgVUTE3BkLqTYeoCgQxKQMCpR/Ac4bebCNCKMXFsGMppbQD/HWnumhfzBSPOl4x6qN7UHmHcnEkw7ijliykfc+clk/X4J8CkZSm+TXNq2lGMxmP20JwMyxYrladKR65DWTBkJj/QalbFPqy9HaUzhYamePO5SD6kwOPauDGmT4MvpdTL8oATwjCYmrReQvwVv9JuZv6LQLvmNgwkd3ZQ3kOVg1W]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Daniel Storey and Jonathan Northcroft assess what they regard&nbsp;as the strongest Champions League quarter-final line up for years. Manchester City define themselves by European success, and Chelsea are likely to emerge from&nbsp...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Daniel Storey and Jonathan Northcroft assess what they regard&nbsp;as the strongest Champions League quarter-final line up for years. Manchester City define themselves by European success, and Chelsea are likely to emerge from&nbsp;the less taxing&nbsp;half of the draw, but English clubs will have to reckon with the relentlessness of the German champions.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Daniel Storey and Jonathan Northcroft assess what they regard&nbsp;as the strongest Champions League quarter-final line up for years. Manchester City define themselves by European success, and Chelsea are likely to emerge from&nbsp;the less taxing&nbsp;half of the draw, but English clubs will have to reckon with the relentlessness of the German champions.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are England capable of becoming European champions?</title>
			<itunes:title>Are England capable of becoming European champions?</itunes:title>
			<pubDate>Mon, 29 Mar 2021 14:43:56 GMT</pubDate>
			<itunes:duration>47:31</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/areenglandcapableofbecomingeuropeanchampions-/media.mp3" length="113960036" type="audio/mpeg"/>
			<guid isPermaLink="false">51e9703c-2330-40dd-bad1-8f15246ec4ec</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/areenglandcapableofbecomingeuropeanchampions-</link>
			<acast:episodeId>51e9703c-2330-40dd-bad1-8f15246ec4ec</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>areenglandcapableofbecomingeuropeanchampions-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9l4emaU//CP4TPca/xdLkCUpuu5rNLFS69xk+tpiX2nISlhx5KUxwRlQIAV1xFmjcDACqIfv6VlzUA/u2K6E7vUNTVZuJlaTqQwhHKJYgrz9oj5fAEz+fodIipSeZFlZvBfiC+ToK7D4ucdkAaCE1jSmLO7DyDlBe3vW3mCrgSDjjhK91bl3VIBIUyBYu1xMzHTikg+PzQiDScCby10hw+uYgOWfTc7lY5GWaHW8QaGUzU9+8B3sX68jhozixK7ed]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Paul Hayward, and John Cross discuss the&nbsp;relevance of international football and the potential of Gareth Southgate's England squad. They praise his management style, assess his key decisions, and look forward to the Euro finals.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Paul Hayward, and John Cross discuss the&nbsp;relevance of international football and the potential of Gareth Southgate's England squad. They praise his management style, assess his key decisions, and look forward to the Euro finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward, and John Cross discuss the&nbsp;relevance of international football and the potential of Gareth Southgate's England squad. They praise his management style, assess his key decisions, and look forward to the Euro finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who are the winners and losers in this Premier League season?</title>
			<itunes:title>Who are the winners and losers in this Premier League season?</itunes:title>
			<pubDate>Mon, 22 Mar 2021 15:37:12 GMT</pubDate>
			<itunes:duration>59:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whoarethewinnersandlosersinthispremierleagueseason-/media.mp3" length="142363100" type="audio/mpeg"/>
			<guid isPermaLink="false">5b794fca-18b8-46b0-b016-facb2dfeef13</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whoarethewinnersandlosersinthispremierleagueseason-</link>
			<acast:episodeId>5b794fca-18b8-46b0-b016-facb2dfeef13</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whoarethewinnersandlosersinthispremierleagueseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Bw/R0hSVvwpKC+t3fL5wbkhITW2/IJKXTkmpqewHThE06zyI6q4AKCszOo9BqtYSdZr4R6iAVaFNhlXofov9M13zr0SLGNvNKU39uzlBn0S8T2Bd28TkmycT4rR7UWT+Cfo+iS33touSW4WQ8ETeVrT59fg5QTWJR3e9b+WzIRDIyocFWs+iERSgBQvbNo2gkYplkfukX35vCe650gRrwIGq5mMJwLmULGM/0fDDUUiqVPnz0tS+//eIvsi5r6UB]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Anne Marie Batson and Jordan Jarrett Bryan assess the state of play in the Premier League. They acknowledge Manchester City's dominance, but reserve particular praise for Leicester, Chelsea and West Ham, Newcastle are deemed the bigge...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Jordan Jarrett Bryan assess the state of play in the Premier League. They acknowledge Manchester City's dominance, but reserve particular praise for Leicester, Chelsea and West Ham, Newcastle are deemed the biggest losers, but questions are also asked about Manchester United, Wolves and Tottenham under Jose Mourinho.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Jordan Jarrett Bryan assess the state of play in the Premier League. They acknowledge Manchester City's dominance, but reserve particular praise for Leicester, Chelsea and West Ham, Newcastle are deemed the biggest losers, but questions are also asked about Manchester United, Wolves and Tottenham under Jose Mourinho.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Will an English club win this season's Champions League?]]></title>
			<itunes:title><![CDATA[Will an English club win this season's Champions League?]]></itunes:title>
			<pubDate>Fri, 19 Mar 2021 16:39:46 GMT</pubDate>
			<itunes:duration>56:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willanenglishclubwinthisseasonschampionsleague-/media.mp3" length="135365168" type="audio/mpeg"/>
			<guid isPermaLink="false">55124c0f-aa6e-438c-aca2-32a3128da004</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willanenglishclubwinthisseasonschampionsleague-</link>
			<acast:episodeId>55124c0f-aa6e-438c-aca2-32a3128da004</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willanenglishclubwinthisseasonschampionsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRJXSibjhhI/5Y1B7GhosyfmuGFmjIUYRbSRhsN+ggZCxpAy/E7FlO6QAZjlrJo0N9w10ofGSi3/Q5DosHnG7u9WtBs5HBCNt6wiwvEAlymUXwFaqQlXrjF53r2JbAagU60DYyGN/hPT3hjC5YV2S42oRBwvbcpxWcmhO1Ur90Ozr5K+LcPYwK+dfOy9boxZ8QWWdqjUd+I3ElNOH2FoSTieojDO8EB/0Hu35yS5AFHpss8Uzdv0sh8YOfJoIu+hdYR3dFk8ZEMGRyA6i15Wx2itFOK8SlBzCH7IScvxJtqpx]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Melissa Reddy and David Preece react to today's European draws. They envisage Manchester City, Chelsea and Liverpool making the Champions League semi finals. A Europa League final between Manchester United and Arsenal may also be on t...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Melissa Reddy and David Preece react to today's European draws. They envisage Manchester City, Chelsea and Liverpool making the Champions League semi finals. A Europa League final between Manchester United and Arsenal may also be on the cards.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Melissa Reddy and David Preece react to today's European draws. They envisage Manchester City, Chelsea and Liverpool making the Champions League semi finals. A Europa League final between Manchester United and Arsenal may also be on the cards.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Thomas Tuchel return to the Champions League final with Chelsea?</title>
			<itunes:title>Can Thomas Tuchel return to the Champions League final with Chelsea?</itunes:title>
			<pubDate>Mon, 15 Mar 2021 14:46:55 GMT</pubDate>
			<itunes:duration>52:11</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canthomastuchelreturntothechampionsleaguefinalwithchelsea-/media.mp3" length="125132924" type="audio/mpeg"/>
			<guid isPermaLink="false">9fa9b4ce-244b-4db8-a559-c8255fc5b24e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canthomastuchelreturntothechampionsleaguefinalwithchelsea-</link>
			<acast:episodeId>9fa9b4ce-244b-4db8-a559-c8255fc5b24e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canthomastuchelreturntothechampionsleaguefinalwithchelsea-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROjYKKmDwy2QVv8rwieVPN455s5sBsAt61l0F3h2aTEbumiFp7+E0aZVUUs/yddPJrkg51uLjlU7lqrGp2O/wYFlXJGhvkp4zFrwLO3Q5CnfSjRe2ga6U4E8gbnK++8+PJL2YP8CuIWVt/4+oYUhidfpmIxDZqO7Aw5Bnlq99JHpzL3P4eDbpX6BZn7T7x3qxgamqk126h5KMgjQwK0+pKgGgV0f8pcToV/E+7mISOp1MerwhbwA1tgI/Q3x0dG4xyM8BmNCXxv1bNQ8OJvjAAgyxabIV2irqWo+cIx1pX7E]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Darren Lewis and Ade Oladipo assess Chelsea's Champions League chances, but make Manchester City favourites. Despite Manchester United's struggle in the Europa League, they believe Ole Gunnar Solksjaer&nbsp;deserves praise. I...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Ade Oladipo assess Chelsea's Champions League chances, but make Manchester City favourites. Despite Manchester United's struggle in the Europa League, they believe Ole Gunnar Solksjaer&nbsp;deserves praise. In North London, Mikel Arteta offers greater scope for progress than Jose Mourinho.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Ade Oladipo assess Chelsea's Champions League chances, but make Manchester City favourites. Despite Manchester United's struggle in the Europa League, they believe Ole Gunnar Solksjaer&nbsp;deserves praise. In North London, Mikel Arteta offers greater scope for progress than Jose Mourinho.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Newcastle United destined to be relegated?</title>
			<itunes:title>Are Newcastle United destined to be relegated?</itunes:title>
			<pubDate>Thu, 11 Mar 2021 16:44:14 GMT</pubDate>
			<itunes:duration>48:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/arenewcastleuniteddestinedtoberelegated-/media.mp3" length="115668020" type="audio/mpeg"/>
			<guid isPermaLink="false">3ec7ad83-e46e-4cd0-8b80-e4fba0b4d970</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/arenewcastleuniteddestinedtoberelegated-</link>
			<acast:episodeId>3ec7ad83-e46e-4cd0-8b80-e4fba0b4d970</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>arenewcastleuniteddestinedtoberelegated-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFmGzXGgPE+cMLWgXObPYaYsfa9G7D+F/Gwe3HYBezD5zXB2gB/payS9/ORDBlVgE39O6MYRnIiJez8AnsYbywFMym68LqeW1yRuUiZLrAVAMXbl+eFnzaawTOK22mqw3bzfsPlJDiO266Ncn3TK2QatM6L7EvfYQ6VcEMebKE7dV5EuZckKIu05Sqgr1eDxpmA+fqYEYUhLA+tRZ0WOajpTdV/etbk7wI9TPkJjkWninKwwhHZEijVlhVVuYWJK++EPC17b5PwYdZpUMKH8SYw2f1hOi1OgeeGq9R93hwcb]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Seb Stafford Bloor and Art de Roche fear for Newcastle's Premier League future. They assess the North London derby and, at a time of transition in European football, unanimously condemn plans for an extended,closed shop, Champions Lea...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Art de Roche fear for Newcastle's Premier League future. They assess the North London derby and, at a time of transition in European football, unanimously condemn plans for an extended,closed shop, Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Art de Roche fear for Newcastle's Premier League future. They assess the North London derby and, at a time of transition in European football, unanimously condemn plans for an extended,closed shop, Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>You have an unlimited transfer budget. Who do you sign, Kylian Mbappe or Erling Haaland</title>
			<itunes:title>You have an unlimited transfer budget. Who do you sign, Kylian Mbappe or Erling Haaland</itunes:title>
			<pubDate>Mon, 08 Mar 2021 15:55:16 GMT</pubDate>
			<itunes:duration>54:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/youhaveanunlimitedtransferbudget.whodoyousign-kylianmbappeorerlinghaaland/media.mp3" length="130927124" type="audio/mpeg"/>
			<guid isPermaLink="false">4c3f00a1-7f6e-4692-9ab6-ac95df9c3c15</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/youhaveanunlimitedtransferbudget.whodoyousign-kylianmbappeorerlinghaaland</link>
			<acast:episodeId>4c3f00a1-7f6e-4692-9ab6-ac95df9c3c15</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>youhaveanunlimitedtransferbudget.whodoyousign-kylianmbappeorerlinghaaland</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9ED32y8ZtcB06bDo/TIe3qGcBmE9QQ08UGG36jaM/+yi8daFHHEf2OCU45JKKf3G4B1cyv1NV5GEjQw0Z9kAQdAyukNExIXYQS7lwlCUfhxbvW902MAn/60BtF7pKMvLbdC4so9I0whg7oauzzNQWYT+/NsAO3qka8KpUZJegBWqhvb56GuZ4M2Iyj9OYwjdtUA7IuJYQkPtT5+EWHAtSuRO2XIzchcaKlbBN8CRBwI8Qg3p9L/nse3bnFqo10mXe]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Miguel Delaney and Adrian Clarke discuss the relative merits of the new big two, Kylian Mbappe and Erling Haaland, at the start of a pivotal&nbsp;week in the Champions League. They ask how low Liverpool can go, see warning signs for Ma...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Adrian Clarke discuss the relative merits of the new big two, Kylian Mbappe and Erling Haaland, at the start of a pivotal&nbsp;week in the Champions League. They ask how low Liverpool can go, see warning signs for Manchester City in United's derby victory, and believe Arsenal have been disadvantaged by UEFA.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Adrian Clarke discuss the relative merits of the new big two, Kylian Mbappe and Erling Haaland, at the start of a pivotal&nbsp;week in the Champions League. They ask how low Liverpool can go, see warning signs for Manchester City in United's derby victory, and believe Arsenal have been disadvantaged by UEFA.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Manchester City The Inevitables?</title>
			<itunes:title>Are Manchester City The Inevitables?</itunes:title>
			<pubDate>Thu, 04 Mar 2021 15:42:30 GMT</pubDate>
			<itunes:duration>48:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/aremanchestercitytheinevitables-/media.mp3" length="115889348" type="audio/mpeg"/>
			<guid isPermaLink="false">619b1fe5-0b81-4fa6-b3a8-940c7138751e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/aremanchestercitytheinevitables-</link>
			<acast:episodeId>619b1fe5-0b81-4fa6-b3a8-940c7138751e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>aremanchestercitytheinevitables-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREnccOjQPODg1UULc1eIAVu4lsgRkNUCx8HEI7CtCcixp+WtN7+ig8BSruq/9ifBbfXBuefkLfFVLExxxlOuFj6iceSOmB66smGzxLZU3XetiX+q6z2Cvmr62i1HuLgGEj0GKpqpIlZNAk4VQXvN7n8o0vF/3XI8ZAnzluT+BMtO19bMmat/RYJU4NTPKkU/7VYBpz7o/V9tqKW9qOlq9GOuRdiJHBXpTKFrsox5UkqwEggPK+gGdwUmn7KPVkXx+QI/j4rnfLPGy2ZSa2tGGnXRzNztKJ9YUquEgWZboxOf]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Richard Amofa and Glenn Moore consider City's fifth Premier League title in a decade a formality. Who can meet their challenge domestically and in Europe? Manchester United are running key players into the ground and Chelsea's cu...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Richard Amofa and Glenn Moore consider City's fifth Premier League title in a decade a formality. Who can meet their challenge domestically and in Europe? Manchester United are running key players into the ground and Chelsea's culture of impatience acts against them. Newcastle, meanwhile, are in big trouble.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Richard Amofa and Glenn Moore consider City's fifth Premier League title in a decade a formality. Who can meet their challenge domestically and in Europe? Manchester United are running key players into the ground and Chelsea's culture of impatience acts against them. Newcastle, meanwhile, are in big trouble.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[What role will fans play in football's future?]]></title>
			<itunes:title><![CDATA[What role will fans play in football's future?]]></itunes:title>
			<pubDate>Mon, 01 Mar 2021 16:40:19 GMT</pubDate>
			<itunes:duration>51:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatrolewillfansplayinfootballsfuture-/media.mp3" length="123806000" type="audio/mpeg"/>
			<guid isPermaLink="false">382a5dc5-5768-4dc7-945c-09c01c723512</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatrolewillfansplayinfootballsfuture-</link>
			<acast:episodeId>382a5dc5-5768-4dc7-945c-09c01c723512</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatrolewillfansplayinfootballsfuture-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRJiB2L29uVCbGUGaoH9/9lO8h9ube63wn5w6IYGgZPMGSCRT0sUme/gtGf7q0VW0EQNjzs4va/peBWnlu9bShznrRZ/P6UpuOGq4sU+7FKvAEyaRF9MCXVebQllzp2SuTrD4KWcWQAplq1SvbqMxIeVAeTFeqt4FqCahylxx5nYup/wLx8tbq3z5dMkuIaGLIOrxvfzAFJzhs1NsUHHd/HWibvOlOHSYNwfKTfmJuZZV9lRyRHAJ5WKbB43hdvxQ6ADiUqR/H4XOUWjbV8o1EJWWcJmzYkGK16J5zEDzTvEw]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Paul Hayward and Dominic Fifield discuss the issues raised in 'Ours' , the latest BT Sport Films documentary, which will be shown on BT Sport 1 at 10.30pm on Tuesday. They base their optimism for the future of the game on the fan...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Paul Hayward and Dominic Fifield discuss the issues raised in 'Ours' , the latest BT Sport Films documentary, which will be shown on BT Sport 1 at 10.30pm on Tuesday. They base their optimism for the future of the game on the fans' resilience, passion and innovation. They also discuss the top six, and Fulham's chances of avoiding the drop.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Paul Hayward and Dominic Fifield discuss the issues raised in 'Ours' , the latest BT Sport Films documentary, which will be shown on BT Sport 1 at 10.30pm on Tuesday. They base their optimism for the future of the game on the fans' resilience, passion and innovation. They also discuss the top six, and Fulham's chances of avoiding the drop.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will the Moyes effect stop City in their tracks?</title>
			<itunes:title>Will the Moyes effect stop City in their tracks?</itunes:title>
			<pubDate>Thu, 25 Feb 2021 15:06:34 GMT</pubDate>
			<itunes:duration>48:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willthemoyeseffectstopcityintheirtracks-/media.mp3" length="116599268" type="audio/mpeg"/>
			<guid isPermaLink="false">052db581-a326-49ed-8243-f74e0bc1f2a1</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willthemoyeseffectstopcityintheirtracks-</link>
			<acast:episodeId>052db581-a326-49ed-8243-f74e0bc1f2a1</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willthemoyeseffectstopcityintheirtracks-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRDaIhcKunxvPNnNXQgzv1rd8MDCatF+bS5IAuhwToRJ6+i+RlcPhzboz5u3tU095n+DhDE2IIx0arNDLnF9rtR4uW0E5O+n9+iqHlrj8AAZRt6/EffjDz+a+qEVuYIHzPvAWic3sDwPYxYEZNIxzwulJbNmlWzhP0GrU6b+Wb5y3E6ZGLPmwOFmzggI2KWzViC0PH7n5M4mk2YgWbfSuZxoCggpb9tLICbJjGFcjT0IIle243un5q0KNcG6z7B59qO8ituQsUKTmTFEPVdznGVgiWk3kNE5FuBZ0WgGV7252]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Anne Marie Batson and Jonathan Northcroft praise David Moyes for following his Everton blueprint at West Ham. They discuss the influence of Juanma Lillo, Pep Guardiola's mentor, and believe Steven Gerrard is proving why he will one da...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Jonathan Northcroft praise David Moyes for following his Everton blueprint at West Ham. They discuss the influence of Juanma Lillo, Pep Guardiola's mentor, and believe Steven Gerrard is proving why he will one day return to Liverpool as manager.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Jonathan Northcroft praise David Moyes for following his Everton blueprint at West Ham. They discuss the influence of Juanma Lillo, Pep Guardiola's mentor, and believe Steven Gerrard is proving why he will one day return to Liverpool as manager.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Can Manchester City's dominance extend to the Champions League?]]></title>
			<itunes:title><![CDATA[Can Manchester City's dominance extend to the Champions League?]]></itunes:title>
			<pubDate>Mon, 22 Feb 2021 15:02:00 GMT</pubDate>
			<itunes:duration>55:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canmanchestercitysdominanceextendtothechampionsleague-/media.mp3" length="133216616" type="audio/mpeg"/>
			<guid isPermaLink="false">3d24ba6b-c021-4f5c-99ef-7d9dbf49c901</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canmanchestercitysdominanceextendtothechampionsleague-</link>
			<acast:episodeId>3d24ba6b-c021-4f5c-99ef-7d9dbf49c901</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canmanchestercitysdominanceextendtothechampionsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRDnuMyXg3eFIUWqudqoxT9TcKsmr5s2d5jMVIRbz/v2IyfzHDP280bppVq8rQUh0qBAHGyW0R1ZmajyRjwc1a/8VnnvWATlOW21x9CT/ks8MCOcIbFsN0hxoHoppYr2QpEHzP9erHPQDwC0rY+3FMMwsJx1f8RVR29TTanA97MfOKT9Rc7nBfBXX7QJtdHKB5PrGcizOFWXwsJawOM1wy740Vqffo4g5X8KiFEwvGeZJKTERkLUIob4EjjS0bDcnkeI/7s/yyJxEYnUY3DHJnW6WihRl255n/IJuGWfHrg5I]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Miguel Delaney and John Cross discuss the future of the Champions League, and the implications of City's current superiority. They refuse to write off Liverpool, regard Chelsea as potential European champions, and believe it is realis...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and John Cross discuss the future of the Champions League, and the implications of City's current superiority. They refuse to write off Liverpool, regard Chelsea as potential European champions, and believe it is realistic to imagine Leicester City winning the Europa League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and John Cross discuss the future of the Champions League, and the implications of City's current superiority. They refuse to write off Liverpool, regard Chelsea as potential European champions, and believe it is realistic to imagine Leicester City winning the Europa League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Jurgen Klopp find salvation in the Champions League?</title>
			<itunes:title>Can Jurgen Klopp find salvation in the Champions League?</itunes:title>
			<pubDate>Mon, 15 Feb 2021 15:58:04 GMT</pubDate>
			<itunes:duration>55:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canjurgenkloppfindsalvationinthechampionsleague-/media.mp3" length="132038984" type="audio/mpeg"/>
			<guid isPermaLink="false">9e1412f0-ca56-4023-bd49-3217eeebaa09</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canjurgenkloppfindsalvationinthechampionsleague-</link>
			<acast:episodeId>9e1412f0-ca56-4023-bd49-3217eeebaa09</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canjurgenkloppfindsalvationinthechampionsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRD7laZdwYs1I959ohKWBMNJzLgF/87L4BhzEQc7ic3wH/7eheogHrVnhmCBiE8ZnzUv2RKTIyarNMMITVwA/0QLbL1xRdZ0zPwwagRJ/5g4bR/uhxA/0C4h0QqH97ue7rM/wuT+jzIYYayzD7XwIp09MZ2dglMF+dho8Xbo9PdPlzs8lRkX1K7XbDZSswUyMBDLEtTQNCxVWscPzCh4rgU/8xb7RPjjHNE6Mck6DOn32xtTP1JvtvnkWo4v+xPnoz8yZmWU5b/Xtd8G2j5B3sfPG6SpCLO2JtFLvPv2K96R7]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jordan Jarrett Bryan and Richard Amofa believe Jurgen Klopp deserves to retain the faith of fans as Liverpool seek a way out of their sudden crisis. They see Manchester City and Bayern Munich as Champions League favourites, but foresee pro...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Richard Amofa believe Jurgen Klopp deserves to retain the faith of fans as Liverpool seek a way out of their sudden crisis. They see Manchester City and Bayern Munich as Champions League favourites, but foresee problems for Barcelona against PSG. The panel also call for more militant action from players, in the face of persistent abuse.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Richard Amofa believe Jurgen Klopp deserves to retain the faith of fans as Liverpool seek a way out of their sudden crisis. They see Manchester City and Bayern Munich as Champions League favourites, but foresee problems for Barcelona against PSG. The panel also call for more militant action from players, in the face of persistent abuse.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Time to remember that managers like Jurgen Klopp and Brendan Rodgers are human beings?</title>
			<itunes:title>Time to remember that managers like Jurgen Klopp and Brendan Rodgers are human beings?</itunes:title>
			<pubDate>Thu, 11 Feb 2021 15:12:07 GMT</pubDate>
			<itunes:duration>52:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/timetorememberthatmanagerslikejurgenkloppandbrendanrodgersarehumanbeings-/media.mp3" length="126820028" type="audio/mpeg"/>
			<guid isPermaLink="false">8ffdd6d2-e893-41ec-a519-366113f8ea68</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/timetorememberthatmanagerslikejurgenkloppandbrendanrodgersarehumanbeings-</link>
			<acast:episodeId>8ffdd6d2-e893-41ec-a519-366113f8ea68</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>timetorememberthatmanagerslikejurgenkloppandbrendanrodgersarehumanbeings-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRErp6qalg12aw+PjqtApzYgDviX6WIPLdMzfkobTdPtN6zOF7ZT5Yy7kXG3yoNUNT5ravUQKxR20eF1L7Uhlpt+XQXf1FuPbHPTgXdvE5+bvb3mqwAdB/eWAcf6PQuQifybinbLBJ7iuE4FxJVZLhPetBqVDjeMnZIU+C75enzrqgoqyuQPoFTRlcLSskDP3AzNEFMmpSzxdhmYrTOlltuvfaSP+RLTWOy0bOhNbOGcfCgpIibqQT0RnR5tAk3mFVWSpr8zFV61JJz6O6KNfuQOuVlD2hk/5pt73pEFzbVde]]></acast:settings>
			<itunes:subtitle><![CDATA[Description Mike Calvin, Ade Oladipo and Glenn Moore focus on Liverpool managers, past and present before they meet at Leicester on Saturday. They hail the impact&nbsp;of Raheem Sterling at Manchester City, understand the sensitivity of Gareth Bale...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Description Mike Calvin, Ade Oladipo and Glenn Moore focus on Liverpool managers, past and present before they meet at Leicester on Saturday. They hail the impact&nbsp;of Raheem Sterling at Manchester City, understand the sensitivity of Gareth Bale to potential injury, and relish Friday's night's Manchester derby in the&nbsp;WSL.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Description Mike Calvin, Ade Oladipo and Glenn Moore focus on Liverpool managers, past and present before they meet at Leicester on Saturday. They hail the impact&nbsp;of Raheem Sterling at Manchester City, understand the sensitivity of Gareth Bale to potential injury, and relish Friday's night's Manchester derby in the&nbsp;WSL.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Jose Mourinho lost without Harry Kane?</title>
			<itunes:title>Is Jose Mourinho lost without Harry Kane?</itunes:title>
			<pubDate>Mon, 08 Feb 2021 15:49:26 GMT</pubDate>
			<itunes:duration>55:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isjosemourinholostwithoutharrykane-/media.mp3" length="132105800" type="audio/mpeg"/>
			<guid isPermaLink="false">7eb212c4-267a-4071-9acd-f1af5571cfcc</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isjosemourinholostwithoutharrykane-</link>
			<acast:episodeId>7eb212c4-267a-4071-9acd-f1af5571cfcc</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isjosemourinholostwithoutharrykane-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRA2EYw0lcH1rZ0Li5SqwBUsPQP4l136svWO+P58Sab1z5MSfxrl3wP6+ohSQHzLSrQER2dW8nv8JXRwDdOm/5yAg5wiwMZ61nJt5VDjeAi9jaGwOqrUUKz14a3yLa9tr91+NjxvlY4qr9J7Fxb69V7H7g7RKIemqJQ7rvJem2nhSy1TnGw/4L07Za1dUQxF5pEIbPnl6rdd5Y59Ulrcu6AJkVUTi4PLpr5E2gpbidt1TYizGhV7ylko8OhJHM72q4l1Wez2sX0RbRgAiwJ2C/dZ6dM+tiIWo3k6mJ2qfKpf1]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor believe Jose Mourinho has a responsibility to protect Harry Kane, despite his fundamental importance to the Tottenham&nbsp;team. They won't rule out a Manchester City quadruple, but see Leicest...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor believe Jose Mourinho has a responsibility to protect Harry Kane, despite his fundamental importance to the Tottenham&nbsp;team. They won't rule out a Manchester City quadruple, but see Leicester as potential FA Cup winners, Manchester United need to give Dean Henderson a run in goal, starting with Wednesday's fifth-round tie against West Ham.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor believe Jose Mourinho has a responsibility to protect Harry Kane, despite his fundamental importance to the Tottenham&nbsp;team. They won't rule out a Manchester City quadruple, but see Leicester as potential FA Cup winners, Manchester United need to give Dean Henderson a run in goal, starting with Wednesday's fifth-round tie against West Ham.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Is Liverpool's title defence already over?]]></title>
			<itunes:title><![CDATA[Is Liverpool's title defence already over?]]></itunes:title>
			<pubDate>Thu, 04 Feb 2021 14:20:40 GMT</pubDate>
			<itunes:duration>58:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isliverpoolstitledefencealreadyover-/media.mp3" length="139245716" type="audio/mpeg"/>
			<guid isPermaLink="false">2cc1e406-8868-4973-9781-903cb6cbe2a0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isliverpoolstitledefencealreadyover-</link>
			<acast:episodeId>2cc1e406-8868-4973-9781-903cb6cbe2a0</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isliverpoolstitledefencealreadyover-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9LKQK4UFK87wMXj1OCoVmzxXEcUntcDyzh78zXWe2SWgO+mNbzYf14FDt31OTebuQSy9++gtmA57xoc5dQKnHLIjX0M2COkoaoshSDjcwFeI82t8yT1i/y9JUNHMyRvdmv/EQAqVaHC0ATRnSBamlPLtmYwIRr7aUeCeAFQGS9Nx8ydkVWsumPG2TpXyYgp8bznCbSnYmHHLFAJe4a54YRh3Grl0G7OJm7CRR+XzZ6bBNv0Vi2wyGE2ni5xvzDeo5]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Melissa Reddy and Dominic Fifield suspect Liverpool's priority will be to protect a top four place, and concentrate on the Champions League. They applaud Manchester City's relentlessness, predict Thomas Tuchel will be a success a...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Melissa Reddy and Dominic Fifield suspect Liverpool's priority will be to protect a top four place, and concentrate on the Champions League. They applaud Manchester City's relentlessness, predict Thomas Tuchel will be a success at Chelsea, and believe the current bottom three will eventually be relegated.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Melissa Reddy and Dominic Fifield suspect Liverpool's priority will be to protect a top four place, and concentrate on the Champions League. They applaud Manchester City's relentlessness, predict Thomas Tuchel will be a success at Chelsea, and believe the current bottom three will eventually be relegated.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Can Marcus Rashford lead football's fight against racial abuse?]]></title>
			<itunes:title><![CDATA[Can Marcus Rashford lead football's fight against racial abuse?]]></itunes:title>
			<pubDate>Mon, 01 Feb 2021 15:22:36 GMT</pubDate>
			<itunes:duration>58:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canmarcusrashfordleadfootballsfightagainstracialabuse-/media.mp3" length="140297024" type="audio/mpeg"/>
			<guid isPermaLink="false">666e0f64-5acb-4274-b238-376a9d8bc5da</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canmarcusrashfordleadfootballsfightagainstracialabuse-</link>
			<acast:episodeId>666e0f64-5acb-4274-b238-376a9d8bc5da</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canmarcusrashfordleadfootballsfightagainstracialabuse-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRCpkFuJQ4kP2rM2ZZ+1E6QCisOTZ9AdbzMaYUjen53C/Lf8+jIiuQp/wdHaOgURGLKJEO+YEvKMSEnjck/4eQl+demGjK5piuhSjC3x8oxBmFKi9K9i9dzD1MWCuMhlPvI6rnEbKGOAfGrxFFROiX6I08mFvWDtVxU0CKDO+T4EDp5xFQTiPBYvMbGeg9sc4oFmLbtJoVHrOZOZ2qgea324TDqLBmK17FHHcaPMsQtSVMfmoSwFJDCwmAeXH3sR7IGnAG4TUoMG8lu5FNO0S9gC6ZjxnmirholTcgWxeCKzL]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Darren Lewis and Miguel Delaney hail Marcus Rashford's influence, but feel direct action by players, and concerted pressure on social media companies, is required to combat increasing abuse. They highlight a busy week of Premier Leagu...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Miguel Delaney hail Marcus Rashford's influence, but feel direct action by players, and concerted pressure on social media companies, is required to combat increasing abuse. They highlight a busy week of Premier League action on BT Sport, hail Ruben Dias as a title-winning signing for Manchester City, and fear Fulham, WBA and Sheffield United will be relegated.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Miguel Delaney hail Marcus Rashford's influence, but feel direct action by players, and concerted pressure on social media companies, is required to combat increasing abuse. They highlight a busy week of Premier League action on BT Sport, hail Ruben Dias as a title-winning signing for Manchester City, and fear Fulham, WBA and Sheffield United will be relegated.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Thomas Tuchel the right man for Chelsea?</title>
			<itunes:title>Is Thomas Tuchel the right man for Chelsea?</itunes:title>
			<pubDate>Thu, 28 Jan 2021 15:29:17 GMT</pubDate>
			<itunes:duration>56:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthomastucheltherightmanforchelsea-/media.mp3" length="134664644" type="audio/mpeg"/>
			<guid isPermaLink="false">ee411567-1e83-42c7-bb6e-06642b723bb9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthomastucheltherightmanforchelsea-</link>
			<acast:episodeId>ee411567-1e83-42c7-bb6e-06642b723bb9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthomastucheltherightmanforchelsea-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROOKDnvDABOvTqt7JY9zMogsdCXvai77ZTkXEJTShnWDqrw5keJoPooxV73AXbEXj9a0AhkoanVF+56Ae+NxGJzbpDPG/HLsWz7go7nsrKL4Dmpz7ktq/jCVA11qQuvc3HSDxNqR3TW32RWe3U2jXEmvxB38xRvfiklfQACHrhvfl4Q2R+kSEmcbpJnAeuYHFayEv4xO1yFF/qjMEFJ7mqQhkBjaszyCDH7hsSz1IsePlfC4tsPu2DSMwp176XJqWzVfylE7NllpOnt4eSBmI5vA/ypEpFOeIx4tIxfiwPUb]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jonathan Northcroft and Art de Roche give their first impressions of Thomas Tuchel's&nbsp;Chelsea. They assess the impact of German coaches, predict this will be Pep Guardiola's greatest season, and foresee Julian Nagelsman a...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Art de Roche give their first impressions of Thomas Tuchel's&nbsp;Chelsea. They assess the impact of German coaches, predict this will be Pep Guardiola's greatest season, and foresee Julian Nagelsman as Jurgen Klopp's eventual successor at Liverpool.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Art de Roche give their first impressions of Thomas Tuchel's&nbsp;Chelsea. They assess the impact of German coaches, predict this will be Pep Guardiola's greatest season, and foresee Julian Nagelsman as Jurgen Klopp's eventual successor at Liverpool.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Did Frank Lampard deserve to be sacked by Chelsea?</title>
			<itunes:title>Did Frank Lampard deserve to be sacked by Chelsea?</itunes:title>
			<pubDate>Mon, 25 Jan 2021 15:47:40 GMT</pubDate>
			<itunes:duration>52:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/didfranklamparddeservetobesackedbychelsea-/media.mp3" length="126607052" type="audio/mpeg"/>
			<guid isPermaLink="false">be8416e6-4974-4dad-a76f-daa873301aed</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/didfranklamparddeservetobesackedbychelsea-</link>
			<acast:episodeId>be8416e6-4974-4dad-a76f-daa873301aed</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>didfranklamparddeservetobesackedbychelsea-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9F/hsDTw0UhffC7MoHueR2fzMsqMp5ldhrMlWNoPzTqXkXzkvZbYzdwSiJKA19o8rqKAIfM2XwBcfh5UECUzHkyFh08JGNZh+1v9ZLLCJKgMOapKloMCfCuvijLxdOGdr4gWLwinOdgWvpBxeWoIXVlDDrazbH02xCvYRVMomV/4kcOKZa1m/kYZX/pLAzjDHaHnBxKUflJ7MhpTh5YcoIFEV7bJHixikKmxwJFwg94a/aNe/b+SoKUpUJQQu13i2]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jordan Jarett Bryan and Seb Stafford Bloor discuss Frank Lampard's sacking, and the suitability of his anticipated replacement, Thomas Tuchel. They see Steve Bruce's dream job turning sour at Newcastle, analyse the challenge faci...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarett Bryan and Seb Stafford Bloor discuss Frank Lampard's sacking, and the suitability of his anticipated replacement, Thomas Tuchel. They see Steve Bruce's dream job turning sour at Newcastle, analyse the challenge facing Jurgen Klopp at Liverpool, and condemn&nbsp;plans for a European Super League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarett Bryan and Seb Stafford Bloor discuss Frank Lampard's sacking, and the suitability of his anticipated replacement, Thomas Tuchel. They see Steve Bruce's dream job turning sour at Newcastle, analyse the challenge facing Jurgen Klopp at Liverpool, and condemn&nbsp;plans for a European Super League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Leicester capable of fighting on three fronts?</title>
			<itunes:title>Are Leicester capable of fighting on three fronts?</itunes:title>
			<pubDate>Thu, 21 Jan 2021 14:53:33 GMT</pubDate>
			<itunes:duration>55:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/areleicestercapableoffightingonthreefronts-/media.mp3" length="132474332" type="audio/mpeg"/>
			<guid isPermaLink="false">3672e41c-86a9-4b63-98bb-62d8e9ecae96</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/areleicestercapableoffightingonthreefronts-</link>
			<acast:episodeId>3672e41c-86a9-4b63-98bb-62d8e9ecae96</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>areleicestercapableoffightingonthreefronts-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRLCSTTkmUhu28x7AvfOe0AWhAl8Xh9sR/xV1Dfj+kZBBz0UvFpOjRBpVlGYTFejPqetYkG7BN0tIKOgJQqn7RAhPkGxerp/Wn+dsbCoKidtZFXMOpuYSqz3kg4Kr4WOW6k7amunHFmWLi1ubOQZRFlzIOjzCqTtla/u2l9FxF+edW8t62/uNYwvqDPcmOuHsESHc8bB8LhTJaG7tS4BJwoJng7n6F7XVW6L9Lr5LjXK0oL1ZznJqgJODJw2tCfirNff286HTPE8mqRn9bY6E3v0=]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Anne Marie Batson and Glenn Moore believe the FA Cup is more open than ever. They highlight an important opportunity for clubs like Everton, Southampton and West Ham, but also identify Blackpool, Doncaster and Luton as potential giant kill...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Glenn Moore believe the FA Cup is more open than ever. They highlight an important opportunity for clubs like Everton, Southampton and West Ham, but also identify Blackpool, Doncaster and Luton as potential giant killers.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Glenn Moore believe the FA Cup is more open than ever. They highlight an important opportunity for clubs like Everton, Southampton and West Ham, but also identify Blackpool, Doncaster and Luton as potential giant killers.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Pep Guardiola is 50 today, Could he win both the Premier League and Champions League this season?</title>
			<itunes:title>Pep Guardiola is 50 today, Could he win both the Premier League and Champions League this season?</itunes:title>
			<pubDate>Mon, 18 Jan 2021 15:25:19 GMT</pubDate>
			<itunes:duration>56:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/pepguardiolais50today-couldhewinboththepremierleagueandchampionsleaguethisseason-/media.mp3" length="134379632" type="audio/mpeg"/>
			<guid isPermaLink="false">b949d128-e569-43f2-951d-2d8754b82eb3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/pepguardiolais50today-couldhewinboththepremierleagueandchampionsleaguethisseason-</link>
			<acast:episodeId>b949d128-e569-43f2-951d-2d8754b82eb3</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>pepguardiolais50today-couldhewinboththepremierleagueandchampionsleaguethisseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBq6WDAIIy5c9izczsZt3WWTxccU+9kTbJ8/WcBr/iG4FUaxKO6zH/hdg46Orc3d8+tekAB6PXn+X1qySGt6qOlc5KuDPWa4Nk/pIRWhAT/kY7XWOeg1XrXgHOtULMtBtb4LG+EyD0oKuF0m5CyRDRktvDnH73Q0QBGV9TZfpv1YFIpP2gACU+ZwcrGzoYuA2AxW42mKqjF0bMP86bkrZ4Pc49o/If9vKCCgnCxKJy+wTDSf5HXXaraUS6+WVs4bQDqh/G2JOYkrXDgSP6K2EKynbID8MN0xJpBoPC21gtIu]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by former players David Preece and Adrian Clarke, who foresee a special season for Manchester City. They feel it will take five years for Frank Lampard to rival Brendan Rodgers, doubt that Sam Allardyce will keep WBA up, and have ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by former players David Preece and Adrian Clarke, who foresee a special season for Manchester City. They feel it will take five years for Frank Lampard to rival Brendan Rodgers, doubt that Sam Allardyce will keep WBA up, and have mixed feelings about Wayne Rooney's move into management.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by former players David Preece and Adrian Clarke, who foresee a special season for Manchester City. They feel it will take five years for Frank Lampard to rival Brendan Rodgers, doubt that Sam Allardyce will keep WBA up, and have mixed feelings about Wayne Rooney's move into management.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Manchester United contenders or pretenders?</title>
			<itunes:title>Are Manchester United contenders or pretenders?</itunes:title>
			<pubDate>Thu, 14 Jan 2021 14:45:51 GMT</pubDate>
			<itunes:duration>59:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/aremanchesterunitedcontendersorpretenders-/media.mp3" length="143372648" type="audio/mpeg"/>
			<guid isPermaLink="false">98326000-261e-40cb-a733-173bdbc05ff4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/aremanchesterunitedcontendersorpretenders-</link>
			<acast:episodeId>98326000-261e-40cb-a733-173bdbc05ff4</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>aremanchesterunitedcontendersorpretenders-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRHvExrgJ62u1YZvLXa3UF/J9SUEicT3tfsXmzjuneGbAZtVIPSaT3hChaKvjntjR+VU+3JuQzlmZ2NAME2+Nbjl1mtha6EO7Wl3hmJ9Vkzlqq8fdp+Vr5RIu0AhuNLgGc0nIuZQGzaEiEl6oGs+BEGTATXRJL4SgmPX5hcCkNAkDn1EqisiPcI4HF7Cj4DVKQ2dgkMS9gV0wa14i8qXEmpz03G4t/LaO6M9PynE/RZGPUwOQQ2lUmevWL0kHh1XnP9xBEhtGRXxxtbV6Dxc9wEP72BSde8boymolPJgj5npC]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Dominic Fifield assess the title race as Manchester United face a pivotal game at Anfield. They discuss whether Liverpool's trophy window is closing, how Phil Foden symbolises Manchester City's developmen...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Dominic Fifield assess the title race as Manchester United face a pivotal game at Anfield. They discuss whether Liverpool's trophy window is closing, how Phil Foden symbolises Manchester City's development, and if Jose Mourinho is his own worst enemy, Plus : is football's "no-hug" protocol realistic?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Dominic Fifield assess the title race as Manchester United face a pivotal game at Anfield. They discuss whether Liverpool's trophy window is closing, how Phil Foden symbolises Manchester City's development, and if Jose Mourinho is his own worst enemy, Plus : is football's "no-hug" protocol realistic?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>How should football respond to the Covid crisis?</title>
			<itunes:title>How should football respond to the Covid crisis?</itunes:title>
			<pubDate>Mon, 11 Jan 2021 15:40:11 GMT</pubDate>
			<itunes:duration>50:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/howshouldfootballrespondtothecovidcrisis-/media.mp3" length="121525904" type="audio/mpeg"/>
			<guid isPermaLink="false">c23c8277-6cd3-46dc-a3e6-c10864cd542c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/howshouldfootballrespondtothecovidcrisis-</link>
			<acast:episodeId>c23c8277-6cd3-46dc-a3e6-c10864cd542c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>howshouldfootballrespondtothecovidcrisis-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRGs9u3fxK4Ny7jLrLmleKGsYLMbG2Oy3atla7YBG3yfZddFs1UnWo0HrxMhLWiCRztYjapnuNFvoEO3v+TNx4BG3EcpQo7iNtdrfQEvyH+7r80pCMfRcdAewKvtyEK1qo4owgJ2SdG/jKSGIosGsa+kr5mxjH+daJZNbXKAaTuMooCZtemAiS+F5Gp4wsTuAHOBQ2BX8+bSYl356GvTGvxNeI5SFxD/OrMJs1LwIofRcC/ISxQ4B/fF5qp2yNA8wnf/voxexqFvIIhm/AhcWmzb3xZfgStPHAlpfBmn6HsNv]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Miguel Delaney and&nbsp;Glenn Moore believe,on balance, the football season should continue,but that the calendar is unsustainable. They disagree about the merits of the FA Cup, but are unanimous in suggesting that the European Champio...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and&nbsp;Glenn Moore believe,on balance, the football season should continue,but that the calendar is unsustainable. They disagree about the merits of the FA Cup, but are unanimous in suggesting that the European Championships should be postponed. In domestic terms, Manchester City are emerging as potential champions.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and&nbsp;Glenn Moore believe,on balance, the football season should continue,but that the calendar is unsustainable. They disagree about the merits of the FA Cup, but are unanimous in suggesting that the European Championships should be postponed. In domestic terms, Manchester City are emerging as potential champions.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Liverpool reboot their season in the FA Cup?</title>
			<itunes:title>Will Liverpool reboot their season in the FA Cup?</itunes:title>
			<pubDate>Thu, 07 Jan 2021 15:05:57 GMT</pubDate>
			<itunes:duration>52:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willliverpoolreboottheirseasoninthefacup-/media.mp3" length="125059844" type="audio/mpeg"/>
			<guid isPermaLink="false">8f1fc385-4261-478f-85a0-3e3bf8d129b5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willliverpoolreboottheirseasoninthefacup-</link>
			<acast:episodeId>8f1fc385-4261-478f-85a0-3e3bf8d129b5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willliverpoolreboottheirseasoninthefacup-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREYxljyTXmfn+8/AhQC01KdKcMraVRLrx8H8kvJxmTt0QYkWAHQF9aE4H5BlKEbbJmc0G4Dbyeqop4TrW+Jv0Ibt6/T5QUPqxj12fQJ7nDlaM7bVxXC4xPm/Dt8oDawhbHXDFBYogoOMaB/tZyCcFuSmRuKMjKYI8McxUDX8JVq9FrwVhbMOkZx16jXsEDuy++nmRR0JzzX2RkKM3TOrrrU5z5dnYSTnGjHJK8WKznPV0h1I68+Tpl5i2wPHzvggwDrbOdz3R+h/YZSFGVBk995ukMvJGBxBvbGZrScOL1vY]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Melissa Reddy and David Preece consider Jurgen Klopp's options before Friday's televised third-round tie against Aston Villa. They highlight Spurs and Everton as potential FA Cup winners, but foresee problems for Brighton at Newp...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Melissa Reddy and David Preece consider Jurgen Klopp's options before Friday's televised third-round tie against Aston Villa. They highlight Spurs and Everton as potential FA Cup winners, but foresee problems for Brighton at Newport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Melissa Reddy and David Preece consider Jurgen Klopp's options before Friday's televised third-round tie against Aston Villa. They highlight Spurs and Everton as potential FA Cup winners, but foresee problems for Brighton at Newport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Frank Lampard get the time he needs at Chelsea?</title>
			<itunes:title>Will Frank Lampard get the time he needs at Chelsea?</itunes:title>
			<pubDate>Mon, 04 Jan 2021 15:47:19 GMT</pubDate>
			<itunes:duration>55:01</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willfranklampardgetthetimeheneedsatchelsea-/media.mp3" length="131930408" type="audio/mpeg"/>
			<guid isPermaLink="false">2b09ce5b-29bc-464f-9442-9d5513cc9b4f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willfranklampardgetthetimeheneedsatchelsea-</link>
			<acast:episodeId>2b09ce5b-29bc-464f-9442-9d5513cc9b4f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willfranklampardgetthetimeheneedsatchelsea-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9QZjqprK+unJSkpW0Md0YgYo4sI6PtahvyTJrz0ImOwggsd0kw4rCs4mzfHj3QAPkEbyX5ri5oOwcpGPgGTURnq7qkoOd22LVAXKTp118i7jnda26bC2rwrbworU43kHFo8Pl98cR2b5mL3UeF/UFcDuwsmgP5BN7qe88dY24g3yA9vTKgylyqcFL8W5J1b0Hq0LyzELkiJXZUUClgLlvXDY2ysUGX8tSB6HanUTkR2ftkO6oC8KxtYHFy0Mxiv5P]]></acast:settings>
			<itunes:subtitle><![CDATA[In this, the 300th episode, Mike Calvin is joined by John Cross and Seb Stafford Bloor. They discuss the pressure on Frank Lampard, dwell on Manchester City's title chances, but criticise Pep Guardiola's defence of Benjamin Mendy. They also f...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[In this, the 300th episode, Mike Calvin is joined by John Cross and Seb Stafford Bloor. They discuss the pressure on Frank Lampard, dwell on Manchester City's title chances, but criticise Pep Guardiola's defence of Benjamin Mendy. They also focus on Manchester United, Spurs, Arsenal, and football's issues with social media abuse.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[In this, the 300th episode, Mike Calvin is joined by John Cross and Seb Stafford Bloor. They discuss the pressure on Frank Lampard, dwell on Manchester City's title chances, but criticise Pep Guardiola's defence of Benjamin Mendy. They also focus on Manchester United, Spurs, Arsenal, and football's issues with social media abuse.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who were the winners and losers in 2020?</title>
			<itunes:title>Who were the winners and losers in 2020?</itunes:title>
			<pubDate>Mon, 28 Dec 2020 09:00:00 GMT</pubDate>
			<itunes:duration>36:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whowerethewinnersandlosersin2020-/media.mp3" length="86849444" type="audio/mpeg"/>
			<guid isPermaLink="false">499c7211-e99d-4ceb-8c1b-ec9c5dead426</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whowerethewinnersandlosersin2020-</link>
			<acast:episodeId>499c7211-e99d-4ceb-8c1b-ec9c5dead426</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whowerethewinnersandlosersin2020-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9q7Nal+CfUQZvqvx6Yz19mjOv+Ir7GR1qQ2uh2zZ7Y8V9zStrZmM0gqROUnKLOfZun0SKleDJeNOT3v+dRGAiK6A8ixQQ2Q3NnIwz0IO7HdrmLUzouoe/uP5MwfMtGKxRQvflwoOX9MWJTC4ku7HW5soLZjQqcSMgVFDtFqeM0MnKFRC4hmWfiVAsoQ5iJ2SlCER2MT9jhEsSgLzYJT2xRDBnHDPAigsUo4//f2AmRORBPBLgDTbKpOslYiWpvVbj]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and Darren Lewis review football in 2020. They reveal their choices of player, young player and breakthrough player of the year, They also talk about memorable matches, the biggest disappointments, and the one thing in ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Darren Lewis review football in 2020. They reveal their choices of player, young player and breakthrough player of the year, They also talk about memorable matches, the biggest disappointments, and the one thing in the&nbsp;game they would happily consign to the dustbin of history.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Darren Lewis review football in 2020. They reveal their choices of player, young player and breakthrough player of the year, They also talk about memorable matches, the biggest disappointments, and the one thing in the&nbsp;game they would happily consign to the dustbin of history.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Manchester United challenge Liverpool for the title?</title>
			<itunes:title>Can Manchester United challenge Liverpool for the title?</itunes:title>
			<pubDate>Mon, 21 Dec 2020 16:08:02 GMT</pubDate>
			<itunes:duration>42:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canmanchesterunitedchallengeliverpoolforthetitle-/media.mp3" length="101509292" type="audio/mpeg"/>
			<guid isPermaLink="false">aae3cff3-2ebb-4bd2-b51b-de8e63c9b339</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canmanchesterunitedchallengeliverpoolforthetitle-</link>
			<acast:episodeId>aae3cff3-2ebb-4bd2-b51b-de8e63c9b339</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canmanchesterunitedchallengeliverpoolforthetitle-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz907Tuq3nZ61sHOiReeaybAEHb/kOX/GXmycP0DXE1eLrPpR3W+aVoUqXmkyR9N3Yr/otRpO4EfMBDaSHtL/Pkuatz26yeKAXcZZjsN7fVgwGegiqvpqZPDF1La8ucQwOWL7OUvdPB3AlMv+DC4LJWsYx0HUT+E2eUe6i+g1Csbi2Ov5wsdnTo7yR+EHKkVX4NpcNptKH371QeuFbZb7NmLQaxvkw3JKHP77qJmWkpEpOGaqVSEQadVX3QzCOUffMG]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Darren Lewis and Jonathan Northcroft assess a title race that's suddenly at sixes and sevens, They caution against writing off Spurs, expect Manchester City to move for Erland Haaland, and fear for the future of Mikel Arteta.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Jonathan Northcroft assess a title race that's suddenly at sixes and sevens, They caution against writing off Spurs, expect Manchester City to move for Erland Haaland, and fear for the future of Mikel Arteta.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Jonathan Northcroft assess a title race that's suddenly at sixes and sevens, They caution against writing off Spurs, expect Manchester City to move for Erland Haaland, and fear for the future of Mikel Arteta.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Will Liverpool's mentality monsters retain the Premier League title?]]></title>
			<itunes:title><![CDATA[Will Liverpool's mentality monsters retain the Premier League title?]]></itunes:title>
			<pubDate>Thu, 17 Dec 2020 15:23:29 GMT</pubDate>
			<itunes:duration>53:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willliverpoolsmentalitymonstersretainthepremierleaguetitle-/media.mp3" length="127806608" type="audio/mpeg"/>
			<guid isPermaLink="false">2842a59b-f236-43b0-917d-c0f34d347ad8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willliverpoolsmentalitymonstersretainthepremierleaguetitle-</link>
			<acast:episodeId>2842a59b-f236-43b0-917d-c0f34d347ad8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willliverpoolsmentalitymonstersretainthepremierleaguetitle-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRLiUx1ZV+Ecn7KVVfD8uZpOvxboybqYo4mAP+AxErQFkTZex6IVj79Y9M/kkJ6YkSL7dOBN3w0o1QToHWZmyMHvXBkd+gzTqQ/5OS36ug/goNJqmhl8wy0mklyMEUrrpjQifQptM5ec4vRwrhJPA+jMZpWdt/QK5rKTnHp3bMyDIsk+4BJYJJkEMmg5OSxsTOqueQH7/ahFCtxQmgtWjqtXdILLOTNCvDftt22sWglmnzqKedMxIoJJaEx2bAR/qzeYyduiAzAe0yd6EUNCGQrWX7/NGhVLbsgmgMIYFBH3h]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Ade Oladipo and Richard Amofa consider the significance of the champions' consistency and character. They defend Jose Mourinho from charges that he employs anti-football tactics, but suggest WBA would have been better retaining Slaven...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Ade Oladipo and Richard Amofa consider the significance of the champions' consistency and character. They defend Jose Mourinho from charges that he employs anti-football tactics, but suggest WBA would have been better retaining Slaven Bilic, instead of bringing in Sam Allardyce.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Ade Oladipo and Richard Amofa consider the significance of the champions' consistency and character. They defend Jose Mourinho from charges that he employs anti-football tactics, but suggest WBA would have been better retaining Slaven Bilic, instead of bringing in Sam Allardyce.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can all three English teams reach the last eight of the Champions League?</title>
			<itunes:title>Can all three English teams reach the last eight of the Champions League?</itunes:title>
			<pubDate>Mon, 14 Dec 2020 17:19:09 GMT</pubDate>
			<itunes:duration>54:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canallthreeenglishteamsreachthelasteightofthechampionsleague-/media.mp3" length="130861352" type="audio/mpeg"/>
			<guid isPermaLink="false">e40f559b-8a00-4c92-b206-e8a4f5e90399</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canallthreeenglishteamsreachthelasteightofthechampionsleague-</link>
			<acast:episodeId>e40f559b-8a00-4c92-b206-e8a4f5e90399</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canallthreeenglishteamsreachthelasteightofthechampionsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9bQXwPqvOcNqSoJ1airu85rZbX1RcdItMfr1kWmAvFGdBYM1vva8/3UkDMja42pgeUoywG1y0hRbtZGXtzSEwpApNbJFdg+EE7XEVF5+CNDDrCVSP7pxyMtcbYjiw5QA9qpLF9rSES02elT9D9w1McFMFraLsgRKurtaHvPGmDdbk/znKUTnXPPesi3DDemTISV99FekkXCC/nNFSE2uEl3K9d9hoQQRZri2b8IAIHbo0xwg9SUhT66aSWQaJSdJf]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jordan Jarrett Bryan and Dominic Fifield assess the European draws. They foresee few problems for Liverpool and Manchester City in the Champions League and relish a return to Chelsea by Diego Costa. They predict more pain for Arsenal and M...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Dominic Fifield assess the European draws. They foresee few problems for Liverpool and Manchester City in the Champions League and relish a return to Chelsea by Diego Costa. They predict more pain for Arsenal and Manchester United, this time in the Europa League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Dominic Fifield assess the European draws. They foresee few problems for Liverpool and Manchester City in the Champions League and relish a return to Chelsea by Diego Costa. They predict more pain for Arsenal and Manchester United, this time in the Europa League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Which club is in greatest crisis, Manchester United or Arsenal?</title>
			<itunes:title>Which club is in greatest crisis, Manchester United or Arsenal?</itunes:title>
			<pubDate>Wed, 09 Dec 2020 15:36:21 GMT</pubDate>
			<itunes:duration>53:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whichclubisingreatestcrisis-manchesterunitedorarsenal-/media.mp3" length="127599896" type="audio/mpeg"/>
			<guid isPermaLink="false">68aeb5a9-040f-4fad-bb62-63a0ad993a48</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whichclubisingreatestcrisis-manchesterunitedorarsenal-</link>
			<acast:episodeId>68aeb5a9-040f-4fad-bb62-63a0ad993a48</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whichclubisingreatestcrisis-manchesterunitedorarsenal-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBrnw5Ic7b0TEzcLRiIGcmWAOHUo8jIxH0VkHZPh+QO85WgJhl6JpT5UOpmqtKT/RL4uAifUdcU7+GFqaax0MRuL+4UXz4LXOBX7AcBYgSsQy25HUF26vdvptqAkiYHLq2vQsezRX5cfX54p4UNq8o39KzSFGLdlm9Jj4Tyag2h3jhCekDMsrwtMgXJ4OScIDLIcGBndQrhcM6FNMnUc3Hah7eVOjpbZ4UIExhMbntGwlKpVQRRXktun4liaDqzWjrCH8IwyZbxdV9hhNBSIni1gHFyKM9QOxDhVMj0QEfmK]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Art de Roche and Jonathan Northcroft discuss deep problems facing Manchester United and Arsenal. They call for greater leadership from the football authorities on the issue of racial, and dwell on the lessons of Jean Marc Bosman, whose pli...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Art de Roche and Jonathan Northcroft discuss deep problems facing Manchester United and Arsenal. They call for greater leadership from the football authorities on the issue of racial, and dwell on the lessons of Jean Marc Bosman, whose plight is featured in a BT Sport documentary.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Art de Roche and Jonathan Northcroft discuss deep problems facing Manchester United and Arsenal. They call for greater leadership from the football authorities on the issue of racial, and dwell on the lessons of Jean Marc Bosman, whose plight is featured in a BT Sport documentary.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>What can Manchester United learn from Liverpool?</title>
			<itunes:title>What can Manchester United learn from Liverpool?</itunes:title>
			<pubDate>Mon, 07 Dec 2020 15:17:05 GMT</pubDate>
			<itunes:duration>1:02:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatcanmanchesterunitedlearnfromliverpool-/media.mp3" length="149742092" type="audio/mpeg"/>
			<guid isPermaLink="false">d8aaa3a3-012c-4ad4-a3e5-6f6fc4eeffeb</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatcanmanchesterunitedlearnfromliverpool-</link>
			<acast:episodeId>d8aaa3a3-012c-4ad4-a3e5-6f6fc4eeffeb</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatcanmanchesterunitedlearnfromliverpool-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREoBjCJAlK4E7Sk9RdQtlLtPiuTBu7FJtIxdGysylJ4SQDzQ2Ov53oDnQtyI4SEPRVEnL+O1jcTQfGqdYaDZvjjMUSQJ+kz621lCzGBDhIQ4Uil75VsGwFKofsaeDWCmJOMUKsuEONkGfTQOkdRgDX8x3CrRAaL39P/ZxN2gusZU6MqLdby/OzljXf2IU8U4ZJ5tg3MOVkxZfvlRDVe/rnRnLWsJjU0hysY2TBxS30nbO6DllgsUTf+oyecSA1PrAfNAVZ352GUeQ7XFNFyKktqjzX9x8D4HSP/aPq7i+1w3]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Melissa Reddy and Anne Marie Batson preview another critical week for Manchester United. They assess what lessons Liverpool give them, and consider the title potential of Tottenham and Chelsea, before having a powerful discussion about rac...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Melissa Reddy and Anne Marie Batson preview another critical week for Manchester United. They assess what lessons Liverpool give them, and consider the title potential of Tottenham and Chelsea, before having a powerful discussion about racism in football and society.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Melissa Reddy and Anne Marie Batson preview another critical week for Manchester United. They assess what lessons Liverpool give them, and consider the title potential of Tottenham and Chelsea, before having a powerful discussion about racism in football and society.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Who's the best, Lionel Messi or Cristiano Ronaldo?]]></title>
			<itunes:title><![CDATA[Who's the best, Lionel Messi or Cristiano Ronaldo?]]></itunes:title>
			<pubDate>Sun, 06 Dec 2020 09:00:00 GMT</pubDate>
			<itunes:duration>35:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whosthebest-lionelmessiorcristianoronaldo-/media.mp3" length="85418120" type="audio/mpeg"/>
			<guid isPermaLink="false">0d38d3eb-0f63-4fcb-8966-328d64eda1ce</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whosthebest-lionelmessiorcristianoronaldo-</link>
			<acast:episodeId>0d38d3eb-0f63-4fcb-8966-328d64eda1ce</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whosthebest-lionelmessiorcristianoronaldo-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9BuGl48OAvS9jSuco2zXsat5LRp4HyLA6Nt6Yj9lzi5F0xu3X/w3KahdofZXA/3JYNulUtyXp7AylwsS7jieBCYWwY+f8XOFfvUmYlPZFPtIpOhIHCNE+S4fq77y2tAhNfbQGKR3LOLxY8GWpbiAcKTXkmXHogeANjINJDOe1xQfCP/ZDSjTowp7M/bY7Pao9c7sJFVdpS7yNy0zoAdmfY+xd1/oX0q85xWUzeG5+aUd963PXe5MlKGU8V47RTL8Q]]></acast:settings>
			<itunes:subtitle><![CDATA[Lionel Messi and Cristiano Ronaldo are due to face one another, for possibly the&nbsp;final time, on Dec 8. Mike Calvin is joined by Miguel Delaney and Adrian Clarke to decide which of the two icons of modern football is the&nbsp;best.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Lionel Messi and Cristiano Ronaldo are due to face one another, for possibly the&nbsp;final time, on Dec 8. Mike Calvin is joined by Miguel Delaney and Adrian Clarke to decide which of the two icons of modern football is the&nbsp;best.</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Lionel Messi and Cristiano Ronaldo are due to face one another, for possibly the&nbsp;final time, on Dec 8. Mike Calvin is joined by Miguel Delaney and Adrian Clarke to decide which of the two icons of modern football is the&nbsp;best.</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has football got the will to tackle two of its biggest problems, dementia and racism?</title>
			<itunes:title>Has football got the will to tackle two of its biggest problems, dementia and racism?</itunes:title>
			<pubDate>Mon, 30 Nov 2020 16:13:44 GMT</pubDate>
			<itunes:duration>1:03:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hasfootballgotthewilltotackletwoofitsbiggestproblems-dementiaandracism-/media.mp3" length="152409512" type="audio/mpeg"/>
			<guid isPermaLink="false">ef4e6d3e-b4b3-43a2-83ff-ae5ff94606cf</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hasfootballgotthewilltotackletwoofitsbiggestproblems-dementiaandracism-</link>
			<acast:episodeId>ef4e6d3e-b4b3-43a2-83ff-ae5ff94606cf</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hasfootballgotthewilltotackletwoofitsbiggestproblems-dementiaandracism-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRK7mQf24Cv3PWUFVSLL7CBjItDv4BaGLeWkCI/WReOu3347aDPaVUfpvAYTaGvYiVAkB8J08+StKJgMroSCFwc4zth0DwrjqN9AS9SiJzbOttaRcZ803P9CYVxbEnu5ItMefXFHxzWnCiXOGKxNdF1o3le50zhfYA7nooXM9N/UKRDDKgMilJoj9r8pAP3KYeMWL16GPaHoKp7VAVRSACrKqJIMhTNe7Cl6PrhL3x5IcasRTOMikzoeQL9e33wQE9fox+/F35cGnCnJH+9bBaPFrVM6g2fldA7z/eMtNAA86]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, John Cross and Jordan Jarrett Bryan are joined by Anton Ferdinand in a special edition of the Football Writers' podcast. They discuss Anton's documentary about racism in the game, and respond to the worrying news that Raul Jimine...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Jordan Jarrett Bryan are joined by Anton Ferdinand in a special edition of the Football Writers' podcast. They discuss Anton's documentary about racism in the game, and respond to the worrying news that Raul Jiminez has fractured his skull. Will football fulfil its duty of care?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Jordan Jarrett Bryan are joined by Anton Ferdinand in a special edition of the Football Writers' podcast. They discuss Anton's documentary about racism in the game, and respond to the worrying news that Raul Jiminez has fractured his skull. Will football fulfil its duty of care?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Does Diego Maradona deserve to be remembered as The Greatest?</title>
			<itunes:title>Does Diego Maradona deserve to be remembered as The Greatest?</itunes:title>
			<pubDate>Thu, 26 Nov 2020 15:52:45 GMT</pubDate>
			<itunes:duration>56:29</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/doesdiegomaradonadeservetoberememberedasthegreatest-/media.mp3" length="135470612" type="audio/mpeg"/>
			<guid isPermaLink="false">b0aaa6f0-be6c-4834-8032-3177a37ac77e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/doesdiegomaradonadeservetoberememberedasthegreatest-</link>
			<acast:episodeId>b0aaa6f0-be6c-4834-8032-3177a37ac77e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>doesdiegomaradonadeservetoberememberedasthegreatest-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9dxXKGIyASupMuyBjYQz4BAOHbqi8G/sUzjFgMbtfq7GLC5580sparKOLZVxQ1IrlYULvrdXIKux7LLgbfoPAJBQW69EdgW/+xO3oU88V8u2zBkbEVmCfJ2F8Z7p59UVgj5Qbujjzmqz4O3UqIviLOdj3giGIuy3e5KKLcTWYuNHsCkojaxWrM4F/svR1kHqUOYfii9khinEOFUsOm7Z1aOwe4vzT/bUCUSHlaGqqhh35OGtevVf4FAQLGurcd464]]></acast:settings>
			<itunes:subtitle>Mike Calvin, who covered the Hand of God game in Mexico in 1986, is joined by Miguel Delaney, Glenn Moore and Ade Oladipo in a special edition, commemorating the life and times of Diego Maradona. They reflect on his genius, consider how he would fare i...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, who covered the Hand of God game in Mexico in 1986, is joined by Miguel Delaney, Glenn Moore and Ade Oladipo in a special edition, commemorating the life and times of Diego Maradona. They reflect on his genius, consider how he would fare in the modern game, and name their choices as the greatest footballer of all time.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, who covered the Hand of God game in Mexico in 1986, is joined by Miguel Delaney, Glenn Moore and Ade Oladipo in a special edition, commemorating the life and times of Diego Maradona. They reflect on his genius, consider how he would fare in the modern game, and name their choices as the greatest footballer of all time.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Jose Mourinho teach Jurgen Klopp a trick or two this season?</title>
			<itunes:title>Will Jose Mourinho teach Jurgen Klopp a trick or two this season?</itunes:title>
			<pubDate>Mon, 23 Nov 2020 15:15:28 GMT</pubDate>
			<itunes:duration>52:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willjosemourinhoteachjurgenkloppatrickortwothisseason-/media.mp3" length="125478488" type="audio/mpeg"/>
			<guid isPermaLink="false">e8781f88-cc49-4be8-bfb2-afbf99d20e56</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willjosemourinhoteachjurgenkloppatrickortwothisseason-</link>
			<acast:episodeId>e8781f88-cc49-4be8-bfb2-afbf99d20e56</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willjosemourinhoteachjurgenkloppatrickortwothisseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9OePHH5O8GJ5GdcIFX7pYXtYOLt+MuKhLznpF2auPGkM4SMzvjlathXxDSNk9vHNPCiQKn3Y4S+tymrJb5RZ0Pev+Xb6aFy4/t+daT39xP5CE8AU+1kCWGpv3XWEO59KKMAwAczoFCTHxq31tA7RLn//4Q0QSV3vCVP72/mlptJqklFjYN+cu/algrRFvXCB0+sR8eFBtQGejWsO6rj86Mt8GDN2XwkIoQ7JwM4LeMTO3gc+IV2DmMJkd7jPIm0k6]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Darren Lewis and Art de Roche weigh up the managerial reputations of Jose Mourinho and Jurgen Klopp. They see Chelsea as title challengers, believe Lionel Messi is an avoidable distraction for Manchester City, and draw parallels&nbsp;b...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Art de Roche weigh up the managerial reputations of Jose Mourinho and Jurgen Klopp. They see Chelsea as title challengers, believe Lionel Messi is an avoidable distraction for Manchester City, and draw parallels&nbsp;between goalscoring problems suffered by Manchester United and Arsenal.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Art de Roche weigh up the managerial reputations of Jose Mourinho and Jurgen Klopp. They see Chelsea as title challengers, believe Lionel Messi is an avoidable distraction for Manchester City, and draw parallels&nbsp;between goalscoring problems suffered by Manchester United and Arsenal.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who will prevail in the grind of this, the hardest season?</title>
			<itunes:title>Who will prevail in the grind of this, the hardest season?</itunes:title>
			<pubDate>Thu, 19 Nov 2020 15:09:08 GMT</pubDate>
			<itunes:duration>51:31</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whowillprevailinthegrindofthis-thehardestseason-/media.mp3" length="123546044" type="audio/mpeg"/>
			<guid isPermaLink="false">e09cce4b-046f-4b02-b1e6-be4d70ec65cb</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whowillprevailinthegrindofthis-thehardestseason-</link>
			<acast:episodeId>e09cce4b-046f-4b02-b1e6-be4d70ec65cb</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whowillprevailinthegrindofthis-thehardestseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRM1Zhwr0669qOBL+1YgteFO4lJWAccNfBF6OScIo+9dpFEPheTkEsSg8ad9yuDoy2Nqb+Df+BcyHTj2Qk8BZrXQJLLIHLhjvSSUXr0q8JRDyAHkcxlORej6LNvQt/Y2uMqvLAZF+ibkxo6Pqt9Z12/CSr2eugxb2EXnr2315SSp4aG/Z57O13yJ+/S3Q9FC+9owx5BDSaWt+oD0Fa6jt5LmvL69M/QQrqA/9cXIbDBeuLa5OzpgtAMIDdxDJ8PoM21ZAlIW1H2UmxokQ67uNjUw28k4j6asrRhqTVtLlARSm]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Miguel Delaney and Dominic Fifield analyse Liverpool's capacity to overcome injuries and infections. They praise Brendan Rodgers, dwell on the promise of Mason Mount and look forward to the measured return of crowds. Speaking before n...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Dominic Fifield analyse Liverpool's capacity to overcome injuries and infections. They praise Brendan Rodgers, dwell on the promise of Mason Mount and look forward to the measured return of crowds. Speaking before news of Pep Guardiola's new City contract, they also examine the challenges facing the Manchester clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Dominic Fifield analyse Liverpool's capacity to overcome injuries and infections. They praise Brendan Rodgers, dwell on the promise of Mason Mount and look forward to the measured return of crowds. Speaking before news of Pep Guardiola's new City contract, they also examine the challenges facing the Manchester clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will the season be decided by the extreme demands on players?</title>
			<itunes:title>Will the season be decided by the extreme demands on players?</itunes:title>
			<pubDate>Mon, 16 Nov 2020 15:42:27 GMT</pubDate>
			<itunes:duration>51:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willtheseasonbedecidedbytheextremedemandsonplayers-/media.mp3" length="123053276" type="audio/mpeg"/>
			<guid isPermaLink="false">14300157-92b3-41ec-94f6-9060a5a90ae9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willtheseasonbedecidedbytheextremedemandsonplayers-</link>
			<acast:episodeId>14300157-92b3-41ec-94f6-9060a5a90ae9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willtheseasonbedecidedbytheextremedemandsonplayers-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPOpDV3L2V8JuxBzAWA5b63e9xNRB/yqLHSDpQjYCgfYWfTjFclvgQY6S4aXNOzKjWF1SIXdzDv4D68Bl4xikjyLdJK4z+Cbn6e7SBSFJmnza+3zh+wTY3YrMKCrN3r7L7cpUUta7tSMrBEEdmi8WARXQJUkfxO2KEbQBf0AZOSiEXmPckGIP8qG3oPuCH9S9J2dlJL7MRyvDDxTf7SzwN8wMDXbXI3dMXb52uvKzoceUQVS06e1p4lWzp0LpZd2hAnXocqCJMcRhaUD6SGGQY0=]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Glenn Moore and Richard Amofa analyse the&nbsp;consequences of a crowded season. They hail women's football&nbsp;weekend, envisage Arsene Wenger as FA chairman, and predict a revolution in recruitment.&nbsp;]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Glenn Moore and Richard Amofa analyse the&nbsp;consequences of a crowded season. They hail women's football&nbsp;weekend, envisage Arsene Wenger as FA chairman, and predict a revolution in recruitment.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Glenn Moore and Richard Amofa analyse the&nbsp;consequences of a crowded season. They hail women's football&nbsp;weekend, envisage Arsene Wenger as FA chairman, and predict a revolution in recruitment.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Leicester shock the football world once more?</title>
			<itunes:title>Can Leicester shock the football world once more?</itunes:title>
			<pubDate>Mon, 09 Nov 2020 16:11:24 GMT</pubDate>
			<itunes:duration>53:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canleicestershockthefootballworldoncemore-/media.mp3" length="127600940" type="audio/mpeg"/>
			<guid isPermaLink="false">fbde0f05-6a5a-4ce2-a55d-0cc0611749c6</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canleicestershockthefootballworldoncemore-</link>
			<acast:episodeId>fbde0f05-6a5a-4ce2-a55d-0cc0611749c6</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canleicestershockthefootballworldoncemore-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9oAyxL6jCio2f5xFg9ows6GMN4IdXIeXDBAy3i3aPtnG/t4rydkLJ7aeu4GiWW/8FnWhgRQ7/zEMOLHrP37H9yFZVNe21cB5vnS5zCAVo5RrJ59xt7y1Gt2t9z8BUVKJxkQesaV/kM/R5GKd0mKeBQm5mOEcGYfFUTZalG0leABCXIVLY7+1UdEV3Blqg16T+DKjEwo5ML7exsTw+JuFBaUGl3XOB/kHr3CNzCsOeOr7EdhvTckRsXZ6pFnoltTmp]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Anne Marie Batson and Dominic Fifield assess Leicester's chances of repeating their 2016 title triumph. They suspect Liverpool and Manchester City will reassert themselves, but praise the progress made by Southampton, Spurs and Chelse...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Dominic Fifield assess Leicester's chances of repeating their 2016 title triumph. They suspect Liverpool and Manchester City will reassert themselves, but praise the progress made by Southampton, Spurs and Chelsea. International football, though, is becoming&nbsp;difficult to justify.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Dominic Fifield assess Leicester's chances of repeating their 2016 title triumph. They suspect Liverpool and Manchester City will reassert themselves, but praise the progress made by Southampton, Spurs and Chelsea. International football, though, is becoming&nbsp;difficult to justify.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Liverpool capable of becoming consistent champions?</title>
			<itunes:title>Are Liverpool capable of becoming consistent champions?</itunes:title>
			<pubDate>Thu, 05 Nov 2020 15:30:56 GMT</pubDate>
			<itunes:duration>49:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/areliverpoolcapableofbecomingconsistentchampions-/media.mp3" length="119774072" type="audio/mpeg"/>
			<guid isPermaLink="false">17fe9dff-a000-4eb1-a9ac-936f1d7bce30</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/areliverpoolcapableofbecomingconsistentchampions-</link>
			<acast:episodeId>17fe9dff-a000-4eb1-a9ac-936f1d7bce30</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>areliverpoolcapableofbecomingconsistentchampions-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRKugClaqbaaDR+yNx5jOztTcPnjj0fZvyQnT6mPMmys8NY0DIm/UsQ0R6kN4Uf+4UuNdaRWqJwOv7RQaUSlsXnsOl86cIIbLNYwqMDibxH2Pnpc9uSTWPLkzg6hqQIOnjQX4QvvyO/TS7JrSc6Rzu9xT/z0FMUAP2N8sG6EIUuwjOb4s8Vw8j14qjtYAgY0n2kd6OHbpVxMsig81SSRe0cdlan17T8RSzbPBEw4uG9/4rMxvu+t6H2q05ZhSInH1cBhN39bNpdlWpNJugXbsfr+JRlCbESKpZ9+hqDhHbBLp]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Jordan Jarrett Bryan believe Liverpool have&nbsp;the ingredients required to develop a dynasty. They predict Everton will add to deep-seated problems at Manchester United, suggest Chelsea are coming together quickly, ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Jordan Jarrett Bryan believe Liverpool have&nbsp;the ingredients required to develop a dynasty. They predict Everton will add to deep-seated problems at Manchester United, suggest Chelsea are coming together quickly, and feel Arsenal could make the top three.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Jordan Jarrett Bryan believe Liverpool have&nbsp;the ingredients required to develop a dynasty. They predict Everton will add to deep-seated problems at Manchester United, suggest Chelsea are coming together quickly, and feel Arsenal could make the top three.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Chelsea capable of winning the Premier League this season?</title>
			<itunes:title>Are Chelsea capable of winning the Premier League this season?</itunes:title>
			<pubDate>Mon, 02 Nov 2020 15:18:42 GMT</pubDate>
			<itunes:duration>51:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/arechelseacapableofwinningthepremierleaguethisseason-/media.mp3" length="124503392" type="audio/mpeg"/>
			<guid isPermaLink="false">acc1dc4f-8510-4dcd-b55c-abf257597419</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/arechelseacapableofwinningthepremierleaguethisseason-</link>
			<acast:episodeId>acc1dc4f-8510-4dcd-b55c-abf257597419</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>arechelseacapableofwinningthepremierleaguethisseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFssR3QOxfc/v/4e4U7JBh5Etid7mD0EIRGm7hzyDyCOlRMNWX0i0Q+6jwGgVGKjiAXQRPMlun+UcP8G0UIXzZ46W4dSwf+qhv9Ry78ODzSGFvmNP/yeeH1WxKRviyqHVRHUR37FCePZ+2zXUKsBX9Vz5YVsGc+u2aqknDcFh1fkKFnCofDu3NsU7RiZteIUm8uyqDgjg2svoN/YdNL/DlwMnA9x7p7bbypWo+oZA7oQum7jghXXpxn8i/il8yrCMTK2t/7ONw5HqqXKbseG3vQim8/WHmESYW4Kj60LGOGb]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin and Ade Oladipo do not share Darren Lewis's confidence in Frank Lampard's squad, even in this, the most unpredictable of seasons. The panel draws a damning contrast between Mikel Arteta and Ole Gunnar Solksjaer, and sees the logic...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin and Ade Oladipo do not share Darren Lewis's confidence in Frank Lampard's squad, even in this, the most unpredictable of seasons. The panel draws a damning contrast between Mikel Arteta and Ole Gunnar Solksjaer, and sees the logic of Pep Guardiola returning to Barcelona. They also identify Leicester's Wes Morgan as a leader of the future.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin and Ade Oladipo do not share Darren Lewis's confidence in Frank Lampard's squad, even in this, the most unpredictable of seasons. The panel draws a damning contrast between Mikel Arteta and Ole Gunnar Solksjaer, and sees the logic of Pep Guardiola returning to Barcelona. They also identify Leicester's Wes Morgan as a leader of the future.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has Ole Gunnar Solksjaer finally proved his critics wrong?</title>
			<itunes:title>Has Ole Gunnar Solksjaer finally proved his critics wrong?</itunes:title>
			<pubDate>Thu, 29 Oct 2020 15:50:25 GMT</pubDate>
			<itunes:duration>51:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hasolegunnarsolksjaerfinallyprovedhiscriticswrong-/media.mp3" length="122506220" type="audio/mpeg"/>
			<guid isPermaLink="false">3383ae10-aef3-4111-a002-b75f39de373b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hasolegunnarsolksjaerfinallyprovedhiscriticswrong-</link>
			<acast:episodeId>3383ae10-aef3-4111-a002-b75f39de373b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hasolegunnarsolksjaerfinallyprovedhiscriticswrong-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRGWvNnalFWiExr7ofONZQvBGOx1tnBU1mttMLTOPoO+qyB1ABy9KsHPeZ2JNRBBdtizfuX/vH6Nb4uWWSql1n8oWsh0cNth1NjTrXsJ7kuLpjPUz9G506SYj7qEWd75mOAuoJcrWn42riy8Mf/7zzsz/k2EWKar3yNK++chDszf1caD1BkUxxP5D9ac20L0R3wKcIZPDRY2NYl2BTlaad1MKQMxR1qRpr9FULOYf5ImO3AMSEyoiXM2WokQrkUAkWROm8G5KPdksUc5Eb/Qqv8kjH0PYPeyZ0hdpdffcrcZb]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Miguel Delaney and Art de Roche deliver overdue praise for the Manchester United manager. They believe it is now or never for Pep Guardiola at Manchester City, and back Jurgen Klopp to steer Liverpool safely to the international break. The...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Art de Roche deliver overdue praise for the Manchester United manager. They believe it is now or never for Pep Guardiola at Manchester City, and back Jurgen Klopp to steer Liverpool safely to the international break. They also consider the merits of British coaches, Marcelo Bielsa's influence at Leeds, and the danger of Slaven Bilic becoming the Premier League's first managerial casualty of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Art de Roche deliver overdue praise for the Manchester United manager. They believe it is now or never for Pep Guardiola at Manchester City, and back Jurgen Klopp to steer Liverpool safely to the international break. They also consider the merits of British coaches, Marcelo Bielsa's influence at Leeds, and the danger of Slaven Bilic becoming the Premier League's first managerial casualty of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Which Premier League club has the best chance of winning the Champions League this season?</title>
			<itunes:title>Which Premier League club has the best chance of winning the Champions League this season?</itunes:title>
			<pubDate>Mon, 26 Oct 2020 16:24:43 GMT</pubDate>
			<itunes:duration>52:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whichpremierleagueclubhasthebestchanceofwinningthechampionsleaguethisseason-/media.mp3" length="126926516" type="audio/mpeg"/>
			<guid isPermaLink="false">df56578d-3ce4-4d6d-9e07-effe9eeec4a8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whichpremierleagueclubhasthebestchanceofwinningthechampionsleaguethisseason-</link>
			<acast:episodeId>df56578d-3ce4-4d6d-9e07-effe9eeec4a8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whichpremierleagueclubhasthebestchanceofwinningthechampionsleaguethisseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBy8XbjxhrXTdrmoZZD5EMTDKrT/X7OewT90exyFVw5NfCOVJrIZNtaLXPTO46XRJAAACB7Z4eINquCVTYLVLr7dOaFlBrDhEMaPOcn257hUMAMwUkcGQ1RdPl49fFc5Jq3udpRG2nBly1Stx/qOh1GnRUkBPSKdmbmrAtLLawMfOL+IYbqEPjqifsiwnKvcwOu7DuLe5f2g7W6YGKAv3sxjTyXuXuuol+Ftbw+QFiN6gHP71E/BGhi0wJqZXEQhlPBjoVFf/RcYoFtJAA+vlqiPY114e71a+d5muXSSIvGe]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, John Cross and Glenn Moore have faith in Liverpool's ability to overcome the loss of Virgil Van Dijk. They feel Manchester City are flat, Manchester United are fallible and Chelsea face a delicate&nbsp;balancing act. Also on the a...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Glenn Moore have faith in Liverpool's ability to overcome the loss of Virgil Van Dijk. They feel Manchester City are flat, Manchester United are fallible and Chelsea face a delicate&nbsp;balancing act. Also on the agenda : VAR, athletes as activists, and the England women's team.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Glenn Moore have faith in Liverpool's ability to overcome the loss of Virgil Van Dijk. They feel Manchester City are flat, Manchester United are fallible and Chelsea face a delicate&nbsp;balancing act. Also on the agenda : VAR, athletes as activists, and the England women's team.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Who's doing the best job, Frank Lampard or Ole Gunnar Solksjaer?]]></title>
			<itunes:title><![CDATA[Who's doing the best job, Frank Lampard or Ole Gunnar Solksjaer?]]></itunes:title>
			<pubDate>Thu, 22 Oct 2020 15:43:02 GMT</pubDate>
			<itunes:duration>52:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whosdoingthebestjob-franklampardorolegunnarsolksjaer-/media.mp3" length="125236280" type="audio/mpeg"/>
			<guid isPermaLink="false">95267b50-063c-457e-aec7-b155f3cc947f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whosdoingthebestjob-franklampardorolegunnarsolksjaer-</link>
			<acast:episodeId>95267b50-063c-457e-aec7-b155f3cc947f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whosdoingthebestjob-franklampardorolegunnarsolksjaer-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRHDAtamQZ5TscB29GTtkYE6uYkxFUmCOyNST9kTH4WpOYu4xVmuhxqdStz+o15i5oB92e5bMIWKp25qXjxHNtzd7Uudgdd2uiS19e0Gq5cUCkrde7/S2Z2R1wTit5FtQ5DmH+p6kalWwX4LsD/raKrxWfjewdjhIUv3zk8rqy67fQHehGFoxWS2LPU2GOEGRJ9t0mByOJMQFyi1h/ZDsSk1FXH8MWieM7f7iiQbEZPM5DIuQphL5oAiProQ6cbBu7Vd8WiD+S3VahHyW52wviT/YL0ayII43uY2T/TE23qvZ]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Anne Marie Batson and Jordan Jarrett Bryan analyse managerial matters at Manchester United and Chelsea. They assess Liverpool's defensive options, consider Manchester City's title credentials, and disagree on the merits of Mesut ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Jordan Jarrett Bryan analyse managerial matters at Manchester United and Chelsea. They assess Liverpool's defensive options, consider Manchester City's title credentials, and disagree on the merits of Mesut Ozil. They also praise Marcus Rashford, and make a powerful plea for change.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Jordan Jarrett Bryan analyse managerial matters at Manchester United and Chelsea. They assess Liverpool's defensive options, consider Manchester City's title credentials, and disagree on the merits of Mesut Ozil. They also praise Marcus Rashford, and make a powerful plea for change.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Liverpool already at a huge disadvantage in the Champions League?</title>
			<itunes:title>Are Liverpool already at a huge disadvantage in the Champions League?</itunes:title>
			<pubDate>Mon, 19 Oct 2020 15:19:12 GMT</pubDate>
			<itunes:duration>51:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/areliverpoolalreadyatahugedisadvantageinthechampionsleague-/media.mp3" length="124027328" type="audio/mpeg"/>
			<guid isPermaLink="false">82c850ae-7146-41a6-a386-7501b871981b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/areliverpoolalreadyatahugedisadvantageinthechampionsleague-</link>
			<acast:episodeId>82c850ae-7146-41a6-a386-7501b871981b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>areliverpoolalreadyatahugedisadvantageinthechampionsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRKOA199BGEDXm+6svhBWJ8nFmRpGNhEO0uYL/zBA4huj0YVtCWjK0oMywnVSSK7DX9vVXR9z5GSAeDwIDyamFjCUHwUS8D/rWV/9K493QCYFL/c744IEs2vfguvLK/OyDh2elUmqcuQ8BnYwc89x1TAYfYHWeoTXaB3rNz5baF7yPMgBdfUC6FsPF8zaTNAu+CJUVDOUhAbwX/gQW2YUmYXRY6axhvvYpU53FLPOUPxeCV012CuBDaBMnEkLkmo3wGemPHQTbMRyCNPiCMBOM8RfdFgob/nlj0YLDRkm2YDh]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and Dominic Fifield believe the Champions League is more open than ever, in a compressed season shaped by injury to key players. Manchester City have the easiest group, Liverpool will struggle due to the loss of Virgil ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Dominic Fifield believe the Champions League is more open than ever, in a compressed season shaped by injury to key players. Manchester City have the easiest group, Liverpool will struggle due to the loss of Virgil Van Dijk, Manchester United are vulnerable at PSG, and Chelsea cannot afford more poor defending against Sevilla.&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Dominic Fifield believe the Champions League is more open than ever, in a compressed season shaped by injury to key players. Manchester City have the easiest group, Liverpool will struggle due to the loss of Virgil Van Dijk, Manchester United are vulnerable at PSG, and Chelsea cannot afford more poor defending against Sevilla.&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Everton seize bragging rights on Merseyside?</title>
			<itunes:title>Will Everton seize bragging rights on Merseyside?</itunes:title>
			<pubDate>Thu, 15 Oct 2020 14:32:22 GMT</pubDate>
			<itunes:duration>49:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willevertonseizebraggingrightsonmerseyside-/media.mp3" length="119601812" type="audio/mpeg"/>
			<guid isPermaLink="false">2773660e-5e53-422a-b507-12ea4c600bdd</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willevertonseizebraggingrightsonmerseyside-</link>
			<acast:episodeId>2773660e-5e53-422a-b507-12ea4c600bdd</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willevertonseizebraggingrightsonmerseyside-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRG1igG0KVDLCA9ObmVu9/K91m2SrDj7TLm8NkPDxtVuW+jQbDu8sLkwDXH+io3fh4Amd8FhVSM32/30Ljc1aWn2+mtsEQN2Zb7LQgFuESwxhnnIUjlhRFumoJaS8PBQfmrlzojJOOAL+3MK0HaZPiv7h3i3j6lM+IwObE2y+/47kzWF1z57PCcp3YNRzEwRX9lkE5ytpfgNH0DS+xHc+QCbi/BVgE6tIkcVajEluNVJJxq8LAE6sq6vIdm3uvBjqLj8cWjOo6SJuUSwt3EnIF+kVmXkhqwSmf/jWaerKj45i]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Richard Amofa believe Everton will never have a better chance of winning the Merseyside derby. They also call for Harry McGuire to be taken out of the firing&nbsp;line, hail Thomas Partey as a key Arsenal signing, and...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Richard Amofa believe Everton will never have a better chance of winning the Merseyside derby. They also call for Harry McGuire to be taken out of the firing&nbsp;line, hail Thomas Partey as a key Arsenal signing, and look at the future of the game, following the rejection of Project Big Picture.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Richard Amofa believe Everton will never have a better chance of winning the Merseyside derby. They also call for Harry McGuire to be taken out of the firing&nbsp;line, hail Thomas Partey as a key Arsenal signing, and look at the future of the game, following the rejection of Project Big Picture.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can the future of English football be entrusted to the top six?</title>
			<itunes:title>Can the future of English football be entrusted to the top six?</itunes:title>
			<pubDate>Mon, 12 Oct 2020 14:43:56 GMT</pubDate>
			<itunes:duration>51:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canthefutureofenglishfootballbeentrustedtothetopsix-/media.mp3" length="123644180" type="audio/mpeg"/>
			<guid isPermaLink="false">c8fb3868-8dfb-4e51-abf3-6b17880a55f3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canthefutureofenglishfootballbeentrustedtothetopsix-</link>
			<acast:episodeId>c8fb3868-8dfb-4e51-abf3-6b17880a55f3</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canthefutureofenglishfootballbeentrustedtothetopsix-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9NDKqACB4v1RwpVv7lLEdHNr5vqxNRiQy2sTsojwonTw/ZMLTzjI+m0ZmPYOGzyY2N4H53Tr8Y/9Py7IBNUUlrCFVbr4JB8b8vCoCvDW2weSbmtfdNyGjClCnkuS1d4++bQt0JASaucgbSaF/9o3qjdyEeJgpw0Me2iW1aZQ4a++sEhTtOEOXdHah0c7PCeUaYpNb8taTe83HRSr+Y+/tBknA1Qz92SG5ePBga5HngtZCaJeuzAaPZMoTXhe+FzkC]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Sarah Shephard and Ade Oladipo consider the implications of Project Big Picture, the secretive plan for far-reaching change driven by Liverpool and Manchester United. They believe some proposals are "horrible" and "cynical...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Sarah Shephard and Ade Oladipo consider the implications of Project Big Picture, the secretive plan for far-reaching change driven by Liverpool and Manchester United. They believe some proposals are "horrible" and "cynical", but can see the benefits in other aspects of the initiative. They also fear for international football, and the potential consequences of more players testing positive in the pandemic.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Sarah Shephard and Ade Oladipo consider the implications of Project Big Picture, the secretive plan for far-reaching change driven by Liverpool and Manchester United. They believe some proposals are "horrible" and "cynical", but can see the benefits in other aspects of the initiative. They also fear for international football, and the potential consequences of more players testing positive in the pandemic.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is this unique season going to provide more surprises?</title>
			<itunes:title>Is this unique season going to provide more surprises?</itunes:title>
			<pubDate>Mon, 05 Oct 2020 14:34:04 GMT</pubDate>
			<itunes:duration>52:32</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthisuniqueseasongoingtoprovidemoresurprises-/media.mp3" length="125979608" type="audio/mpeg"/>
			<guid isPermaLink="false">5d9ef49d-0571-4192-b81d-aaec676248fc</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthisuniqueseasongoingtoprovidemoresurprises-</link>
			<acast:episodeId>5d9ef49d-0571-4192-b81d-aaec676248fc</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthisuniqueseasongoingtoprovidemoresurprises-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9b7rczBPTPmXxypynsQ7NUjJAAO7r6qeZE/jxZZ2k5Cqwc8gLUbpe8AtIJfw0EObdgJWmjIt/5pAcW8Lpjcfg1OMeCmv0+yRf5KiYC3hpGEvwBpw5g1PH5dxbCphvxZif2RoesFnLCb3iYPV1qTDd1Lmxz+GISkGgXje9aTgu6jp12qd/JPNEatgH18bcUULO+B89or5mHbt7evHL8QALkWPaIqRIQ7RKCjiD2mNh/N7Y05P/jhkhnvnbzLlT14ry]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Miguel Delaney and Glenn Moore believe we should expect the unexpected due to a unique set of circumstances. Liverpool's thrashing by Aston Villa is a blip, but Manchester United have deep-seated problems. There's praise for Jose...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Glenn Moore believe we should expect the unexpected due to a unique set of circumstances. Liverpool's thrashing by Aston Villa is a blip, but Manchester United have deep-seated problems. There's praise for Jose Mourinho, Marcelo Biesla and Carlo Ancelotti, and a preview of two key WSL games, on BT Sport next weekend.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Glenn Moore believe we should expect the unexpected due to a unique set of circumstances. Liverpool's thrashing by Aston Villa is a blip, but Manchester United have deep-seated problems. There's praise for Jose Mourinho, Marcelo Biesla and Carlo Ancelotti, and a preview of two key WSL games, on BT Sport next weekend.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has Frank Lampard got the Right Stuff as Chelsea manager?</title>
			<itunes:title>Has Frank Lampard got the Right Stuff as Chelsea manager?</itunes:title>
			<pubDate>Thu, 01 Oct 2020 14:35:31 GMT</pubDate>
			<itunes:duration>48:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hasfranklampardgottherightstuffaschelseamanager-/media.mp3" length="117326936" type="audio/mpeg"/>
			<guid isPermaLink="false">bcc556ca-8e98-4a25-9d6d-b152d56b4ee9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hasfranklampardgottherightstuffaschelseamanager-</link>
			<acast:episodeId>bcc556ca-8e98-4a25-9d6d-b152d56b4ee9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hasfranklampardgottherightstuffaschelseamanager-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROf1gG1bYVmalAvczzYeZB+j6PontgJ9uxTb6mqjwDvvu8nlBdPGZ/a6LrlqAFsrgBtIrcGWN31GevxWxyV+vjelBuRwyhEZsnscSbRFYKPsA6LGR90FhgDP2BLjbA0Kqcc7nKhx7XAX6x6qoZNuYWTlBGqJ4qL9ANZAKO3WucQSCHHqsqVF+vLyllBajIUbq+5YKZ1pdFCUmfmtJTp8YHpLwkIF1aHT9SMvGljC+yqIWnDlTzbucdo8B3vanZctl6fp3eJgBEhgKqNuP+yXuOrbuqI4eqtz8sU7EeF9rJsu]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Anne Marie Batson express their faith in Frank Lampard, but consider Manchester United's transfer dealings "an embarrassment."&nbsp;They fear that football has lost the Government's trust, c...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Anne Marie Batson express their faith in Frank Lampard, but consider Manchester United's transfer dealings "an embarrassment."&nbsp;They fear that football has lost the Government's trust, call for fans to be readmitted to grounds, and believe that international football is being marginalised<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Anne Marie Batson express their faith in Frank Lampard, but consider Manchester United's transfer dealings "an embarrassment."&nbsp;They fear that football has lost the Government's trust, call for fans to be readmitted to grounds, and believe that international football is being marginalised<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Should the new handball laws be scrapped?</title>
			<itunes:title>Should the new handball laws be scrapped?</itunes:title>
			<pubDate>Mon, 28 Sep 2020 14:14:30 GMT</pubDate>
			<itunes:duration>50:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/shouldthenewhandballlawsbescrapped-/media.mp3" length="122281760" type="audio/mpeg"/>
			<guid isPermaLink="false">4d39595f-4dcf-458b-b650-37e7e62665a7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/shouldthenewhandballlawsbescrapped-</link>
			<acast:episodeId>4d39595f-4dcf-458b-b650-37e7e62665a7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>shouldthenewhandballlawsbescrapped-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9dNKinLrwY+Ms4ZDPhVOG8l1cUE/a9u9Xhu7v4G4jMVlf2U/cP/CEIOIJiL+mxUGyjfRbEy8fkegABcba01KVaZDI8xbdC5X/FZg9xvcYkhLO+08vRWZKL6Cy/EdgTEMVsSndvIZW7F2mQ3G1XQsndHcnZQGbd5vKybcMPoLHtGb6y/pUX5e3kT3ixYeZYDgMiIfqphogsSN4DMq6ydgd2/E400XMsmEkJZAtyvNUWVPWpAmerHWmY1mb0L2MED1z]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Darren Lewis and Art de Roche believe the&nbsp;new&nbsp;laws are damaging the game. They support Tottenham's complaints about a fixture pile up, call for greater&nbsp;support for the football pyramid, and analyse how Arsen...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Art de Roche believe the&nbsp;new&nbsp;laws are damaging the game. They support Tottenham's complaints about a fixture pile up, call for greater&nbsp;support for the football pyramid, and analyse how Arsenal have stolen a march on Chelsea, Manchester City and Manchester United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Art de Roche believe the&nbsp;new&nbsp;laws are damaging the game. They support Tottenham's complaints about a fixture pile up, call for greater&nbsp;support for the football pyramid, and analyse how Arsenal have stolen a march on Chelsea, Manchester City and Manchester United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is football doing enough to help itself through its greatest crisis?</title>
			<itunes:title>Is football doing enough to help itself through its greatest crisis?</itunes:title>
			<pubDate>Thu, 24 Sep 2020 14:47:43 GMT</pubDate>
			<itunes:duration>51:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isfootballdoingenoughtohelpitselfthroughitsgreatestcrisis-/media.mp3" length="73486268" type="audio/mpeg"/>
			<guid isPermaLink="false">4f63cf8b-e6d0-442c-a9e5-3b09b57c1ff9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isfootballdoingenoughtohelpitselfthroughitsgreatestcrisis-</link>
			<acast:episodeId>4f63cf8b-e6d0-442c-a9e5-3b09b57c1ff9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isfootballdoingenoughtohelpitselfthroughitsgreatestcrisis-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9gBibuH2lfKo0R+lMMS5B7uQiNYw1bFFAwpjA+ozZTuZwwo6lMLbBguKkIkuNsO867YCRJ2nyO0Z9x6TNIPjeZp/jQSNY2DqHQobu1G5OUMzoLK9XjzB4owHiV0xyiaJ/BY3gClbvPaqisHIWyHGMTenWEAIXYSi0uUCHRZrqKVnN7v8p1QUoh9LX37GRkEzhoDUow6sVQvmURwN6kzfyRhGJ87YxDgy1VdXCrHyLZQz1f8ZVAzNnSW71t/reyDg6]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Dominic Fifield and Adrian Clarke assess the extent of the crisis confronting football. They believe the PFA is betraying its members, and that Premier League clubs, preoccupied by a potential breakaway to form a European Super League, mus...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Adrian Clarke assess the extent of the crisis confronting football. They believe the PFA is betraying its members, and that Premier League clubs, preoccupied by a potential breakaway to form a European Super League, must do more to help those in the EFL.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Adrian Clarke assess the extent of the crisis confronting football. They believe the PFA is betraying its members, and that Premier League clubs, preoccupied by a potential breakaway to form a European Super League, must do more to help those in the EFL.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Manchester United in danger of being left behind?</title>
			<itunes:title>Are Manchester United in danger of being left behind?</itunes:title>
			<pubDate>Mon, 21 Sep 2020 12:59:02 GMT</pubDate>
			<itunes:duration>47:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/aremanchesterunitedindangerofbeingleftbehind-/media.mp3" length="68914660" type="audio/mpeg"/>
			<guid isPermaLink="false">52006571-b852-49a4-b6f2-f3ae7389cdb8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/aremanchesterunitedindangerofbeingleftbehind-</link>
			<acast:episodeId>52006571-b852-49a4-b6f2-f3ae7389cdb8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>aremanchesterunitedindangerofbeingleftbehind-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRMAicUxcVMvvR79e48TqwKsyGsd6AA0/biEfCFPOFcBcdjL0t9jIK3LUZ2/bODtQI0GwsQOYEstdb9LD/Mbi0ka3GQqBVxXBgXOmbRF/ym7r8SGEQ+O/edkecaOg+OYZ1Q8GzqjM4v/57ULzi+8MSmw7bYY4deEK+DeTXZXOqC/C0Mmr3g9nhEOptFF4yXAFcHjwNdr+q3myLF9rqO1B/O9/ldb4gagL59/wmY3CNsTzFRFGPY8yaF4gUj9u0Rzkvqs6QlVL/nPBdRohLT/mWRx7hsiHVT8XF31roSvqh2Fz]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin. Miguel Delaney and Richard Amofa highlight the flaws in United's transfer policy, and the lingering doubts about Ole Gunnar Solskjaer's&nbsp;management. They examine the mounting pressure on Frank Lampard, the instant impact ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin. Miguel Delaney and Richard Amofa highlight the flaws in United's transfer policy, and the lingering doubts about Ole Gunnar Solskjaer's&nbsp;management. They examine the mounting pressure on Frank Lampard, the instant impact of Thiago, and the potential of new front threes at Spurs and Everton.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin. Miguel Delaney and Richard Amofa highlight the flaws in United's transfer policy, and the lingering doubts about Ole Gunnar Solskjaer's&nbsp;management. They examine the mounting pressure on Frank Lampard, the instant impact of Thiago, and the potential of new front threes at Spurs and Everton.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Chelsea the real deal?</title>
			<itunes:title>Are Chelsea the real deal?</itunes:title>
			<pubDate>Thu, 17 Sep 2020 14:35:17 GMT</pubDate>
			<itunes:duration>52:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/arechelseatherealdeal-/media.mp3" length="125238368" type="audio/mpeg"/>
			<guid isPermaLink="false">d7e4091b-5414-4b9d-8578-e75205357f2e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/arechelseatherealdeal-</link>
			<acast:episodeId>d7e4091b-5414-4b9d-8578-e75205357f2e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>arechelseatherealdeal-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9WHzqVyW8dgVn4ITSLkt1FY+JTVpiA3qZfuoExVDHaviWtL0vxVupV9z3jevIxR3eVBkQZORWdssD18qSpkLBRPrlfsfckaOXqu9xnXzmRqPpEvWK2Pnar3V8j1ofKwLXbdoKix3oxOVBCcyBJsuePK4HBaxN0RqCnYYoM9+5PLxkJ1fld6N9dAwzZef1p8W8fd3NLYP6PLWjLcqaJVkcYUBKUj8P0uH/vu4BZWQDQJa2kSejdl4GIp9NgCHFrTe2]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Anne Marie Batson and Jonathan Northcroft analyse the challenge facing Frank Lampard at Chelsea. They hail the return of Gareth Bale, discuss Mason Greenwood’s treatment by sections of the media, and call for change to protect football’s f...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne Marie Batson and Jonathan Northcroft analyse the challenge facing Frank Lampard at Chelsea. They hail the return of Gareth Bale, discuss Mason Greenwood’s treatment by sections of the media, and call for change to protect football’s future.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne Marie Batson and Jonathan Northcroft analyse the challenge facing Frank Lampard at Chelsea. They hail the return of Gareth Bale, discuss Mason Greenwood’s treatment by sections of the media, and call for change to protect football’s future.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Tottenham be a mid-table team under Jose Mourinho?</title>
			<itunes:title>Will Tottenham be a mid-table team under Jose Mourinho?</itunes:title>
			<pubDate>Mon, 14 Sep 2020 14:53:22 GMT</pubDate>
			<itunes:duration>53:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willtottenhambeamid-tableteamunderjosemourinho-/media.mp3" length="129003032" type="audio/mpeg"/>
			<guid isPermaLink="false">c774fad3-f5fe-4b68-bce9-d017bc4651b9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willtottenhambeamid-tableteamunderjosemourinho-</link>
			<acast:episodeId>c774fad3-f5fe-4b68-bce9-d017bc4651b9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willtottenhambeamid-tableteamunderjosemourinho-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9srluogSBU2zzpVEq04l9bZAC4tyNL9bApZA//0aNNtfhb7kGVRJx1AmwQPx7Lzc6LLbJ8vUhPMs1K+mrOtyTcejcZVQaPfaXzrt8zFmcNSfCe0/gF5fI7CqEsq70aR8vMWEhldx74+WyORafUgt8+uGa8hkXj7nRaYNdJ1dFd1HRAFe33ssDKQTsR/1i3vQjAJglBZvEo2KhdX9/FmSzoXfgWj91rbyeRMLRDWgMFmkFpEEEYxhHOnsGFm5SDbBu]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Ade Olapido and John Cross review the opening&nbsp;weekend of the Premier League season. They foresee problems for Jose Mourinho, praise Arsenal's progress under Mikel Arteta, and call for greater financial help for EFL clubs.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Ade Olapido and John Cross review the opening&nbsp;weekend of the Premier League season. They foresee problems for Jose Mourinho, praise Arsenal's progress under Mikel Arteta, and call for greater financial help for EFL clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Ade Olapido and John Cross review the opening&nbsp;weekend of the Premier League season. They foresee problems for Jose Mourinho, praise Arsenal's progress under Mikel Arteta, and call for greater financial help for EFL clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who wins the Premier League, and who gets relegated?</title>
			<itunes:title>Who wins the Premier League, and who gets relegated?</itunes:title>
			<pubDate>Thu, 10 Sep 2020 14:20:03 GMT</pubDate>
			<itunes:duration>52:45</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whowinsthepremierleague-andwhogetsrelegated-/media.mp3" length="126522488" type="audio/mpeg"/>
			<guid isPermaLink="false">9197abd8-c720-40a8-94f9-f874206f79f5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whowinsthepremierleague-andwhogetsrelegated-</link>
			<acast:episodeId>9197abd8-c720-40a8-94f9-f874206f79f5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whowinsthepremierleague-andwhogetsrelegated-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRCFemDUbogZUh0g8HpWEu9VZ8l2AIjqluyxVKRStPo1DJ7fBGmP7L7Jq7I1vSkEYoKw23Wq2uK29kN5Le5Iunc16y2fRM1NJf2QoIFhF89z+gHKbirBxFWlm5zDlm8EfbvWmDst0Qqw1FmK2omZhIa6/OH0Ij7jJvkO6vxGZSJ/7bM9cBWQf6JIIVV6+IybyUroyDjMaXaKq7TmgHKtixxJtudWANlp7gBlgrFEXZoPnrqkLle2gy+XHz+pMlj6uiuD2/4gXE1gxwcR3vDEFrdwxifcBO2sEQZOMxjth9p26]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and Jordan Jarrett Bryan name their winners and losers in the new Premier League season. Top four, bottom three, surprise sides, biggest flops and best signings. Will you agree?</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Jordan Jarrett Bryan name their winners and losers in the new Premier League season. Top four, bottom three, surprise sides, biggest flops and best signings. Will you agree?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Jordan Jarrett Bryan name their winners and losers in the new Premier League season. Top four, bottom three, surprise sides, biggest flops and best signings. Will you agree?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is the top four in the Premier League a closed shop?</title>
			<itunes:title>Is the top four in the Premier League a closed shop?</itunes:title>
			<pubDate>Mon, 07 Sep 2020 14:21:24 GMT</pubDate>
			<itunes:duration>54:16</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthetopfourinthepremierleagueaclosedshop-/media.mp3" length="130155608" type="audio/mpeg"/>
			<guid isPermaLink="false">648970dc-bae1-4feb-bad6-0953c42aca6e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthetopfourinthepremierleagueaclosedshop-</link>
			<acast:episodeId>648970dc-bae1-4feb-bad6-0953c42aca6e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthetopfourinthepremierleagueaclosedshop-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRIjYqfZucg1QME1xoM8KDNsjXNS+e1CpUHHR0qhkseCmjZ4lYBLMByHujHJv4XFRWaOh7afQ37IvkA3jQtqRIL25mQJfYCfvXWfBQHSTHfvFPpa5FJJqPiTvvxk5FCLOFpMebVPJ6/ofhFQjFGjLZqSRXyGb1/kaRijGDPcfwOgLYWgIKwjMNEPSfip8OYzv62WEP4+3R2ic+xRgbGenBaBGGJe7+cadxEetxjdxX4dJHTcFVhQAuDhHtH+ckQ/eqlJSDb7YqRUnJaG+ih163LUSPIS+fNDmWpCbD66DKprA]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Dominic Fifield and Miguel Delaney suggest only Arsenal have a realistic chance of breaking into the top four. Is Ole Gunnar Solskjaer Manchester United's weakest link? What does Frank Lampard need to achieve to survive at Chelsea? Wi...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Miguel Delaney suggest only Arsenal have a realistic chance of breaking into the top four. Is Ole Gunnar Solskjaer Manchester United's weakest link? What does Frank Lampard need to achieve to survive at Chelsea? With Liverpool restricted financially, will Lionel Messi be Manchester City's Christmas present?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Miguel Delaney suggest only Arsenal have a realistic chance of breaking into the top four. Is Ole Gunnar Solskjaer Manchester United's weakest link? What does Frank Lampard need to achieve to survive at Chelsea? With Liverpool restricted financially, will Lionel Messi be Manchester City's Christmas present?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Should England be playing in the Nations League?</title>
			<itunes:title>Should England be playing in the Nations League?</itunes:title>
			<pubDate>Thu, 03 Sep 2020 14:20:00 GMT</pubDate>
			<itunes:duration>51:16</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/shouldenglandbeplayinginthenationsleague-/media.mp3" length="122942612" type="audio/mpeg"/>
			<guid isPermaLink="false">297d8b4f-e113-4d23-9478-de0f887510e9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/shouldenglandbeplayinginthenationsleague-</link>
			<acast:episodeId>297d8b4f-e113-4d23-9478-de0f887510e9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>shouldenglandbeplayinginthenationsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFqCLz0G+JbaWVSCWHj0uePn8YgauTMjlaJegzI+SiuFbgRyziQGSDHdw3ub/mvkmtT9oN8IQRJ/AequsEgQAw7C9BitnwXGcBeIT7Jpeda9oDQqpKLRGAylYaQ9DCw2a6ADL4ByTNdDAzYF0WvnZtELfMYSrXsc7UoH3HuuCILxQ6cBOzbru8jztD1TTQpe8qNYOAMtqiB+gKcGgb0FEwZmduT68ckfsDoQ1jnDmZM/ejmUU+aAWwfAO2r+GEG3aG7L54b7rqMSFlNeJdieVCCtuCvR6RXzoouQURUowVVF]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Darren Lewis and Art de Roche throw a spotlight on England, and the relevance of international football. They look forward to this weekend's return of the WSL, hail Marcus Rashford as football's most powerful role model, and name...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Art de Roche throw a spotlight on England, and the relevance of international football. They look forward to this weekend's return of the WSL, hail Marcus Rashford as football's most powerful role model, and name their signing of the summer, so far.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Art de Roche throw a spotlight on England, and the relevance of international football. They look forward to this weekend's return of the WSL, hail Marcus Rashford as football's most powerful role model, and name their signing of the summer, so far.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>What impact would Lionel Messi have on English football?</title>
			<itunes:title>What impact would Lionel Messi have on English football?</itunes:title>
			<pubDate>Thu, 27 Aug 2020 14:49:59 GMT</pubDate>
			<itunes:duration>48:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatimpactwouldlionelmessihaveonenglishfootball-/media.mp3" length="115360040" type="audio/mpeg"/>
			<guid isPermaLink="false">db81d420-d808-479e-a6ba-f1f234473dc2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatimpactwouldlionelmessihaveonenglishfootball-</link>
			<acast:episodeId>db81d420-d808-479e-a6ba-f1f234473dc2</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatimpactwouldlionelmessihaveonenglishfootball-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9ojpsN3wx6coenhdN+F3P5Oo1MxXOn3ZkzsWkUlYGxFTOWzezbW6DBJEcVpXCk65zg0q5HdBZGsdDpxbBLHUC52JN9p9gXZkisCD3UmvjqIdhke/UonmoPLg7PuexHt0/nkioe/ROcX/MxGp+B5lg/w+9fL12TrNv9bKbOJVrnL463DYEtqxCG3p8YX1oy1Fj002uv49hM8lmWm/3MTitE95wmmM8pBvcqIM/3msZqEPfDac0BeYBizhl+zvAz45I]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Sarah Shephard and Richard Amofa consider the implications of City signing Lionel Messi. They also analyse the latest England squad, the Community Shield, and the chances of Premier League footballers refusing to play in protest at racial ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Sarah Shephard and Richard Amofa consider the implications of City signing Lionel Messi. They also analyse the latest England squad, the Community Shield, and the chances of Premier League footballers refusing to play in protest at racial inequalities.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Sarah Shephard and Richard Amofa consider the implications of City signing Lionel Messi. They also analyse the latest England squad, the Community Shield, and the chances of Premier League footballers refusing to play in protest at racial inequalities.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Does English football have a superiority complex?</title>
			<itunes:title>Does English football have a superiority complex?</itunes:title>
			<pubDate>Mon, 24 Aug 2020 13:49:18 GMT</pubDate>
			<itunes:duration>50:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/doesenglishfootballhaveasuperioritycomplex-/media.mp3" length="120447452" type="audio/mpeg"/>
			<guid isPermaLink="false">effab69e-179a-4fd2-9141-39cbd2a22712</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/doesenglishfootballhaveasuperioritycomplex-</link>
			<acast:episodeId>effab69e-179a-4fd2-9141-39cbd2a22712</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>doesenglishfootballhaveasuperioritycomplex-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9h3Et9ro4oWvbj3RylaQuVpNJSS0Qc6EbUHI1ja4Vxn9FhAeiFDxiYXxRyIvD5vqUuGk8WTcy3BcEZAxgeHZjnkIr9k1WLOZy0uw8AKzD0+DB9E08gvHOk1nUu5VBmc0m0ufSaTaxaC/oLGQx59zAJoPNra1XC3B1WJrqQACJxI3ixHEgsjOoxp+VNvUIVJYMczUe8EYS6syFbKGPxxyPg+FOdXI1r8n596tg+1KwUPc=]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Ade Oladipo and Adrian Clarke discuss Neymar's tears, Bayern's team ethic, and what Premier League clubs can learn from Champions League disappointment, They also ask whether our teams should take the Europa League more seriously.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Ade Oladipo and Adrian Clarke discuss Neymar's tears, Bayern's team ethic, and what Premier League clubs can learn from Champions League disappointment, They also ask whether our teams should take the Europa League more seriously.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Ade Oladipo and Adrian Clarke discuss Neymar's tears, Bayern's team ethic, and what Premier League clubs can learn from Champions League disappointment, They also ask whether our teams should take the Europa League more seriously.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Neymar prevent Bayern Munich from winning the Champions League?</title>
			<itunes:title>Can Neymar prevent Bayern Munich from winning the Champions League?</itunes:title>
			<pubDate>Thu, 20 Aug 2020 14:15:37 GMT</pubDate>
			<itunes:duration>51:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canneymarpreventbayernmunichfromwinningthechampionsleague-/media.mp3" length="123827924" type="audio/mpeg"/>
			<guid isPermaLink="false">b66b37c2-c483-4508-89f7-15b721c12726</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canneymarpreventbayernmunichfromwinningthechampionsleague-</link>
			<acast:episodeId>b66b37c2-c483-4508-89f7-15b721c12726</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canneymarpreventbayernmunichfromwinningthechampionsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRB0QaU8vTAx5iwSvpj+MZCXzMh4Z5tXD/iX//0ZGIJikJuhw9OqjyJfcQZt+blCG2z0Pn2u2jUn9CIi0c8HX2wC6aZ2BkZcPuco4NoBaA6U6wb4AyeqXPSzFmL1KshzZ9xkJ66w5TdScWCwZJ+FfYoL3Bu0KsVFuziYdJafiAF1g+0KohjH5JK5Sq20MghagzjqQxaJ4yCodN2e6MWQwM7fxuucKStYsBdsjLEHN89uwLQm8ZvDznG0EKbn/goQQ/gBPl9HSfdtH2XtpRxKPXxREjS5wUAbPVwVprENV4wQ3]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jonathan&nbsp;Northcroft and Anne Marie Batson look forward to Sunday's final. Their six to watch? Neymar, Mbappe, Di Maria, Lewandowski, Gnabry and Davies, They praise Europa League finalist Romelu Lukaku, and analyse the task fa...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan&nbsp;Northcroft and Anne Marie Batson look forward to Sunday's final. Their six to watch? Neymar, Mbappe, Di Maria, Lewandowski, Gnabry and Davies, They praise Europa League finalist Romelu Lukaku, and analyse the task facing Arsenal Women, the only remaining English team in European competition.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan&nbsp;Northcroft and Anne Marie Batson look forward to Sunday's final. Their six to watch? Neymar, Mbappe, Di Maria, Lewandowski, Gnabry and Davies, They praise Europa League finalist Romelu Lukaku, and analyse the task facing Arsenal Women, the only remaining English team in European competition.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Pep Guardiola and Ole Gunnar Solksjaer the best managers for City and United?</title>
			<itunes:title>Are Pep Guardiola and Ole Gunnar Solksjaer the best managers for City and United?</itunes:title>
			<pubDate>Mon, 17 Aug 2020 14:34:56 GMT</pubDate>
			<itunes:duration>49:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/arepepguardiolaandolegunnarsolksjaerthebestmanagersforcityandunited-/media.mp3" length="117696128" type="audio/mpeg"/>
			<guid isPermaLink="false">388b4313-1d26-4f59-91d3-cacf50ea8768</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/arepepguardiolaandolegunnarsolksjaerthebestmanagersforcityandunited-</link>
			<acast:episodeId>388b4313-1d26-4f59-91d3-cacf50ea8768</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>arepepguardiolaandolegunnarsolksjaerthebestmanagersforcityandunited-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9zP+zF3luVZp9yoMTxLtS/UBR0Wzg3WyYPbyS182VldzM7URKy1iVRp3ZWupyZ+G+QHK0U17YPKUxeYlXAA/9oWMy3TtwGj5pRa9NU2jItd83PzbTJFysMX9chxbC/y1qDfFz0tSLIEKXXmEBdYDcWrHrphT/2pMtuUe/4laU/7MUv56UBOMfjnwxC88zVTPxoIYY4bFtFBr+XQOaT1IYWKMgdva8cLdeCX8sHLANzkZSNPE/N5vz3QKLTUBVFGs2]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Alyson Rudd and Jordan Jarrett Bryan call for Pep Guardiola to commit himself, long term, to Manchester City. They consider the merits of Mauricio Pochettino over Ole Gunnar Solksjaer, analyse&nbsp;]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Alyson Rudd and Jordan Jarrett Bryan call for Pep Guardiola to commit himself, long term, to Manchester City. They consider the merits of Mauricio Pochettino over Ole Gunnar Solksjaer, analyse&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Alyson Rudd and Jordan Jarrett Bryan call for Pep Guardiola to commit himself, long term, to Manchester City. They consider the merits of Mauricio Pochettino over Ole Gunnar Solksjaer, analyse&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Pep Guardiola reach his Holy Grail?</title>
			<itunes:title>Will Pep Guardiola reach his Holy Grail?</itunes:title>
			<pubDate>Thu, 13 Aug 2020 14:27:57 GMT</pubDate>
			<itunes:duration>54:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willpepguardiolareachhisholygrail-/media.mp3" length="131317568" type="audio/mpeg"/>
			<guid isPermaLink="false">84308b6e-ce26-4415-8034-d646892de65d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willpepguardiolareachhisholygrail-</link>
			<acast:episodeId>84308b6e-ce26-4415-8034-d646892de65d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willpepguardiolareachhisholygrail-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRAzAY96ku88BQ2cYL82phjUqW5ow9i0Q9JX5YS5SJdmob8cQwX/OwxJbqQEppuYvWT/zk9OUFwBFOW1GmvyKFjUdYXuOHDdj1pQoaHQUlvoIA5UoX9NdL55CT1aVZ7vdqlDZmZkrRzEVkc4h+OyQPOFx3pHdDnYu1on8VHaQXCHJTVSuR4D5ocvZsJdu4jO9gINFQivQNLHuP9IR9F5nsymGRCYRxyH3HmQou7SZUClVGUrYs3kSXmKFhCBGgtsPU/QwHfmyYOIFpXDOG/xMyjKPwNMU5kCJQzjwOBB+n44Y]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Dom Fifield and John Cross assess Manchester City, and the three wins they need to be European champions. They discuss Barcelona's faults, Neymar's impact, Lewandowski's status, and the threat Antonio Conte represents to Man...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dom Fifield and John Cross assess Manchester City, and the three wins they need to be European champions. They discuss Barcelona's faults, Neymar's impact, Lewandowski's status, and the threat Antonio Conte represents to Manchester United's chances of winning the Europa League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dom Fifield and John Cross assess Manchester City, and the three wins they need to be European champions. They discuss Barcelona's faults, Neymar's impact, Lewandowski's status, and the threat Antonio Conte represents to Manchester United's chances of winning the Europa League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can anyone beat Bayern?</title>
			<itunes:title>Can anyone beat Bayern?</itunes:title>
			<pubDate>Mon, 10 Aug 2020 15:09:33 GMT</pubDate>
			<itunes:duration>48:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/cananyonebeatbayern-/media.mp3" length="117478208" type="audio/mpeg"/>
			<guid isPermaLink="false">5272d633-1119-4b15-ace0-a9303000125b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/cananyonebeatbayern-</link>
			<acast:episodeId>5272d633-1119-4b15-ace0-a9303000125b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>cananyonebeatbayern-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRIAKZKVJ9PIecoRMV/2qBmy2PlWddj5UVAHvcuo5qxcd4RKGFYTr+7r21Ubwphoi/VkS/s96E1vNJYnPvgKVQX1gFd8XGogbDYb+3V65fgCrWqSgZZtsywTBLyB+x6fJ8PYLfK8gC06xnfB4UIe6RJoIwyVLuB0AINIubU1emukOFvNfafDDdbVhcbmnmJDAt3nGq+M8zHnh1u4B3ukLARGeURuMwgWaVbSkd1ZeMsZRsTVGloBJaQ2YNYGB5w8u2hUrb8HHMKPAzA5hsuEi61VGiYlMi+gyNAsRuesYqvea]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin Adrian Clarke and Seb Stafford Bloor make Manchester City third favourites for the Champions League, behind Bayern and Atletico Madrid. They see Wolves as Manchester United's biggest threat in the Europa League, question&nbsp;Andre...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin Adrian Clarke and Seb Stafford Bloor make Manchester City third favourites for the Champions League, behind Bayern and Atletico Madrid. They see Wolves as Manchester United's biggest threat in the Europa League, question&nbsp;Andrea Pirlo's appointment at Juventus, and doubt the viability of the EFL's&nbsp;salary cap.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin Adrian Clarke and Seb Stafford Bloor make Manchester City third favourites for the Champions League, behind Bayern and Atletico Madrid. They see Wolves as Manchester United's biggest threat in the Europa League, question&nbsp;Andrea Pirlo's appointment at Juventus, and doubt the viability of the EFL's&nbsp;salary cap.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Must Manchester City win the Champions League before Pep Guardiola leaves?</title>
			<itunes:title>Must Manchester City win the Champions League before Pep Guardiola leaves?</itunes:title>
			<pubDate>Thu, 06 Aug 2020 15:37:01 GMT</pubDate>
			<itunes:duration>52:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mustmanchestercitywinthechampionsleaguebeforepepguardiolaleaves-/media.mp3" length="50230280" type="audio/mpeg"/>
			<guid isPermaLink="false">733c30df-13f8-41f4-8143-a2ddff4ef36f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mustmanchestercitywinthechampionsleaguebeforepepguardiolaleaves-</link>
			<acast:episodeId>733c30df-13f8-41f4-8143-a2ddff4ef36f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mustmanchestercitywinthechampionsleaguebeforepepguardiolaleaves-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9ysmvW2X3InBNubWRqGvF7GRcZs+gFfElPSWuXoACvClpk95OOsqTByynSITkwVWGKoDbfnJQXJGxw2dEVyC9FqVKNYB8isxJSIxVQcZwgzLc7uGaUwarGj04IjNa/cWGj5bbdBhvhQ/sxkLgBHnmipoV4HF9TPu1q8CadoUaBOF3qhO6xSpVhl4YMD90t0S6Be20sxclH+QgMOGb8UZX/zySA+6G/IaPMJEn9Sliv3/xt1iWcIONfswB6CajbtAN]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Darren Lewis and Anne Marie Batson weigh up City's chances against Real Madrid when the Champions League resumes. They discuss the morality of huge transfer investments when clubs like Arsenal are announcing redundancies, consider Gar...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Anne Marie Batson weigh up City's chances against Real Madrid when the Champions League resumes. They discuss the morality of huge transfer investments when clubs like Arsenal are announcing redundancies, consider Gareth Bale's future, and call for big clubs to renounce FA Cup prize money for the common good.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Anne Marie Batson weigh up City's chances against Real Madrid when the Champions League resumes. They discuss the morality of huge transfer investments when clubs like Arsenal are announcing redundancies, consider Gareth Bale's future, and call for big clubs to renounce FA Cup prize money for the common good.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Should Manchester United take the Europa League seriously?</title>
			<itunes:title>Should Manchester United take the Europa League seriously?</itunes:title>
			<pubDate>Mon, 03 Aug 2020 13:30:36 GMT</pubDate>
			<itunes:duration>52:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/shouldmanchesterunitedtaketheeuropaleagueseriously-/media.mp3" length="50342453" type="audio/mpeg"/>
			<guid isPermaLink="false">75ae1b4a-117f-4e71-ba94-109262e8fa38</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/shouldmanchesterunitedtaketheeuropaleagueseriously-</link>
			<acast:episodeId>75ae1b4a-117f-4e71-ba94-109262e8fa38</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>shouldmanchesterunitedtaketheeuropaleagueseriously-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz92AEN9x6oDuRvjBviaiUedOsokIlOr856Vh2XF6cjo8c1UdkseN9FnAXnzViSkU2AEz7ohOb/SfM4hK+H6uuSMnBVri9fnzZTIyE2ib7otd6D5VLPm9+3d65u8BwNXhrQsbRThLjRXIvqf1IzS7nWGQSx6h/ZvXyUesDvPecqPsF6IucApWZ5/u9WrY2bgwsKrnCWt5Q2ClmquX2H46ep2ztQeMerh1W9shtbVQvYLtTDkIBa1K0gq5cN1utl5LY0]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Ade Oladipo and Miguel Delaney believe United have a real chance of a European trophy. They analyse the fallout from the FA Cup final, preview the Championship play off final, and have far-reaching views on the state of the modern game.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Ade Oladipo and Miguel Delaney believe United have a real chance of a European trophy. They analyse the fallout from the FA Cup final, preview the Championship play off final, and have far-reaching views on the state of the modern game.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Ade Oladipo and Miguel Delaney believe United have a real chance of a European trophy. They analyse the fallout from the FA Cup final, preview the Championship play off final, and have far-reaching views on the state of the modern game.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will underdogs Arsenal lift the FA Cup?</title>
			<itunes:title>Will underdogs Arsenal lift the FA Cup?</itunes:title>
			<pubDate>Thu, 30 Jul 2020 15:37:44 GMT</pubDate>
			<itunes:duration>50:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willunderdogsarsenalliftthefacup-/media.mp3" length="120568448" type="audio/mpeg"/>
			<guid isPermaLink="false">8fd82dad-b6c8-4c9c-ad0c-5f7bd7940c03</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willunderdogsarsenalliftthefacup-</link>
			<acast:episodeId>8fd82dad-b6c8-4c9c-ad0c-5f7bd7940c03</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willunderdogsarsenalliftthefacup-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPGq5Nwjz5OWCanDQT2idtwNAWwMmpJTlw97wszfMHCYkPbOJH6Oev5uVUAbp39ZinEXxAudf90lTA3bXTO7NDPcMSOfboDjT7r6YamL4iqUJzmSTyHHiK0j0IKpGRipf7MZWGvPIWeezU1O2ZVfWmjRA8/gleI6hPXehX4Sx9OUdoHvwFQkqtOGdJNaL+vN3OuQ5xf9hIQ5GmOKzFgCJL/uSytf5juzsWUrr2vAgoN5ybr8jIyDzrGjHpupbCar/kSBvhJ1z19C47pruVDJd7RkztnuoanmSQRNjxlQci1E]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Richard Amofa believe a Wembley win is essential to aid Mikel Arteta's team building. They also consider Brentford's Premier League potential, the season's best and worst transfers, and name their breakthro...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Richard Amofa believe a Wembley win is essential to aid Mikel Arteta's team building. They also consider Brentford's Premier League potential, the season's best and worst transfers, and name their breakthrough players.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Richard Amofa believe a Wembley win is essential to aid Mikel Arteta's team building. They also consider Brentford's Premier League potential, the season's best and worst transfers, and name their breakthrough players.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>What do Manchester United need to do to become legitimate title challengers?</title>
			<itunes:title>What do Manchester United need to do to become legitimate title challengers?</itunes:title>
			<pubDate>Mon, 27 Jul 2020 15:12:32 GMT</pubDate>
			<itunes:duration>44:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatdomanchesterunitedneedtodotobecomelegitimatetitlechallengers-/media.mp3" length="105927488" type="audio/mpeg"/>
			<guid isPermaLink="false">41e4344b-6b99-4630-9e6d-3a4cea53e94e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatdomanchesterunitedneedtodotobecomelegitimatetitlechallengers-</link>
			<acast:episodeId>41e4344b-6b99-4630-9e6d-3a4cea53e94e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatdomanchesterunitedneedtodotobecomelegitimatetitlechallengers-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRIUgOPuIFNVMdgOu6utwbIitZ5bL99V1gPXGILZmLcr82aaDFzUBNy7QaJ/xVE0nVbyR8aDykXiHTrWJik4mNBfP9HgTez7LO2FzVnqFjDTY48iQEgygv5/2KqfKKrdY+M+O0Lu6XzWXAE/br+iKZNJ8P/RS6eNdvb0d1TCbqoiF2PZdMgjch3wmXTVlQpemOVsmwCm/VZHw5TNUGZqAYNHbZh76rSjpKQUSmq+K4+XtUEWE2Z7MPa/Is83OIepNDYnDUntxc3iqcjqMTJ4/dsZWHzJAv26M7p7U/uxAozV0]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Seb Stafford Bloor and Art de Roche discuss United's strengths and weaknesses in what, for them, is an especially extended season, They also assess European qualifiers, consider Eddie Howe's&nbsp;future, and wonder which, if ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Art de Roche discuss United's strengths and weaknesses in what, for them, is an especially extended season, They also assess European qualifiers, consider Eddie Howe's&nbsp;future, and wonder which, if any, of the relegated teams will bounce back immediately.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Art de Roche discuss United's strengths and weaknesses in what, for them, is an especially extended season, They also assess European qualifiers, consider Eddie Howe's&nbsp;future, and wonder which, if any, of the relegated teams will bounce back immediately.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Liverpool maintain their dominance of the Premier League?</title>
			<itunes:title>Will Liverpool maintain their dominance of the Premier League?</itunes:title>
			<pubDate>Thu, 23 Jul 2020 15:29:21 GMT</pubDate>
			<itunes:duration>50:10</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willliverpoolmaintaintheirdominanceofthepremierleague-/media.mp3" length="120410048" type="audio/mpeg"/>
			<guid isPermaLink="false">c97e0000-29e5-491a-9d66-a346c1146bf1</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willliverpoolmaintaintheirdominanceofthepremierleague-</link>
			<acast:episodeId>c97e0000-29e5-491a-9d66-a346c1146bf1</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willliverpoolmaintaintheirdominanceofthepremierleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRMb75vKAzUYpc0ZEtIKxFW3dyW0BHSnkyzGduyeuqGfS7yOXb6DpWx35fgS5kdZrYlWbkpN/P2GcDdzd86qZL/Ti4+bVEYFLNGb/aw6TcEkibxlBxpRBzWkRdFhFztyr1Hf/rJT63u/37VIxPOilstyQCK4sYphQ501DhFj26M33Ees3+MAFnH4wnk5R6vI3sidNr1O3xnidqgR3SEDOa0sbkI/jB9ApFmd3+fyC5Vb2TFg4FCFBvpN91TfQO2Nd6FOdo5RjOx13yDWV+Bk791NdyzOWKDmc/M7wpf+Jv6ut]]></acast:settings>
			<itunes:subtitle>Mike Calvin Jonathan Northcroft and Jordan Jarrett Bryan see more success on the horizon for the new champions. They outline weaknesses in their principal challengers, consider their Footballer of the Year candidates, and wonder whether Watford will re...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin Jonathan Northcroft and Jordan Jarrett Bryan see more success on the horizon for the new champions. They outline weaknesses in their principal challengers, consider their Footballer of the Year candidates, and wonder whether Watford will regret sacking Nigel Pearson.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin Jonathan Northcroft and Jordan Jarrett Bryan see more success on the horizon for the new champions. They outline weaknesses in their principal challengers, consider their Footballer of the Year candidates, and wonder whether Watford will regret sacking Nigel Pearson.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Should Pep Guardiola's record at Manchester City come under greater scrutiny?]]></title>
			<itunes:title><![CDATA[Should Pep Guardiola's record at Manchester City come under greater scrutiny?]]></itunes:title>
			<pubDate>Mon, 20 Jul 2020 15:21:04 GMT</pubDate>
			<itunes:duration>50:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/shouldpepguardiolasrecordatmanchestercitycomeundergreaterscrutiny-/media.mp3" length="120101888" type="audio/mpeg"/>
			<guid isPermaLink="false">6979f730-b8ef-4093-ac00-3fc0f026e9da</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/shouldpepguardiolasrecordatmanchestercitycomeundergreaterscrutiny-</link>
			<acast:episodeId>6979f730-b8ef-4093-ac00-3fc0f026e9da</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>shouldpepguardiolasrecordatmanchestercitycomeundergreaterscrutiny-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBRGOjSXxqLkaRPnHAyLgn1s892rBFhQUu2CjG0rRRV4u7770HTaZBYGsGX8G8FqwC/MtJhPrWC5KSiO8l+mqlRM7O7P68PNvkgBeWPZSF87t7PHoZcrUX9W6ncUKo3M46++Bh3XsaoLQNY3kurlLfBaWv32S1bRCe+e13/xmJskQJTdF9ojJ1U0SqRP9VVTJ3EXUMdrfJPgXHCWoh3HAfLI76ysXvAK5gkOgTWC6MoFhA+wBcaGG+EvcnlLxkgEbV4hCGL0M8rcg9r5RmWk7+iEqe8l5imwy4hYjaRI36C6]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor question Manchester's Big Two,&nbsp;Pep Guardiola and&nbsp;Ole Gunnar Solksjaer, They call for Mikel Arteta to be backed financially at Arsenal, look forward to Marcelo Bielsa's arriva...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor question Manchester's Big Two,&nbsp;Pep Guardiola and&nbsp;Ole Gunnar Solksjaer, They call for Mikel Arteta to be backed financially at Arsenal, look forward to Marcelo Bielsa's arrival in the Premier League, and condemn Watford's sacking of Nigel Pearson&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor question Manchester's Big Two,&nbsp;Pep Guardiola and&nbsp;Ole Gunnar Solksjaer, They call for Mikel Arteta to be backed financially at Arsenal, look forward to Marcelo Bielsa's arrival in the Premier League, and condemn Watford's sacking of Nigel Pearson&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will the FA Cup final be a Manchester derby?</title>
			<itunes:title>Will the FA Cup final be a Manchester derby?</itunes:title>
			<pubDate>Thu, 16 Jul 2020 14:58:23 GMT</pubDate>
			<itunes:duration>45:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willthefacupfinalbeamanchesterderby-/media.mp3" length="109726208" type="audio/mpeg"/>
			<guid isPermaLink="false">436fa3d6-e23b-4688-8558-0d20e7b31c3b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willthefacupfinalbeamanchesterderby-</link>
			<acast:episodeId>436fa3d6-e23b-4688-8558-0d20e7b31c3b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willthefacupfinalbeamanchesterderby-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9cHB5+wfMGLXCdaKtysqjEwW4zD+/GLcqYnRmkUlysViTB/Q6lIApu9oDduwihEjVo9oB+20a4HKZZVh3lf0j/E4yXpDNxrlGi4zJZmertBrEFaSZBXgLILlmKTCSDI2FiOR8Xwi2sxKw3HIJdnquixqq43vVwpICz+Y1ce0diDc9SbmCRohqSeQ9cJD2IpQVTdJ4onku0gIeuRPOj6mfYg/9thHKHyaCAKvHa9IJr0eqo/LlGBarcMj9NJTaaHSA]]></acast:settings>
			<itunes:subtitle><![CDATA[Despite doubts about United's priorities, Mike Calvin, Adrian Clarke and Seb Stafford Bloor predict an all-Manchester FA Cup final. They discuss friction between leading managers, Wolves' chances of winning the Europa League, and call for a r...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Despite doubts about United's priorities, Mike Calvin, Adrian Clarke and Seb Stafford Bloor predict an all-Manchester FA Cup final. They discuss friction between leading managers, Wolves' chances of winning the Europa League, and call for a refereeing revolution.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Despite doubts about United's priorities, Mike Calvin, Adrian Clarke and Seb Stafford Bloor predict an all-Manchester FA Cup final. They discuss friction between leading managers, Wolves' chances of winning the Europa League, and call for a refereeing revolution.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[The most important victory in Manchester City's history?]]></title>
			<itunes:title><![CDATA[The most important victory in Manchester City's history?]]></itunes:title>
			<pubDate>Mon, 13 Jul 2020 15:05:19 GMT</pubDate>
			<itunes:duration>49:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/themostimportantvictoryinmanchestercityshistory-/media.mp3" length="119380928" type="audio/mpeg"/>
			<guid isPermaLink="false">fd399b6f-9f95-4ab8-9c7c-feb9a025ad98</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/themostimportantvictoryinmanchestercityshistory-</link>
			<acast:episodeId>fd399b6f-9f95-4ab8-9c7c-feb9a025ad98</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>themostimportantvictoryinmanchestercityshistory-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9NZAIAr2v3miGJogWakytOXBkeD3jvh1mK35jWppo9XK3vWsLXQtKgRCE2Ukv/c1she32XiU8n6BzfcPyrHRJzagtewT1/LFr+W9wBtqkULRRAcyc4Olv9trG6sPeqI5CASnTta01ZXIroKoHkbdXXbmSs+S/Bd2PjnOy/qRrezCVHBnYn431Mvfe5369TTnraYIepRxNmYrg5Kn+fcstJejGq3+ePXQRbJBMjC1EqjfVW165AautBs1w8oSqu3ew]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor discuss the overturning of City's Champions League ban. Is football about to enter a&nbsp;new era, in which limits on spending are abandoned? Who will benefit, and how will the race to qualify ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor discuss the overturning of City's Champions League ban. Is football about to enter a&nbsp;new era, in which limits on spending are abandoned? Who will benefit, and how will the race to qualify for next season's competition pan out?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor discuss the overturning of City's Champions League ban. Is football about to enter a&nbsp;new era, in which limits on spending are abandoned? Who will benefit, and how will the race to qualify for next season's competition pan out?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>How badly is football missing the fans?</title>
			<itunes:title>How badly is football missing the fans?</itunes:title>
			<pubDate>Thu, 09 Jul 2020 15:20:32 GMT</pubDate>
			<itunes:duration>52:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/howbadlyisfootballmissingthefans-/media.mp3" length="126908288" type="audio/mpeg"/>
			<guid isPermaLink="false">b2f652d5-10f9-43b4-8d68-c6e5061d8867</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/howbadlyisfootballmissingthefans-</link>
			<acast:episodeId>b2f652d5-10f9-43b4-8d68-c6e5061d8867</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>howbadlyisfootballmissingthefans-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRNopTovn0jlNmFOaotNrvtHsWYGZRdXjwHff4PQXT+sxZ6uXAZtgaIPtoHPP9VMvqFhDLD1FfJn70/Qd+EFI2Qhj1umYz5XEKfoz9lBNdQybDvrq8WQlbB6MwsdARwAxYL+woVDLeRex3rGkr6xGB0BIXBtLdMNg0RP43Inrdy/OnVNox4jvKvEomEjsJ0d3FEBANkxB7Wi2gTiNmH8k1SWIMjhch6XHPv+pTFHpYhO5utVj59pyRH1d/6ca4po70+Z9hJYrMjWxqJ/3vU2b48gZS3Fqa1JZAP0NDTCgdcne]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor assess how football is faring, three weeks into Project Restart. Which initiatives&nbsp;will endure, and how will the game change? They also look at the transfer market, the relegation struggle, and...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor assess how football is faring, three weeks into Project Restart. Which initiatives&nbsp;will endure, and how will the game change? They also look at the transfer market, the relegation struggle, and the under-appreciated excellence of Sean Dyche.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor assess how football is faring, three weeks into Project Restart. Which initiatives&nbsp;will endure, and how will the game change? They also look at the transfer market, the relegation struggle, and the under-appreciated excellence of Sean Dyche.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Jose Mourinho be successful at Tottenham?</title>
			<itunes:title>Will Jose Mourinho be successful at Tottenham?</itunes:title>
			<pubDate>Mon, 06 Jul 2020 15:06:33 GMT</pubDate>
			<itunes:duration>53:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willjosemourinhobesuccessfulattottenham-/media.mp3" length="129551168" type="audio/mpeg"/>
			<guid isPermaLink="false">9dfbd9f8-0c90-4b7a-a2e5-f9ff0ad29d55</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willjosemourinhobesuccessfulattottenham-</link>
			<acast:episodeId>9dfbd9f8-0c90-4b7a-a2e5-f9ff0ad29d55</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willjosemourinhobesuccessfulattottenham-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRMTne7h/VUfHa+a5aPdwbopscaWY/g2CQzh3evbBD8f7nkEpbZbh68gZtZlAPNMWESxE21YvbtNSFJ9dSPdCofGVAcrmy5U8+bcq7LhxH10+ryWQ8bMwU43lelZ/xs/OlfkhMmqwRerqovogyA4ye+KRzkKHL2ut+TZNsyN47y5tSBBfAwtmO4AODlzClL/3cP4F2/w75V6erPo48jr4OKSuKlbTJfQWz4yaMHPW8BcNl8c7Zo3pP4UUHKKr60Lkxuq59ebN5vvSrPEEb7Zwa18ysXLZ3mX4jgtMiuMdUPrs]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke discuss Jose&nbsp;Mourinho's troubled start as Spurs manager. They also hail the emergence of Mason Greenwood and the potential of a new generation of English footballers.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke discuss Jose&nbsp;Mourinho's troubled start as Spurs manager. They also hail the emergence of Mason Greenwood and the potential of a new generation of English footballers.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke discuss Jose&nbsp;Mourinho's troubled start as Spurs manager. They also hail the emergence of Mason Greenwood and the potential of a new generation of English footballers.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who is going down from the Premier League?</title>
			<itunes:title>Who is going down from the Premier League?</itunes:title>
			<pubDate>Thu, 02 Jul 2020 15:59:50 GMT</pubDate>
			<itunes:duration>52:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whoisgoingdownfromthepremierleague-/media.mp3" length="126318848" type="audio/mpeg"/>
			<guid isPermaLink="false">8106934a-6e97-4931-8632-9d00156d8d23</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whoisgoingdownfromthepremierleague-</link>
			<acast:episodeId>8106934a-6e97-4931-8632-9d00156d8d23</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whoisgoingdownfromthepremierleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9U70Ug+3maFMuKk+aDvtMAYsgwxIhxvQf50U/MjAPS9zCTLFHSlphGMSmyTiX6M1jAOZuXv/5i6q/tz1wpbpdXNMDLuYpcg6yJOktjYwK0D9+R7qPlrUUtNNJmsnDDSL81g8SqSxJoiuAPrP0Y+tbgZp9gp7ApM9VRYhedLBkixZ0kFl2NLKagLWf8fHFB4eP0y/Sves+D+jCbqGJ/zqhi/LaaJkPWUz5P4syDOUyIsjzK2uFvlY+L7l2PrW5RMVx]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor&nbsp;assess the Premier League relegation battle. They hold out little hope for Norwich and Bournemouth, but who do they tip to avoid the drop?]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor&nbsp;assess the Premier League relegation battle. They hold out little hope for Norwich and Bournemouth, but who do they tip to avoid the drop?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor&nbsp;assess the Premier League relegation battle. They hold out little hope for Norwich and Bournemouth, but who do they tip to avoid the drop?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is this the start of a Liverpool dynasty?</title>
			<itunes:title>Is this the start of a Liverpool dynasty?</itunes:title>
			<pubDate>Mon, 29 Jun 2020 14:33:51 GMT</pubDate>
			<itunes:duration>53:39</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthisthestartofaliverpooldynasty-/media.mp3" length="128777408" type="audio/mpeg"/>
			<guid isPermaLink="false">c27deaf5-28b1-4251-8bc2-24439fedbd8b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthisthestartofaliverpooldynasty-</link>
			<acast:episodeId>c27deaf5-28b1-4251-8bc2-24439fedbd8b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthisthestartofaliverpooldynasty-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRJH5vA/6m2CzLlbQ5JzIhUS8knztSAdDsD2b4gP8QBykan9w45dk1ZRx5lBA0UKawXvdtbEDVCXZRqSDeHeqUwLPBJTm5cwj+5HvosK4lZIWDWHdsVfubMKs/JxZEsjRpy0bs0oyhEF2rkm3rJfTmk1Os692E09PdcGQQRHHv/vcRqcv5jlwxOruRish+6upRLqwWeTQ/9W6VwP3I5JbBxWanSXQC2u89yViYeymjJe7seRL0h7FJCMS/npu0+wa0cfXm532SYQ86McnL+BpGZ5TdrOq62+xyL1V4Coq6rvs]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor discuss how rivalries at the top of the Premier League will deepen and develop, Where&nbsp;will the strongest challenge to Liverpool come from? Can Manchester City win the treble, and how will the F...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor discuss how rivalries at the top of the Premier League will deepen and develop, Where&nbsp;will the strongest challenge to Liverpool come from? Can Manchester City win the treble, and how will the FA Cup semi finals pan out?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor discuss how rivalries at the top of the Premier League will deepen and develop, Where&nbsp;will the strongest challenge to Liverpool come from? Can Manchester City win the treble, and how will the FA Cup semi finals pan out?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Manchester United win the FA Cup this season?</title>
			<itunes:title>Will Manchester United win the FA Cup this season?</itunes:title>
			<pubDate>Fri, 26 Jun 2020 06:38:10 GMT</pubDate>
			<itunes:duration>41:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willmanchesterunitedwinthefacupthisseason-/media.mp3" length="99740288" type="audio/mpeg"/>
			<guid isPermaLink="false">a7322e26-b1c5-4372-b9d7-43ab6e45bb24</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willmanchesterunitedwinthefacupthisseason-</link>
			<acast:episodeId>a7322e26-b1c5-4372-b9d7-43ab6e45bb24</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willmanchesterunitedwinthefacupthisseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROYP5vdyux5usM5ijPn95E4+l5BvyX9N7Ex0ZlunnWTsM21rPyRXhaBsLFLU4w9XiAgerQz4iSzLM19sofkqYvTNosqfS1sCZ8OOhoBiK58cZ5IxvIdCU06A3zQQlPgUjm3qsfbyuWvPOVYjdl2TlBfRYYkBKKGCUURoinuZYvaaNx3lwJhnGWtM9Re4EmHsipy3Qeru2jr1utjpImjkaZ7Rstl79y6j5nxuC5jbf/Ud8sr3Os9oFiCwI03iUURtlI0GafV8T2nb9NBEDOaP/D75IAH3AxkrulvmdaN/pizI]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Seb Stafford Bloor preview this weekend's FA Cup quarter finals. They make United favourites, but warn that Arsenal can no longer be classified as a big club.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Seb Stafford Bloor preview this weekend's FA Cup quarter finals. They make United favourites, but warn that Arsenal can no longer be classified as a big club.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jordan Jarrett Bryan and Seb Stafford Bloor preview this weekend's FA Cup quarter finals. They make United favourites, but warn that Arsenal can no longer be classified as a big club.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Liverpool win the Premier League tonight?</title>
			<itunes:title>Will Liverpool win the Premier League tonight?</itunes:title>
			<pubDate>Thu, 25 Jun 2020 12:30:07 GMT</pubDate>
			<itunes:duration>18:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willliverpoolwinthepremierleaguetonight-/media.mp3" length="44886848" type="audio/mpeg"/>
			<guid isPermaLink="false">8cb1c0ff-ac65-4404-8c19-dd9bd57cb5f5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willliverpoolwinthepremierleaguetonight-</link>
			<acast:episodeId>8cb1c0ff-ac65-4404-8c19-dd9bd57cb5f5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willliverpoolwinthepremierleaguetonight-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9iA5js99Nf3AuDi6kqewvYZX1zBGiYDnj3kJCPP8McZ609+a5WEb78xW5tFN+uw25qn0gUvJ1lKoMhwPuW3K7prD90cwNBMjNFoetlBjr2/n1g6zdRd66uDmCXF4+HTbbK7nSjsWkKzOaPJIEN0Tk7icN1l8/EAJkjrTOrUGGpPPnKlWz2VSiM2gWcmBzFnq0]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Seb Stafford Bloor and Jordan Jarret Bryan look forward to tonight's potentially decisive game between Chelsea and Manchester City at Stamford Bridge. Two believe Liverpool's long&nbsp;wait will be over in a matter of hours....]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Jordan Jarret Bryan look forward to tonight's potentially decisive game between Chelsea and Manchester City at Stamford Bridge. Two believe Liverpool's long&nbsp;wait will be over in a matter of hours....<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Jordan Jarret Bryan look forward to tonight's potentially decisive game between Chelsea and Manchester City at Stamford Bridge. Two believe Liverpool's long&nbsp;wait will be over in a matter of hours....<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Chelsea - is the Empire about to strike back?</title>
			<itunes:title>Chelsea - is the Empire about to strike back?</itunes:title>
			<pubDate>Mon, 22 Jun 2020 14:31:24 GMT</pubDate>
			<itunes:duration>57:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/chelsea-istheempireabouttostrikeback-/media.mp3" length="138587648" type="audio/mpeg"/>
			<guid isPermaLink="false">0cd2a486-3b79-4aaf-a039-967eae9de821</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/chelsea-istheempireabouttostrikeback-</link>
			<acast:episodeId>0cd2a486-3b79-4aaf-a039-967eae9de821</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>chelsea-istheempireabouttostrikeback-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9KL0wyjQfEz4M6I+6oObBXGkaU72aUitUevd7YjWePeHQkuxGjrYqwSmS7Nx1pq9wDyhMoawGx0VSGldq8lgUkyJHppa9aZ73MCSa+wnoa4Jj79t8oApT+RVgO+aVjdnpR2aT2IDiKXtRPk2sVOcC5H6OU5rK8QWdnY0kPthFOFIo8pUnnQWiZjaETZlxA3QoGvsuzlmimSbKOBRzMp5R59VgwvjJUuH+eBlzz0hnajgfPEd0JRAB/OBFh6kH+roH]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor forecast a bright future for Chelsea, once the formalities of Liverpool's title win are completed. They wonder whether Wolves are too good for their own good, and analyse the struggle to avoid rele...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor forecast a bright future for Chelsea, once the formalities of Liverpool's title win are completed. They wonder whether Wolves are too good for their own good, and analyse the struggle to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor forecast a bright future for Chelsea, once the formalities of Liverpool's title win are completed. They wonder whether Wolves are too good for their own good, and analyse the struggle to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>With the Premier League title effectively conceded, what next for Manchester City?</title>
			<itunes:title>With the Premier League title effectively conceded, what next for Manchester City?</itunes:title>
			<pubDate>Thu, 18 Jun 2020 15:17:42 GMT</pubDate>
			<itunes:duration>54:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/withthepremierleaguetitleeffectivelyconceded-whatnextformanchestercity-/media.mp3" length="129802688" type="audio/mpeg"/>
			<guid isPermaLink="false">bfff8d0c-33ee-437b-ab82-19347d06710d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/withthepremierleaguetitleeffectivelyconceded-whatnextformanchestercity-</link>
			<acast:episodeId>bfff8d0c-33ee-437b-ab82-19347d06710d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>withthepremierleaguetitleeffectivelyconceded-whatnextformanchestercity-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRKaZu2WjRmr9IfHNaR7ggxTGSHbmU0YOQka+Xp2rzmFtCX8iQEVvFOjQ2VQT9SgXdqla/GRU8sU5bwB2VlGdrMtuT4DNDF7yjvxjYtiatpY2KrB6O+v/dRmahHanEXkm/yVs//4zTmrUFkf6xXiif3sOqya252Vebx4DHildtbjkzjUwCKPEvvgHOnhpwBygKsiBjH5xzhUD/lfEiBBc798iZVB894QaOhjq5qKnCKTogmr4xN+RCaKoXr0iYnXv0zINVo2Aacp/QGCULD/n2bL9BwxpKkpXkvcEOa2Nx/Kf]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke prepare for Liverpool's coronation, and ask whether Manchester City can win the Champions League. They condemn&nbsp;technological injustice and consider the good and bad aspects of player power.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke prepare for Liverpool's coronation, and ask whether Manchester City can win the Champions League. They condemn&nbsp;technological injustice and consider the good and bad aspects of player power.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke prepare for Liverpool's coronation, and ask whether Manchester City can win the Champions League. They condemn&nbsp;technological injustice and consider the good and bad aspects of player power.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Football's back. What have you missed most?]]></title>
			<itunes:title><![CDATA[Football's back. What have you missed most?]]></itunes:title>
			<pubDate>Mon, 15 Jun 2020 14:47:04 GMT</pubDate>
			<itunes:duration>54:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/footballsback.whathaveyoumissedmost-/media.mp3" length="130595648" type="audio/mpeg"/>
			<guid isPermaLink="false">603daf4c-b65d-4da4-99cd-c4e8cc03b456</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/footballsback.whathaveyoumissedmost-</link>
			<acast:episodeId>603daf4c-b65d-4da4-99cd-c4e8cc03b456</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>footballsback.whathaveyoumissedmost-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Q2K5iUKZWKGTAkom31/EY5Lku68YyOFKtO/0xg9dXoFazkiQNfEXyTPN80bRhNbON/1tv/jBTjHWNAsx9wWqjVCS4/erJmV9M2g2Z+k4H0+tnt0xlsdKFDtYZhCTU4v06c02rsLBVOq2+6yCrAcIj3QLm8thjsrT+3DmS9AVX9euYgmzh+2lkrR7M16dGalaJeRcyJcvmP7C/bKygUt0o1TJxDY7FnM1YkQfcU1pE2qpY2F9IQN3Vf0y23e32kKA]]></acast:settings>
			<itunes:subtitle><![CDATA[With the Premier League returning this week, Mike Calvin, Seb Stafford Bloor and Adrian Clarke discuss the unique challenges of a mini season. They describe how football has been missed, and how it has gained a new leader, in Marcus Rashford.&nbsp;]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[With the Premier League returning this week, Mike Calvin, Seb Stafford Bloor and Adrian Clarke discuss the unique challenges of a mini season. They describe how football has been missed, and how it has gained a new leader, in Marcus Rashford.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[With the Premier League returning this week, Mike Calvin, Seb Stafford Bloor and Adrian Clarke discuss the unique challenges of a mini season. They describe how football has been missed, and how it has gained a new leader, in Marcus Rashford.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>What more can football do to tackle racism?</title>
			<itunes:title>What more can football do to tackle racism?</itunes:title>
			<pubDate>Thu, 11 Jun 2020 16:43:12 GMT</pubDate>
			<itunes:duration>54:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatmorecanfootballdototackleracism-/media.mp3" length="130592768" type="audio/mpeg"/>
			<guid isPermaLink="false">4234fb3b-3e52-47ee-917c-7ed8e915ff89</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatmorecanfootballdototackleracism-</link>
			<acast:episodeId>4234fb3b-3e52-47ee-917c-7ed8e915ff89</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatmorecanfootballdototackleracism-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRK2WgcQAt9Pg7k7pPRvZ93MWyFKfbN43c7IFvPMpf7ZCK+bYcBORTOkrzsFEETeAsrSaTm2W7OagAz1bNnFZf4ana5uSbrJmYIUzKWsW+a5dCjoC4ywSbIFzD0garVREt2iEDKFX0lP+eBRbhLAixV83LE10BZ8yD2+axu31+4M4KK8Zz7juZGOjG8Jn/mXCZhj8JvcMYdlme1hiNU/WgpbqwVbuk6F3Mt0l/aBjEh9SLAkRHTCny/+l0KDYbgHcgT10/TNVtXKKcE4uhgUBg/W/ZI9nMv1NFEa+RcXBgXyx]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Jordan Jarrett Bryan, Adrian Clarke and Seb Stafford Bloor for an honest and challenging debate on all aspects of racism in the modern game.&nbsp;]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Jordan Jarrett Bryan, Adrian Clarke and Seb Stafford Bloor for an honest and challenging debate on all aspects of racism in the modern game.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Jordan Jarrett Bryan, Adrian Clarke and Seb Stafford Bloor for an honest and challenging debate on all aspects of racism in the modern game.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Will Manchester City's appeal against a Champions League ban shape football's future?]]></title>
			<itunes:title><![CDATA[Will Manchester City's appeal against a Champions League ban shape football's future?]]></itunes:title>
			<pubDate>Mon, 08 Jun 2020 15:01:30 GMT</pubDate>
			<itunes:duration>48:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willmanchestercitysappealagainstachampionsleaguebanshapefootballsfuture-/media.mp3" length="115235648" type="audio/mpeg"/>
			<guid isPermaLink="false">ee92eda6-44e8-4bf6-a6fd-d2d6620715cc</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willmanchestercitysappealagainstachampionsleaguebanshapefootballsfuture-</link>
			<acast:episodeId>ee92eda6-44e8-4bf6-a6fd-d2d6620715cc</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willmanchestercitysappealagainstachampionsleaguebanshapefootballsfuture-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9DSSTIz5pEp6EpclN2T1MKjBK5qVElrYCbrgQ4gbZTeyVxKkRwFGQZ1AFx5ZsLSxQTi/ELRgemLmBXmlMm/DDu5lIDamI4iUnwjbUXYh36P2q377ZPwocbW9quU05waDhmQ47i7iN2BIatqvI9Cxgep8bKujpWluXeeweCXhO/g0wPF6Uq0HfVL/q34j8bF3201ON1Y2ow3aPJ/49wXq8Qvy4gKUs6/36a8+8INkQSXmlYZX3zh6nbZFg60ru9lbk]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke discuss a controversy that could be as significant as the Bosman ruling. They also examine Chelsea's recruitment strategy, chaos in League One, and Liverpool's relegation from the WSL.&nbsp;]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke discuss a controversy that could be as significant as the Bosman ruling. They also examine Chelsea's recruitment strategy, chaos in League One, and Liverpool's relegation from the WSL.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke discuss a controversy that could be as significant as the Bosman ruling. They also examine Chelsea's recruitment strategy, chaos in League One, and Liverpool's relegation from the WSL.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Which clubs are in deepest relegation trouble?</title>
			<itunes:title>Which clubs are in deepest relegation trouble?</itunes:title>
			<pubDate>Thu, 04 Jun 2020 14:49:33 GMT</pubDate>
			<itunes:duration>53:31</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whichclubsareindeepestrelegationtrouble-/media.mp3" length="128440448" type="audio/mpeg"/>
			<guid isPermaLink="false">895738d0-23e1-4d1c-a93a-88f4c5aa1b28</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whichclubsareindeepestrelegationtrouble-</link>
			<acast:episodeId>895738d0-23e1-4d1c-a93a-88f4c5aa1b28</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whichclubsareindeepestrelegationtrouble-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRKGSII99Ridb+rnKwHmz7eeeZAdxqmc6aEjxO7s47wgZDpGHm46HUzDB+5/mM72BPSwSJItkOdJMFn584ywGNkgA4HX+Axtd01WshoZMHFm5Lv3dr/7GndvJq9nGx7yc7m9HWbzQV8mCj8KUpj6gEm7eLbYhA3D4v8/TgPiePM/nXJ9cd5oikucB1if/YRmWGfkF8xuy0a5TMfT27nyzzkrMYpIJXzz0KSeBGVPQ/95WpXuQVQQaNr53EYkF0IhO2mjyswYzp30LkwT/kZpHTWU=]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor assess Premier League relegation candidates, and the importance of protecting football's competitive credibility. They also dwell on a week in which players were confirmed as powerful role&nbsp...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor assess Premier League relegation candidates, and the importance of protecting football's competitive credibility. They also dwell on a week in which players were confirmed as powerful role&nbsp;models.&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor assess Premier League relegation candidates, and the importance of protecting football's competitive credibility. They also dwell on a week in which players were confirmed as powerful role&nbsp;models.&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who has most to gain, and most to lose, when the Premier League resumes?</title>
			<itunes:title>Who has most to gain, and most to lose, when the Premier League resumes?</itunes:title>
			<pubDate>Mon, 01 Jun 2020 15:19:49 GMT</pubDate>
			<itunes:duration>54:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whohasmosttogain-andmosttolose-whenthepremierleagueresumes-/media.mp3" length="131705408" type="audio/mpeg"/>
			<guid isPermaLink="false">1d437b7b-3843-434c-a683-0f482b0b6fc2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whohasmosttogain-andmosttolose-whenthepremierleagueresumes-</link>
			<acast:episodeId>1d437b7b-3843-434c-a683-0f482b0b6fc2</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whohasmosttogain-andmosttolose-whenthepremierleagueresumes-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9ROpnfnWrqHWMthuf6fXVte71mpNds6yWP71mujCkPuJ5J6339Lb/HFf8WIKXHZssqohvN/tzpWjbH5fZVXDZvr7btvw+9756Aq7cR1HsCRjZOfEO2X8O6n0+vStFgTHwJGlniEehIzftfSvPdMHbwyUlDQW0CdomG9ePKGYb7ft0mv5aQyHMHgwWEi/oj//4LvaPMfKsTXNxKylGhG8HAK5ZQDWUU1o0btASWwrn7zfnjy3jogPEN2oAn0eaiLo7]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke expect Manchester United and Wolves to make a concerted push for the top four. They also celebrate footballers' freedom&nbsp;of expression, and&nbsp;name their latest batch of players to wa...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke expect Manchester United and Wolves to make a concerted push for the top four. They also celebrate footballers' freedom&nbsp;of expression, and&nbsp;name their latest batch of players to watch when football restarts.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Adrian Clarke expect Manchester United and Wolves to make a concerted push for the top four. They also celebrate footballers' freedom&nbsp;of expression, and&nbsp;name their latest batch of players to watch when football restarts.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Should fan-run clubs be part of football's survival plan?]]></title>
			<itunes:title><![CDATA[Should fan-run clubs be part of football's survival plan?]]></itunes:title>
			<pubDate>Thu, 28 May 2020 14:39:27 GMT</pubDate>
			<itunes:duration>51:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/shouldfan-runclubsbepartoffootballssurvivalplan-/media.mp3" length="122619968" type="audio/mpeg"/>
			<guid isPermaLink="false">6bd22f06-ddaf-4078-8ea4-a38062ea0d7b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/shouldfan-runclubsbepartoffootballssurvivalplan-</link>
			<acast:episodeId>6bd22f06-ddaf-4078-8ea4-a38062ea0d7b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>shouldfan-runclubsbepartoffootballssurvivalplan-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz92eTlF9QUdwY4M3YtE2WNDVEeMkF+LOBsCfDwlv8Ep1es1u2qNE69USu+YJu0Y8bDRk3U+/+i3UQUenjCRJ41hdbZRt9R0VIbl5FtkiigOFETUIKXmVTBmeK7n8DVshu7s6qICWFxM6dC8kl+s5EaqkOYIpcwTuFCsa0gGbXsZchYjp5p+L7vcmoincEZADfXbKEwaJg+jbNvbfMB6UjavtvqOoEDnxMW7RemCH/YPA+hzXVfPWOvqOZZgI47oSAL]]></acast:settings>
			<itunes:subtitle><![CDATA[As the Premier League ramps up to&nbsp;restart on June&nbsp;20, Mike Calvin, Seb Stafford Bloor and Adrian Clarke look at the role fans can play in the future of the game. They also start to name their players to watch when, finally, the season...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[As the Premier League ramps up to&nbsp;restart on June&nbsp;20, Mike Calvin, Seb Stafford Bloor and Adrian Clarke look at the role fans can play in the future of the game. They also start to name their players to watch when, finally, the season resumes.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[As the Premier League ramps up to&nbsp;restart on June&nbsp;20, Mike Calvin, Seb Stafford Bloor and Adrian Clarke look at the role fans can play in the future of the game. They also start to name their players to watch when, finally, the season resumes.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who is your football hero?</title>
			<itunes:title>Who is your football hero?</itunes:title>
			<pubDate>Mon, 25 May 2020 05:00:00 GMT</pubDate>
			<itunes:duration>50:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whoisyourfootballhero-/media.mp3" length="120832448" type="audio/mpeg"/>
			<guid isPermaLink="false">4fa9fac5-abc8-449a-8037-bafac1426ee8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whoisyourfootballhero-</link>
			<acast:episodeId>4fa9fac5-abc8-449a-8037-bafac1426ee8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whoisyourfootballhero-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRLbd4UwcBW6vEi58ixJIedCtZ5NN03ELw3TS5nxKNGJhCNPWKPkyWTwn1FvCPmReWX3JeA3UUcIHc/5K7OeLMp4zmHxnIqeZcryRwu8+QaaDXRC/ANPx1ZTKvFZTR7Sc8UMEau4hOXgcRnIzkpodUxUzYCm3iNXf2btBLVZt9z7N54DMpC/Djg3HYrmsDPHaWlDwLi6cm5EZ4Pak94GdiH3AzfG/UYnCBtTlZ2QD99WCbbiBN64mBRbg7EwwaNQXy/EQV3opjCnh8axPWwqC3pdUbyyMN3HufNUoNYtgHet2]]></acast:settings>
			<itunes:subtitle><![CDATA[A special edition of the Football Writers' podcast, in which listeners choose their football heroes. Mike Calvin, Adrian Clarke, and Seb Stafford Bloor go through the an A-Z of heroes from Alan Devonshire to Zico.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[A special edition of the Football Writers' podcast, in which listeners choose their football heroes. Mike Calvin, Adrian Clarke, and Seb Stafford Bloor go through the an A-Z of heroes from Alan Devonshire to Zico.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[A special edition of the Football Writers' podcast, in which listeners choose their football heroes. Mike Calvin, Adrian Clarke, and Seb Stafford Bloor go through the an A-Z of heroes from Alan Devonshire to Zico.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is football management more insecure than ever?</title>
			<itunes:title>Is football management more insecure than ever?</itunes:title>
			<pubDate>Thu, 21 May 2020 14:26:31 GMT</pubDate>
			<itunes:duration>49:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isfootballmanagementmoreinsecurethanever-/media.mp3" length="118586048" type="audio/mpeg"/>
			<guid isPermaLink="false">18400ba1-4a7d-4841-8fbd-b0680d7bb7a2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isfootballmanagementmoreinsecurethanever-</link>
			<acast:episodeId>18400ba1-4a7d-4841-8fbd-b0680d7bb7a2</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isfootballmanagementmoreinsecurethanever-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRAscT3cQe8FS5CPcg/rz0j9JuaWi1tUhF4x+OGUVhsstnSoV6Ecb3ZjoWqnlhbHo2tn9r9OY2y7djzYzJEPuKHR5lpNmzUDckgMxehNSzK+d4kPh7gPQzewl3y0KRiA0FVZ4XMAlrBMxRvjNZl4mkx118hsW6OBZA4boySGUlsiXTHdvCWzPYa2YWZP6WncYX4j+YdxHRbrFidOu4/sidMyOqx4M2mDsh6fcS57tqn8KPmEtr4GBleaQFFZnsYRIpPJeQh5oEavs+pY2Ck+rKfek6ic4qhEYGFh9Ta+tAxA9]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor look at the financial and emotional challenges facing football managers, They also put Rangers' great Euro nights into the context of their current problems, and examine the future of the women...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor look at the financial and emotional challenges facing football managers, They also put Rangers' great Euro nights into the context of their current problems, and examine the future of the women's game.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor look at the financial and emotional challenges facing football managers, They also put Rangers' great Euro nights into the context of their current problems, and examine the future of the women's game.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has the Bundesliga set a high bar for the Premier League?</title>
			<itunes:title>Has the Bundesliga set a high bar for the Premier League?</itunes:title>
			<pubDate>Mon, 18 May 2020 13:24:14 GMT</pubDate>
			<itunes:duration>55:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hasthebundesligasetahighbarforthepremierleague-/media.mp3" length="132942848" type="audio/mpeg"/>
			<guid isPermaLink="false">df5789c3-01a5-4459-882c-a89f074fbd11</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hasthebundesligasetahighbarforthepremierleague-</link>
			<acast:episodeId>df5789c3-01a5-4459-882c-a89f074fbd11</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hasthebundesligasetahighbarforthepremierleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRDZkvctuYOcZPJGOIhDPgKtgWglfh33Wb1P87NU6bmwlKEjcuG+Bf2ImuO0+dd5suYFO1gGH1TNRokdnQZOwQ2/Dr4tZRGm2LsXh9/WTJ6vF5WkKbvVrEocuK/Lo2UqclCW9unoQnZ2gJ2cmhi+b8HYs2SFhkc7Tg7CLU49uZjz9cUjyppiTuQqSgHCXtY0SbIrTDv5CZL7Sl2WB2SKO7PX3fmkPoAaK3YodkH6EvOYTB367QlACHGuqBDDhH4aM8+P7/pi3sIPnTyDm+SPcG4/imCxb3OmfBMh/JQJwg9R0]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Seb Stafford Bloor and Daniel Storey discuss football's new reality. Norwich captain Grant Hanley and Leicester's Hamza Choudhury give the players' perspective. Also: Football's Room 101 and the passing of the scouts...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford Bloor and Daniel Storey discuss football's new reality. Norwich captain Grant Hanley and Leicester's Hamza Choudhury give the players' perspective. Also: Football's Room 101 and the passing of the scouts' scout.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford Bloor and Daniel Storey discuss football's new reality. Norwich captain Grant Hanley and Leicester's Hamza Choudhury give the players' perspective. Also: Football's Room 101 and the passing of the scouts' scout.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is the Bundesliga the best league in which to develop young players?</title>
			<itunes:title>Is the Bundesliga the best league in which to develop young players?</itunes:title>
			<pubDate>Thu, 14 May 2020 15:33:24 GMT</pubDate>
			<itunes:duration>50:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthebundesligathebestleagueinwhichtodevelopyoungplayers-/media.mp3" length="121015388" type="audio/mpeg"/>
			<guid isPermaLink="false">4b016dd1-06d0-43de-839d-11416d5102d1</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthebundesligathebestleagueinwhichtodevelopyoungplayers-</link>
			<acast:episodeId>4b016dd1-06d0-43de-839d-11416d5102d1</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthebundesligathebestleagueinwhichtodevelopyoungplayers-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRIoWzHpFZ5Xd0KjStvvF/SAXfl2c8+kM71aHE8q56jRVJ0N0eQgBJtgsK2h/BOttqLm8yEttHUatuT4GNl/0at2cAhFSS5wvMDUiAZoWiUFMS9Fy60nbAo3hTM2My5QWqUhQ6FyfBEKV42gJw20NByw5USidzj/+9zhD1sogusDpD0qpnWAT1bBJxQnTFKStc8cyhbbIyQZmAPviicm+DhrEqsiljbjSdD0X/TCt1srBXxaCow1DMXjPhmRbd/KYiaDzd8aqfiGlEt3gm2FQwHXLzF0+qnc8s3UM9+K8YEO+]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin. Seb Stafford Bloor and Adrian Clarke look forward to the return of the Bundesliga, and examine the players to watch out for. Also : Manchester City in the Champions League, and the legacy of Euro 2016.&nbsp;]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin. Seb Stafford Bloor and Adrian Clarke look forward to the return of the Bundesliga, and examine the players to watch out for. Also : Manchester City in the Champions League, and the legacy of Euro 2016.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin. Seb Stafford Bloor and Adrian Clarke look forward to the return of the Bundesliga, and examine the players to watch out for. Also : Manchester City in the Champions League, and the legacy of Euro 2016.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Will football's fallout include B teams in the EFL?]]></title>
			<itunes:title><![CDATA[Will football's fallout include B teams in the EFL?]]></itunes:title>
			<pubDate>Mon, 11 May 2020 14:58:31 GMT</pubDate>
			<itunes:duration>53:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willfootballsfalloutincludebteamsintheefl-/media.mp3" length="127680284" type="audio/mpeg"/>
			<guid isPermaLink="false">d08b9eea-37a6-49e0-97f0-4831fe89a68f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willfootballsfalloutincludebteamsintheefl-</link>
			<acast:episodeId>d08b9eea-37a6-49e0-97f0-4831fe89a68f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willfootballsfalloutincludebteamsintheefl-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRAuJhOkbCmnVOsSNNNIcLnHh2b20Cr+Liy09OTDNpZgdE7BO49ai8v8ZuCas7WiTydCgM/YjFIz7/ifBA13qe1cKEs+qFCNBHqgFS5j1opwT8/uuCi+xdOb+Rabb4MhWybCJOIkFwCWw3heOH1QCniCB0fXEAtU4y2Hy7YT72LGFoJNYzeJ2ojfci+BOdY0nMHMocKO7DJFxOsdTmWGa67J8mBcrRyIke8guZBIaQ0W2Htlm4Yr6oqN6sEH9+VxFb7vE1lG6ER/SG/vGaex7H30EYmIodPSWT2oqWFFbHl7m]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor explore further potential changes to the English game. They also discuss player welfare, the impending return of the Bundesliga, and consider the potential of England's starlets.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor explore further potential changes to the English game. They also discuss player welfare, the impending return of the Bundesliga, and consider the potential of England's starlets.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor explore further potential changes to the English game. They also discuss player welfare, the impending return of the Bundesliga, and consider the potential of England's starlets.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Despite the uncertainties, do England remain potential World Cup winners?</title>
			<itunes:title>Despite the uncertainties, do England remain potential World Cup winners?</itunes:title>
			<pubDate>Thu, 07 May 2020 14:41:31 GMT</pubDate>
			<itunes:duration>51:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/despitetheuncertainties-doenglandremainpotentialworldcupwinners-/media.mp3" length="123814352" type="audio/mpeg"/>
			<guid isPermaLink="false">4d399a05-fe82-4d2d-8e03-8a30ac5caab7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/despitetheuncertainties-doenglandremainpotentialworldcupwinners-</link>
			<acast:episodeId>4d399a05-fe82-4d2d-8e03-8a30ac5caab7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>despitetheuncertainties-doenglandremainpotentialworldcupwinners-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRL+nm4BWXzWDV1DYjYNOB69isCb7Ik4AZnu7CBjdDIV2tWTOzN/bmwB9Z/hcdZI7LAKubtS7et5/8EpJTpzzN7kt09jVAHgAJdPmjTUEWHyjEnqBu/rmo+kohUeXX47JRAjKiIAlO0uZkvJuHb1g/bg9c50Pq3ydF45FTz4iG3HVeT75OAR3In52ebXyKfWXtXwjw1VmOyZn+hVfpYTx7N8FC5ZOsOOSof/nGevEoQbNrnf/DSCKCW2QpN0J5CIgl68iGu6Z1wk9rDZaK9yrBXIm746iv5hs48xWnGwZiHSF]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor discuss the future of the England team, manager Gareth Southgate, and the international&nbsp;game. They also assess Tottenham's great European nights, and whether Ronaldhino meant THAT goal aga...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor discuss the future of the England team, manager Gareth Southgate, and the international&nbsp;game. They also assess Tottenham's great European nights, and whether Ronaldhino meant THAT goal against Davie Seaman at the 2002 World Cup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor discuss the future of the England team, manager Gareth Southgate, and the international&nbsp;game. They also assess Tottenham's great European nights, and whether Ronaldhino meant THAT goal against Davie Seaman at the 2002 World Cup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is the football pyramid under threat?</title>
			<itunes:title>Is the football pyramid under threat?</itunes:title>
			<pubDate>Mon, 04 May 2020 14:32:38 GMT</pubDate>
			<itunes:duration>49:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthefootballpyramidunderthreat-/media.mp3" length="119510984" type="audio/mpeg"/>
			<guid isPermaLink="false">479bb855-a879-4f02-8dfc-ab06069188bd</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthefootballpyramidunderthreat-</link>
			<acast:episodeId>479bb855-a879-4f02-8dfc-ab06069188bd</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthefootballpyramidunderthreat-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROnnL50gULN8g1SV9HyUSAx3YCgEMoG55di46QLhQAQz3YJ0Nzfq8OVWx/FaIZXTwMNR0CNFt+mrCnIPakUX6AAVJ+EX2YYC9A2iQwv8KJH3esCgQ15BLspcMTpWr/BGgMpLTmvRS6FWM5ya4r71w9lQMm3+0XTJfaYr7XYWhbHjJk9/X5HD7D1yxUMbtYceLxxoTXPWpit1f7Wu2Rq4oXoAy/ezmkhuGcXAZvFJaDDCuzVCM0SsigGX2QTsSwl1Xs5608p+drfDaMuzSUv+GhyICZtaOD5lqtdVJWxmDmw/]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor consider&nbsp;football's nuclear options. They also discuss the myth of hero managers like Fabio Capello, and reveal the matches they cannot brings&nbsp;themselves to watch again.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor consider&nbsp;football's nuclear options. They also discuss the myth of hero managers like Fabio Capello, and reveal the matches they cannot brings&nbsp;themselves to watch again.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford Bloor consider&nbsp;football's nuclear options. They also discuss the myth of hero managers like Fabio Capello, and reveal the matches they cannot brings&nbsp;themselves to watch again.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is the transfer market about to undergo a revolution?</title>
			<itunes:title>Is the transfer market about to undergo a revolution?</itunes:title>
			<pubDate>Thu, 30 Apr 2020 15:44:27 GMT</pubDate>
			<itunes:duration>49:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthetransfermarketabouttoundergoarevolution-/media.mp3" length="119035964" type="audio/mpeg"/>
			<guid isPermaLink="false">3aaf443a-1bea-4c50-89c6-fa72f8d82d65</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthetransfermarketabouttoundergoarevolution-</link>
			<acast:episodeId>3aaf443a-1bea-4c50-89c6-fa72f8d82d65</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthetransfermarketabouttoundergoarevolution-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROOPiBnmy1uRRF0/wfPSyfAEe8o7QxmSixq262WmvWd485vetLYA7a23vWtN46PcWbqEXA1Evmb7vgiB5gq6JjeVOcP+byXjiqYMaK8LwBcZ3kbJoz7g6rgwWpoy63sVsNa8JSjRMd05FRi+9WZIgYts9ZdE6vlFvWhmdnkmj3rPft6qqquVJNsjGljLHqRA45yR/LZLF0nJ8pxwnCtFsGOHs14RkdeYwzREL64erEoMQ5HlmF773APjvfeo9F/Ruby3oNWFFZemNjF+pJOBxIQos016Dg9OGU8YdukxKPJw]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to plot the future of the transfer system. They also consider Mauricio Pochettino joining Newcastle, look back at Euro 2004, and assess Celtic’s great European nights.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to plot the future of the transfer system. They also consider Mauricio Pochettino joining Newcastle, look back at Euro 2004, and assess Celtic’s great European nights.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to plot the future of the transfer system. They also consider Mauricio Pochettino joining Newcastle, look back at Euro 2004, and assess Celtic’s great European nights.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is football in danger of coming back too soon?</title>
			<itunes:title>Is football in danger of coming back too soon?</itunes:title>
			<pubDate>Mon, 27 Apr 2020 15:07:29 GMT</pubDate>
			<itunes:duration>52:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isfootballindangerofcomingbacktoosoon-/media.mp3" length="126052688" type="audio/mpeg"/>
			<guid isPermaLink="false">651d33a7-82d4-46ca-8967-75ced5c3a499</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isfootballindangerofcomingbacktoosoon-</link>
			<acast:episodeId>651d33a7-82d4-46ca-8967-75ced5c3a499</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isfootballindangerofcomingbacktoosoon-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRDyTfzEQCPj4f8gg9lr6lV2J5B1Sn97l6pbt+n02EZc2Tqhinm1hgK8sei3tQYZ7mrSlIPotKLcFH45T9BR0wh2KPhQ1mVw8Gx6DoFy5XWRSjW6oq2Dx8fxlHId/lr7BDYI21MoPTPmxv6WFNb8GhQWiMZzl+qGAkQ/jmppMJ7HYADCFiflD0Q3yNAL11tClKYoMJgwUs1y+UuFJYAkMr+Aoso+dNh3CS7uwZRg1B+2tv4nbZOPoDh+1ZUUsyhNYrY2Ex+L/B3T9FJHc+AUkxPREq1h2qcDII+dvpeIICy4k]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Adrian Clarke Seb Stafford Bloor to discuss the timing of football’s return. They also examine whether Phil Neville should be replaced immediately as manager of the Lionesses, and identify a potential Premier League manager of ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Adrian Clarke Seb Stafford Bloor to discuss the timing of football’s return. They also examine whether Phil Neville should be replaced immediately as manager of the Lionesses, and identify a potential Premier League manager of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Adrian Clarke Seb Stafford Bloor to discuss the timing of football’s return. They also examine whether Phil Neville should be replaced immediately as manager of the Lionesses, and identify a potential Premier League manager of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>What will football look like in the future?</title>
			<itunes:title>What will football look like in the future?</itunes:title>
			<pubDate>Thu, 23 Apr 2020 14:31:54 GMT</pubDate>
			<itunes:duration>50:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatwillfootballlooklikeinthefuture-/media.mp3" length="121678328" type="audio/mpeg"/>
			<guid isPermaLink="false">98fa88f0-0fbc-40a1-9dd9-68b56b3cb383</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatwillfootballlooklikeinthefuture-</link>
			<acast:episodeId>98fa88f0-0fbc-40a1-9dd9-68b56b3cb383</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatwillfootballlooklikeinthefuture-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9KQrn9Q0n+au5X1i7b73Nmp6K98tSuliT8FviVKdwdpRa5hv5/43tI/qDldkr5GwVBHpDk6RRlHJY5KZUuPklPfOUMe4cmbHRf6f7Q/nxj5DmUXjNwUar+9HF+86PrDlPlZ9ZPLLOHOF8XW9wrFVHUnIDY9/ss4NjcDyGj5jYESkhE6eErK2AbburU6n12wyj9JEYdWGYaCjXkiLZ1GlNfZenY0/zjfdI+TIPcJ3q1EohRvjQx0wyLoX9vnxCYk74]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Seb Stafford Bloor and Adrian Clarke to look at how the game will be changed by the current crisis. They answer listeners’ questions, in addition to analysing Chelsea’s greatest European nights, and assessing Euro 96.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Seb Stafford Bloor and Adrian Clarke to look at how the game will be changed by the current crisis. They answer listeners’ questions, in addition to analysing Chelsea’s greatest European nights, and assessing Euro 96.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Seb Stafford Bloor and Adrian Clarke to look at how the game will be changed by the current crisis. They answer listeners’ questions, in addition to analysing Chelsea’s greatest European nights, and assessing Euro 96.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Does football need heroes more than ever?</title>
			<itunes:title>Does football need heroes more than ever?</itunes:title>
			<pubDate>Mon, 20 Apr 2020 16:53:45 GMT</pubDate>
			<itunes:duration>53:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/doesfootballneedsheroesmorethanever-/media.mp3" length="129205568" type="audio/mpeg"/>
			<guid isPermaLink="false">addea241-1d95-40f6-9667-e3b8573935e2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/doesfootballneedsheroesmorethanever-</link>
			<acast:episodeId>addea241-1d95-40f6-9667-e3b8573935e2</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>doesfootballneedsheroesmorethanever-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFiyxAryJIDZEUH3tFP2I6XuhfHgYxM2bWKCOndHUWg6/m/HIEadNvo/6T4D39q3OK+C4Pdgn868tAqu/PYJGYBqasx1f0wJ6amVPtsjrUpHXr5xG0Dia99OTovUuv8M1q+zYUHQBBQOnhusjIQx8zOwV53J6B3WbP8QWTBAOmuSvcvAOsF96LxGOoDedzP6YosolbKP7IOP03wZB+9kdGBxPn3iWdgdi/jOUdSD0KUV9N3p0GnAXSYHCUX8sLZ33seiOj6pbNGYEKRL2DBEs1BUwpfhLreNwgv9qcPu/lKO]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to discuss their heroes, and the listeners’ personal favourites. Also features an in depth and highly personal look at Italia 90.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to discuss their heroes, and the listeners’ personal favourites. Also features an in depth and highly personal look at Italia 90.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to discuss their heroes, and the listeners’ personal favourites. Also features an in depth and highly personal look at Italia 90.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Time to stop taking fans for granted?</title>
			<itunes:title>Time to stop taking fans for granted?</itunes:title>
			<pubDate>Thu, 16 Apr 2020 15:56:33 GMT</pubDate>
			<itunes:duration>50:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/timetostoptakingfansforgranted-/media.mp3" length="121364084" type="audio/mpeg"/>
			<guid isPermaLink="false">53c0bff7-e946-415d-af72-6fd1b6711645</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/timetostoptakingfansforgranted-</link>
			<acast:episodeId>53c0bff7-e946-415d-af72-6fd1b6711645</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>timetostoptakingfansforgranted-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9N3FomnXOuxGyNzyRmNQ3/NbJBI8bWw4KsLvaujMhjyILuXPfz29HXKFxAQ+5WQ2S35xPvzQYY3zp178qQs/B+0WRVBPmwvJsHPRtEl83l3yaJ4EwFPAaJ+YVJlDnmOaHpejJhfvbC+z+5eAja7vZYZo+LIewHrcX1x8wV+bLan/Ytomhp+1UhVRP8afeTDRKGYxK7NOYBJZrVMsNXrRryaxACEPgQU79Mbmj44rZKcZ/o1AkP4kF8yWAXP2RzA3k]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to discuss fan engagement, the Newcastle takeover, managerial heavyweights, Arsenal’s European nights and Euro 92.&nbsp;]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to discuss fan engagement, the Newcastle takeover, managerial heavyweights, Arsenal’s European nights and Euro 92.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to discuss fan engagement, the Newcastle takeover, managerial heavyweights, Arsenal’s European nights and Euro 92.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Does the transfer market have a viable future?</title>
			<itunes:title>Does the transfer market have a viable future?</itunes:title>
			<pubDate>Mon, 13 Apr 2020 05:00:00 GMT</pubDate>
			<itunes:duration>48:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/doesthetransfermarkethaveaviablefuture-/media.mp3" length="116440580" type="audio/mpeg"/>
			<guid isPermaLink="false">c5ac95ab-4625-492b-be78-1b0977b2d380</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/doesthetransfermarkethaveaviablefuture-</link>
			<acast:episodeId>c5ac95ab-4625-492b-be78-1b0977b2d380</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>doesthetransfermarkethaveaviablefuture-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9cm4Ikkl3RxoWfvOo0fb+iWAFcyyoZBqx4FlLtFIkqKKaXOsS11G5kxzs28wRNK67+kYxp14uMcKvI1l5d+zAekeT1jTMmWACP6RzabSmpOxV7+sM19zTAJZq1uHMacTCocz4SJJZOXm/cmYj3/sZougS2Md3exJrHjhB+qxvIwSPimsQUbNHTMUZdSG4EqIE+fGa+zcaQrTAK8u6eGPoGrcWxS+jvZz3NJSpcPes1kgjjfClnu5een4k9IxBPz1h]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Adrian Clarke and Seb Stafford to discuss how transfers will change, analyse the next batch of Premier League managers, and focus on the 2006 World Cup.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Adrian Clarke and Seb Stafford to discuss how transfers will change, analyse the next batch of Premier League managers, and focus on the 2006 World Cup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Adrian Clarke and Seb Stafford to discuss how transfers will change, analyse the next batch of Premier League managers, and focus on the 2006 World Cup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Players Together – a game changer?</title>
			<itunes:title>Players Together – a game changer?</itunes:title>
			<pubDate>Thu, 09 Apr 2020 15:25:50 GMT</pubDate>
			<itunes:duration>48:11</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/playerstogether-agamechanger-/media.mp3" length="115579280" type="audio/mpeg"/>
			<guid isPermaLink="false">128110e2-e353-48d6-856d-e99f443bd1c9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/playerstogether-agamechanger-</link>
			<acast:episodeId>128110e2-e353-48d6-856d-e99f443bd1c9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>playerstogether-agamechanger-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRMBF5jpW4ovziFVIfDeMB5bqnXXnUXPlkdKjzohRMrypQOlXfDHbde+t76JnlYAE4yuhFil3Ra7FHJrKHVt7sSaCGSWTeMaRy60aRYy2ZJX9SdJBsuLyEf6g4H+LNtrH2GMwTStU4OXHy0VLhv/PuZKCj/0d37Ca92vpON9Dn0dv5sz0tvUkhSHKz3KCgbZU5sSDDoXLfU1KwOSNmicDcAOkyfOBdS4afE5Fzco00YEL8rh/p95GCieUUWWIU9evtCfwUdjGg0jl6mex1z8B04/WDKr1GQrQ94oJcMhN8CzR]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Adrian Clarke and Seb Stafford to discuss the players’ new charitable initiative, Liverpool’s greatest European matches, and the sliding doors moments of Mexico 86.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Adrian Clarke and Seb Stafford to discuss the players’ new charitable initiative, Liverpool’s greatest European matches, and the sliding doors moments of Mexico 86.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Adrian Clarke and Seb Stafford to discuss the players’ new charitable initiative, Liverpool’s greatest European matches, and the sliding doors moments of Mexico 86.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can football afford a lack of trust and solidarity?</title>
			<itunes:title>Can football afford a lack of trust and solidarity?</itunes:title>
			<pubDate>Mon, 06 Apr 2020 17:23:04 GMT</pubDate>
			<itunes:duration>46:48</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canfootballaffordalackoftrustandsolidarity-/media.mp3" length="112230128" type="audio/mpeg"/>
			<guid isPermaLink="false">a40f0823-39cc-4d27-96a9-c2883d2fc37e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canfootballaffordalackoftrustandsolidarity-</link>
			<acast:episodeId>a40f0823-39cc-4d27-96a9-c2883d2fc37e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canfootballaffordalackoftrustandsolidarity-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRH0XUWRt3mur1m82FsA3tuxYnWYYxhcgRsUepjMkCXv6OEMHnxCKqR29JyESg7wV24IAeh4KODJHNDSF3HwyGSMgrYs+3yPH47S9fF+V2EhnQKddLmXxsJ5qEMGaZ4lfhVp1JXu4w8I/Fb6CyAt2emblTseIv5GNSRSnwb41oPvDngQHNngaFk4FwUVEfdPogbeyiJRWavZd0fNAm3TXlPAFDnsj1qcD0h0Vp/oh3Aof1tkRkXPNGb8TDjbYufNVHDDCTdJi/fWNAHxyPc8fQYupbJavxTX2UmvV9TiAdU7W]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Seb Stafford Bloor and Adrian Clarke to discuss the latest developments, plus a look back at France’ 82 and the ABC of Premier League management.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Seb Stafford Bloor and Adrian Clarke to discuss the latest developments, plus a look back at France’ 82 and the ABC of Premier League management.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Seb Stafford Bloor and Adrian Clarke to discuss the latest developments, plus a look back at France’ 82 and the ABC of Premier League management.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>How will football emerge from its moral maze?</title>
			<itunes:title>How will football emerge from its moral maze?</itunes:title>
			<pubDate>Thu, 02 Apr 2020 15:12:54 GMT</pubDate>
			<itunes:duration>46:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/howwillfootballemergefromitsmoralmaze-/media.mp3" length="111814616" type="audio/mpeg"/>
			<guid isPermaLink="false">a3961d35-900b-47e4-9b2d-cff4dfd54bc3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/howwillfootballemergefromitsmoralmaze-</link>
			<acast:episodeId>a3961d35-900b-47e4-9b2d-cff4dfd54bc3</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>howwillfootballemergefromitsmoralmaze-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRLbPUs3rUXvBcxU1/IXPqOiORGMaRadFT6JvbJ9mWJlqZ8zKscYB38D6bzMO7lkGujMnb4h47rZMe8XjJ/e3mqnlOLzfWtFixyI2wd5viayfGU+S0gIQzeQZIfvmANzDiPG4ZtV6BXtYXxuN8n4P+dmffUEP+ChKG+MtLf53IxSy1wD5RlDwQMghdjrP39mQ44ueemSBLQxwx9S8EhyX8V0XivkblpsNEGOHQ7SQSPoKjEa+zQ4PJAUyBMA8/cBvOunf9RsHA97D8Gjf5GDKoYrDAZXgZGJsG9oy1BBrk3VV]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and Seb Stafford discuss football’s future and its past, in the form of France 98 and great European nights involving Manchester United.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford discuss football’s future and its past, in the form of France 98 and great European nights involving Manchester United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford discuss football’s future and its past, in the form of France 98 and great European nights involving Manchester United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Too soon to decide football’s future?</title>
			<itunes:title>Too soon to decide football’s future?</itunes:title>
			<pubDate>Mon, 30 Mar 2020 16:52:42 GMT</pubDate>
			<itunes:duration>48:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/toosoontodecidefootball-sfuture-/media.mp3" length="115389272" type="audio/mpeg"/>
			<guid isPermaLink="false">1b4c4cc4-0781-4c88-b8a9-d17620ff8631</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/toosoontodecidefootball-sfuture-</link>
			<acast:episodeId>1b4c4cc4-0781-4c88-b8a9-d17620ff8631</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>toosoontodecidefootball-sfuture-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9dmIRQMz6SB/4AJBlqmdR5YshbZw4eudNwtiL+67aMxK2qo9ydIDmO835aY8UypOdHBQQ3k6BS/CDETLBJetXthArGPPAescVPl+xD/Tw/QQE4qVUdcIh0140R4fzjCTXajwpvPZPOap0rE7fA5t28jZpajfWSPf4ZIQONCMcCXV+9OPNo6cPxoEY9TcwfvJoVrdKqV8gpY1h2tU39ilU30WDJwXEtFGk1+oqX/eqelUPJBZouMQZX8T0D0T/rTKm]]></acast:settings>
			<itunes:subtitle>With talk of contingency plans involving the restart of the Premier League with players in a quarantine camp, Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to discuss football’s crisis strategy.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[With talk of contingency plans involving the restart of the Premier League with players in a quarantine camp, Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to discuss football’s crisis strategy.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[With talk of contingency plans involving the restart of the Premier League with players in a quarantine camp, Mike Calvin is joined by Adrian Clarke and Seb Stafford Bloor to discuss football’s crisis strategy.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can football be more than a game?</title>
			<itunes:title>Can football be more than a game?</itunes:title>
			<pubDate>Mon, 23 Mar 2020 18:55:56 GMT</pubDate>
			<itunes:duration>44:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canfootballbemorethanagame-/media.mp3" length="42147986" type="audio/mpeg"/>
			<guid isPermaLink="false">cc08e43d-9120-43f8-bb71-016ddca0b345</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canfootballbemorethanagame-</link>
			<acast:episodeId>cc08e43d-9120-43f8-bb71-016ddca0b345</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canfootballbemorethanagame-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9J5T6Bf84UFsG+Ec4lNCba1JfSxfC8lxd/LUvGN8zNRdyPc2EIzVYZKS/0m/fpm0RYX0MAfMBeImStD7y6e0+NbduK+x0G4COBY7R5WvWkyIOogPjymXVXsv3aUylXAER4gV7pCjgqjn7yM8Ri1Ylr+LGw++y70J3bV8ER6dte46uhxrNy0ZxO+ZUNWsyveFFTfmSSDvpGU4gxWT1WWKimi7hJzrcoimwzNt3TRlB5pm1JLHrzDh4PbzcHu0zwLM7]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined remotely by Adrian Clarke and Seb Stafford-Bloor to gauge football’s impact in unprecedented times, from Bhutan to Stevenage, via Manchester United and Spurs.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined remotely by Adrian Clarke and Seb Stafford-Bloor to gauge football’s impact in unprecedented times, from Bhutan to Stevenage, via Manchester United and Spurs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined remotely by Adrian Clarke and Seb Stafford-Bloor to gauge football’s impact in unprecedented times, from Bhutan to Stevenage, via Manchester United and Spurs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Football will just have to wait</title>
			<itunes:title>Football will just have to wait</itunes:title>
			<pubDate>Mon, 16 Mar 2020 17:52:28 GMT</pubDate>
			<itunes:duration>44:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/footballwilljusthavetowait/media.mp3" length="42813518" type="audio/mpeg"/>
			<guid isPermaLink="false">2c9d9241-835b-4f7d-b4d4-37c1a2177f1b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/footballwilljusthavetowait</link>
			<acast:episodeId>2c9d9241-835b-4f7d-b4d4-37c1a2177f1b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>footballwilljusthavetowait</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9uVoiGG7WoLovq4cV5tZQOyu1pbqNbEwpHLx33rPKHs9OYZLMM2jWwoAHhP6323cKsol8RzuyhrIXRPWvLSHDyJzwgJFEk0K7pZ3A4jwcu6RQ8juYFmvsy7ESsVkVMvFy6+JjgKRdmFsLrTGUv3k9Jswz8riH7DOAGSknEtws9DIOvaPTPQSGfluWSsw2NGR+x+6v51a9vCvdsqr5XUNPYAGtH16+GtL4AEhDTUIhUglVI64fpGT3jOWvsqcuSkzy]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by John Cross and Tony Hodson who discuss the uncertain time football currently faces, and whether Liverpool lift the trophy in an empty stadium.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by John Cross and Tony Hodson who discuss the uncertain time football currently faces, and whether Liverpool lift the trophy in an empty stadium.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by John Cross and Tony Hodson who discuss the uncertain time football currently faces, and whether Liverpool lift the trophy in an empty stadium.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Another glorious European night for Liverpool?​</title>
			<itunes:title>Another glorious European night for Liverpool?​</itunes:title>
			<pubDate>Mon, 09 Mar 2020 17:56:14 GMT</pubDate>
			<itunes:duration>45:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/anothergloriouseuropeannightforliverpool-/media.mp3" length="43440686" type="audio/mpeg"/>
			<guid isPermaLink="false">c4d75dc5-a71b-4f30-b818-22867baefa21</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/anothergloriouseuropeannightforliverpool-</link>
			<acast:episodeId>c4d75dc5-a71b-4f30-b818-22867baefa21</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>anothergloriouseuropeannightforliverpool-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRCQFAmIq1IN5Hd5TyRiJCeotGP/WxDvRBy/nASu7ovjMw7rm/leSdseVXyMw2koA7Aa4e8ptfw6XJC9ivtwQMU015KpIjbtO0/knBlsQRSipD4p/68UkXheUHYT+2FUktvlL0yn8C2M7Qitxzf1I+D3cYo03Smod1og0Ar+UK/T7l8kDpw0K05r2dPlFDeOMdLza1ph5vDkQw9sY9JpK8O1mXSqLuSnPACtPfwLLpfTWUs0feMEfC+iyEyS/7Gw/Y1lgB8O6kCiqToNdrGVpe6aNAmtymY3QbacToHxp/Gfs]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford-Bloor discuss how the footballing theatre of Anfield will impact a big night in Liverpool's season. They also study&nbsp;the footballing philosophies of Klopp and Simeone, and take a look at Mourinho...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford-Bloor discuss how the footballing theatre of Anfield will impact a big night in Liverpool's season. They also study&nbsp;the footballing philosophies of Klopp and Simeone, and take a look at Mourinho’s&nbsp;recent outspoken&nbsp;gripes.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford-Bloor discuss how the footballing theatre of Anfield will impact a big night in Liverpool's season. They also study&nbsp;the footballing philosophies of Klopp and Simeone, and take a look at Mourinho’s&nbsp;recent outspoken&nbsp;gripes.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are there doubts creeping in on Frank Lampard at Chelsea?</title>
			<itunes:title>Are there doubts creeping in on Frank Lampard at Chelsea?</itunes:title>
			<pubDate>Mon, 02 Mar 2020 17:52:03 GMT</pubDate>
			<itunes:duration>44:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/aretheredoubtscreepinginonfranklampardatchelsea-/media.mp3" length="42424040" type="audio/mpeg"/>
			<guid isPermaLink="false">c9f6f927-c7f3-4ee8-b703-56e6c664f129</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/aretheredoubtscreepinginonfranklampardatchelsea-</link>
			<acast:episodeId>c9f6f927-c7f3-4ee8-b703-56e6c664f129</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>aretheredoubtscreepinginonfranklampardatchelsea-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRLfLbOXUoRtRdgOentb0x6ikcdQtWPz7+ytp4fKxK47MZ5osgZ6DJIKlcdlVdBSjUQ9GH82RYh6Wq6peNrhBoqh3yKzAuxyjMdTmP/DPiniqcTqJB9kixs9mwpiohAMyLchOoiGrLK3PL3+z/q/3rIXVGJ/AW+bblTrsp1hfY95XJ/fEI8anyPL/Z1PP5OhvZT3co5mq4L343fD/gemnXsZRiqnHrA/7I6du59GJVMz4KGxGOUHYkRBJ/enqC5MKOuLZKYJceEyzIvt8ftscwKKXJMcnkprX/JF4PvUaUvGN]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin,&nbsp;Alyson Rudd&nbsp;and Daniel Storey discuss the question marks surrounding&nbsp;Frank Lampard’s ability to get the best out of Chelsea, following&nbsp;recent results at the Bridge. The trio also analyse&nbsp;how Liv...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin,&nbsp;Alyson Rudd&nbsp;and Daniel Storey discuss the question marks surrounding&nbsp;Frank Lampard’s ability to get the best out of Chelsea, following&nbsp;recent results at the Bridge. The trio also analyse&nbsp;how Liverpool’s first league defeat may affect&nbsp;their approach to other competitions,&nbsp;and Jose Mourinho’s striking crisis at Spurs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin,&nbsp;Alyson Rudd&nbsp;and Daniel Storey discuss the question marks surrounding&nbsp;Frank Lampard’s ability to get the best out of Chelsea, following&nbsp;recent results at the Bridge. The trio also analyse&nbsp;how Liverpool’s first league defeat may affect&nbsp;their approach to other competitions,&nbsp;and Jose Mourinho’s striking crisis at Spurs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Man City's season on the line in Madrid]]></title>
			<itunes:title><![CDATA[Man City's season on the line in Madrid]]></itunes:title>
			<pubDate>Mon, 24 Feb 2020 18:06:25 GMT</pubDate>
			<itunes:duration>45:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mancitysseasononthelineinmadrid/media.mp3" length="43191320" type="audio/mpeg"/>
			<guid isPermaLink="false">65092e34-04af-4803-b2ac-d50e11492f9b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mancitysseasononthelineinmadrid</link>
			<acast:episodeId>65092e34-04af-4803-b2ac-d50e11492f9b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mancitysseasononthelineinmadrid</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRJM/9zbB+oHrD73bp9b2XejNXR+N/thA4+IO9uTSi1HLYq92CrtBWIrEfrLf0fNtF7ne7E0vDIIDLKhF9GLABpZt+PHYpG2Qn2OA/YJkKc+xyhKXn/vLwjfoSs+8J2JjVVIAyNeFGLRFB4lJ+tU84VeHEEEqkDnr3AKHHSbiRZ+NMiV5JhjanYj0SpUjYOXKYQQpwK5kXDYuuFIV1ws82z3f1BpKl/ZlRMPG4LDug2rEZEjFoDaaF28EcOojlwfMLPXk5LYhYi8vDuNvK7GKvOf2XN8ZyT8eBVgf6Qcyzfh8]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke, and Dominic Fifield discuss the upcoming Champions League knockout rounds with Manchester City travelling to Real Madrid with the shadow of their UEFA ban hanging over them. Chelsea host Bayern Munich, and Cristiano Ronaldo ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke, and Dominic Fifield discuss the upcoming Champions League knockout rounds with Manchester City travelling to Real Madrid with the shadow of their UEFA ban hanging over them. Chelsea host Bayern Munich, and Cristiano Ronaldo and Lionel Messi return&nbsp;to action in their ties.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke, and Dominic Fifield discuss the upcoming Champions League knockout rounds with Manchester City travelling to Real Madrid with the shadow of their UEFA ban hanging over them. Chelsea host Bayern Munich, and Cristiano Ronaldo and Lionel Messi return&nbsp;to action in their ties.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[A Battle for Football's future?]]></title>
			<itunes:title><![CDATA[A Battle for Football's future?]]></itunes:title>
			<pubDate>Mon, 17 Feb 2020 17:12:38 GMT</pubDate>
			<itunes:duration>48:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/abattleforfootballsfuture-/media.mp3" length="46515644" type="audio/mpeg"/>
			<guid isPermaLink="false">e3aee9a1-49a6-438b-ab36-239f0e49d7e5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/abattleforfootballsfuture-</link>
			<acast:episodeId>e3aee9a1-49a6-438b-ab36-239f0e49d7e5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>abattleforfootballsfuture-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBp6iLFX/1g8d4aWloxwHQoi//NO4Mee2JufMckYcpq8YiHXD5aayBLw3QBWute41CwlHwIcdTwZVN+7Ii7XREbBeHC99IMFqCfejma1571zacxTJaQhAOFLtsgI8znBH+xd6Zoausg1bTwVJ7+o2ZreOVcQVDq/NljJu/fFMXjstgw4jPl6Rxjc4h8eiEf+5cs2VYhPVIVS/g3MxGnA8YIop8VPqd3hk8mP7a9lFMHSczQ8KV8qGTU5d21tA2mV6T3JALX3u+HhjzOW317GZOGgYLNpOkLqKG/UGABvLrxN]]></acast:settings>
			<itunes:subtitle><![CDATA[This week, Mike Calvin and his guests Darren Lewis and Tony Hodson discuss the fallout between Man City and Uefa, but who will come out on top; footballs governing authorities or the 'super' clubs?The trio also talk over the upcoming Champ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>This week, Mike Calvin and his guests Darren Lewis and Tony Hodson discuss the fallout between Man City and Uefa, but who will come out on top; footballs governing authorities or the 'super' clubs?</p><br><p>The trio also talk over the upcoming Champions League fixtures and challenges posed to the English clubs.</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>This week, Mike Calvin and his guests Darren Lewis and Tony Hodson discuss the fallout between Man City and Uefa, but who will come out on top; footballs governing authorities or the 'super' clubs?</p><br><p>The trio also talk over the upcoming Champions League fixtures and challenges posed to the English clubs.</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Who's the 'best of the rest' this season?]]></title>
			<itunes:title><![CDATA[Who's the 'best of the rest' this season?]]></itunes:title>
			<pubDate>Mon, 10 Feb 2020 17:38:15 GMT</pubDate>
			<itunes:duration>45:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whosthebestoftherestthisseason-/media.mp3" length="43941920" type="audio/mpeg"/>
			<guid isPermaLink="false">90184b65-79c4-4103-9562-9694b2379824</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whosthebestoftherestthisseason-</link>
			<acast:episodeId>90184b65-79c4-4103-9562-9694b2379824</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whosthebestoftherestthisseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRLuuEonq3cpYBSSJXu507m3B2vhuX8Up1L5Gl5FNGK5Jz26Lir8L3kqqcznW0nLCbEF7vm218osN9tRocm0T0jB5EmwIl/Ti0Fju8LA0saZr15eFnMnY/eLFFBd4ItZ9D425t75XmNEU8sPf3YjqGtPjkJJhWidMbvVGZaqn6Kydhm3PBa2c3GpLE4VJDoEvvb/QxYXK7n9UmyRqTLAhAWcf+aRvmq51fKP3jtJ88Acsrsagq7juYa2fDU1lEmXtH+/NUzE218BktfviuVFFHMCd7VwPnNOPRolbIxHgS8kL]]></acast:settings>
			<itunes:subtitle><![CDATA[With the title all but&nbsp;decided, Mike Calvin and guests Miguel Delaney and Andy Dillon discuss&nbsp;the&nbsp;best of the rest; could Wolves win a trophy and do Leicester look set on sticking in the top three?]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[With the title all but&nbsp;decided, Mike Calvin and guests Miguel Delaney and Andy Dillon discuss&nbsp;the&nbsp;best of the rest; could Wolves win a trophy and do Leicester look set on sticking in the top three?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[With the title all but&nbsp;decided, Mike Calvin and guests Miguel Delaney and Andy Dillon discuss&nbsp;the&nbsp;best of the rest; could Wolves win a trophy and do Leicester look set on sticking in the top three?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Women's Football Podcast: Are Chelsea now the favourites for the WSL title?]]></title>
			<itunes:title><![CDATA[Women's Football Podcast: Are Chelsea now the favourites for the WSL title?]]></itunes:title>
			<pubDate>Thu, 06 Feb 2020 06:00:30 GMT</pubDate>
			<itunes:duration>38:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/womensfootballpodcast-arechelseanowthefavouritesforthewsltitle-/media.mp3" length="36447596" type="audio/mpeg"/>
			<guid isPermaLink="false">b538192b-aebf-4881-9040-80f788de5c4c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/womensfootballpodcast-arechelseanowthefavouritesforthewsltitle-</link>
			<acast:episodeId>b538192b-aebf-4881-9040-80f788de5c4c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>womensfootballpodcast-arechelseanowthefavouritesforthewsltitle-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9mFZuR9fDG9nEGAOS62YQThMaTBCicbiDsaW8++HQud8w5z/43K0sWg/3ozJwFqD1CDr0gv0u+seC7kAs1e01Nu0pfYYIxC+aLB5BiiBS2S/APOpX9L25plQL6Sz+0LPVur0SjLfOahUU36PNDOjPBRCOoFMvSla+mPRMjGVYufX5k9WP7hEKCIj2ta8sqMRvnF7eWXKdjlTFCdYniSdKEwowdz3w16Y+Ex29IF2mFUFkJuud8SbKIHx7ENlZNnTq]]></acast:settings>
			<itunes:subtitle><![CDATA[Can Chelsea maintain their march to the title when they face Manchester United in the BT Sport WSL match this Sunday? Are Liverpool on the brink of relegation?&nbsp;The panel also discuss the influence and growth of women coaches in the game.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Can Chelsea maintain their march to the title when they face Manchester United in the BT Sport WSL match this Sunday? Are Liverpool on the brink of relegation?&nbsp;The panel also discuss the influence and growth of women coaches in the game.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Can Chelsea maintain their march to the title when they face Manchester United in the BT Sport WSL match this Sunday? Are Liverpool on the brink of relegation?&nbsp;The panel also discuss the influence and growth of women coaches in the game.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are the cracks starting to appear on Guardiola’s City reign?</title>
			<itunes:title>Are the cracks starting to appear on Guardiola’s City reign?</itunes:title>
			<pubDate>Mon, 03 Feb 2020 17:46:39 GMT</pubDate>
			<itunes:duration>47:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/arethecracksstartingtoappearonguardiola-scityreign-/media.mp3" length="68382490" type="audio/mpeg"/>
			<guid isPermaLink="false">6f2c7209-7721-49ff-925d-dd159dc00621</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/arethecracksstartingtoappearonguardiola-scityreign-</link>
			<acast:episodeId>6f2c7209-7721-49ff-925d-dd159dc00621</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>arethecracksstartingtoappearonguardiola-scityreign-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9/AVdcVy7LdNaA44e8+019Bg2kTGVvWBWDgTyMlgCZWPDnogu3IfCGLGAn7KoyY/IIA84HsPI4xybzWw2JrxybYdahlfIEM8DuOBhjymdd5WEekf2CvC7ZhdTWz2H1oOtlkjwgMTx6gQlbIObPm4mkNPm1ShSjsC04eXMHYL9AGRq9N8gWFR77pcc+cNt++h1wi0njnQqpImfuRpLBLEcBAhv/vtfYQvhp0mwgA1Q28QBK54zYeYyMMJFh5gvShKY]]></acast:settings>
			<itunes:subtitle>Was Jose’s win over Pep a masterclass or a stroke of luck? Can Liverpool entice Kylian Mbappe to join this summer? Have Chelsea blown their top four chances by not investing in the transfer market? The panel discuss the weekend’s major talking points a...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Was Jose’s win over Pep a masterclass or a stroke of luck? Can Liverpool entice Kylian Mbappe to join this summer? Have Chelsea blown their top four chances by not investing in the transfer market? The panel discuss the weekend’s major talking points and what lies ahead in the race for the top four and midweek FA Cup matches.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Was Jose’s win over Pep a masterclass or a stroke of luck? Can Liverpool entice Kylian Mbappe to join this summer? Have Chelsea blown their top four chances by not investing in the transfer market? The panel discuss the weekend’s major talking points and what lies ahead in the race for the top four and midweek FA Cup matches.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has the magic of the FA Cup really disappeared?</title>
			<itunes:title>Has the magic of the FA Cup really disappeared?</itunes:title>
			<pubDate>Mon, 27 Jan 2020 18:29:53 GMT</pubDate>
			<itunes:duration>49:35</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hasthemagicofthefacupreallydisappeared-/media.mp3" length="47498513" type="audio/mpeg"/>
			<guid isPermaLink="false">8bddf539-482a-4f89-a16e-3ad502d7bdd1</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hasthemagicofthefacupreallydisappeared-</link>
			<acast:episodeId>8bddf539-482a-4f89-a16e-3ad502d7bdd1</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hasthemagicofthefacupreallydisappeared-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPVv47ZhzZqcdkHQbnstRT73FiRk4OKzFsp+xzgVh67ywaRRDCiFXikNclZ+HiS0PqN1mxC5sKN2ncSq8zkHAIsduY5HPc2KEhyMomQ1q3sohOcHXy4t32UIjUJDDcyTx8tvgXPql1dtRDX/bnSyLqXB4ksQ5nlR9vjaDJ87R4rs1V5gzQ2f70xqiEofqcBYJG67Eqj7uFLR3ryg5BCMaK8w+EgDvFdF3tyfcPeadCdp8LhQ+EjB3KR64ekDlUViqapk/WFHxHodeanNbnhxQgwo2fe005TtBm2U8bkRXBlv]]></acast:settings>
			<itunes:subtitle><![CDATA[This week, Mike Calvin is joined by John Cross and Tom Hopkinson as they discuss the oldest, national football competition in the world, the FA Cup. The panel also chat&nbsp;Manchester United, and&nbsp;the issues&nbsp;currently surrounding ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[This week, Mike Calvin is joined by John Cross and Tom Hopkinson as they discuss the oldest, national football competition in the world, the FA Cup. The panel also chat&nbsp;Manchester United, and&nbsp;the issues&nbsp;currently surrounding the club.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[This week, Mike Calvin is joined by John Cross and Tom Hopkinson as they discuss the oldest, national football competition in the world, the FA Cup. The panel also chat&nbsp;Manchester United, and&nbsp;the issues&nbsp;currently surrounding the club.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Liverpool - the victory lap begins</title>
			<itunes:title>Liverpool - the victory lap begins</itunes:title>
			<pubDate>Mon, 20 Jan 2020 17:58:01 GMT</pubDate>
			<itunes:duration>46:32</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/liverpool-thevictorylapbegins/media.mp3" length="111599552" type="audio/mpeg"/>
			<guid isPermaLink="false">8547fd51-3fe1-4438-a425-4dddc1364563</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/liverpool-thevictorylapbegins</link>
			<acast:episodeId>8547fd51-3fe1-4438-a425-4dddc1364563</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>liverpool-thevictorylapbegins</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9GhuYAupsUlcRqXQaVSWuuZJGqcuJ9Ul6PEX/wDOVsAvVwPsdXoP60QlT3zK/x6pvG38BYOsdWcTBP2xD3BzvjopQhiiH5FrgDevkoakW451vTxOhHQpiZ1qQFvSGYxcqTN6c2zy0AALTREizsFCwnXhAwb4VCOlg+COfaU2BtstSpfndq+2iOSyJk87LRvOTA0263lUVH0Lb/DapB0XOgUAQErts+GMBJQNAewv4VRm9f8N/cdNCXOkJ6BTrzgf8]]></acast:settings>
			<itunes:subtitle>Are we witnessing the start of a dynasty at Liverpool? Mike Calvin is joined by Alyson Rudd and Daniel Storey to discuss title formalities, and future domination.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Are we witnessing the start of a dynasty at Liverpool? Mike Calvin is joined by Alyson Rudd and Daniel Storey to discuss title formalities, and future domination.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Are we witnessing the start of a dynasty at Liverpool? Mike Calvin is joined by Alyson Rudd and Daniel Storey to discuss title formalities, and future domination.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>How far have Manchester United fallen behind Liverpool?</title>
			<itunes:title>How far have Manchester United fallen behind Liverpool?</itunes:title>
			<pubDate>Mon, 13 Jan 2020 17:28:13 GMT</pubDate>
			<itunes:duration>43:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/howfarhavemanchesterunitedfallenbehindliverpool-/media.mp3" length="103231892" type="audio/mpeg"/>
			<guid isPermaLink="false">cdbb4276-2614-4abb-ae86-3317352d9d25</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/howfarhavemanchesterunitedfallenbehindliverpool-</link>
			<acast:episodeId>cdbb4276-2614-4abb-ae86-3317352d9d25</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>howfarhavemanchesterunitedfallenbehindliverpool-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRCvgJVxRM9kkMfZqu+akTYCi3RoOwEbul5+yqCLDzmjtmk1vmK6YFhDkr7TW0cUL80VrPQod1+n0yTJkj1e1JPXgSsbDa1QW7Fq69XCejL2I1CA829hJ2PHiXhWC7VbcCynzrP2RmRctLfAwMpzzk5MHPsxYW6CxCGhb++0y11AvSYU3rippXC/+MTNe6iXein8/SvU2nw3rUbYydq+FnsrUqbMJwRME+03zC06ixBuE04ItDE7BdHA6Jo4BLRjI4jyXWqZogxM8HN2Zq45f7M6G+nAiB3oW9FPtgOkb0HhW]]></acast:settings>
			<itunes:subtitle><![CDATA[On this weeks&nbsp;Football Writers Podcast, Mike Calvin, Adrian Clarke and Dominic Fifield assess the current state of Liverpool and Manchester United both on and off the pitch, as rivalries renew once again this&nbsp;weekend.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[On this weeks&nbsp;Football Writers Podcast, Mike Calvin, Adrian Clarke and Dominic Fifield assess the current state of Liverpool and Manchester United both on and off the pitch, as rivalries renew once again this&nbsp;weekend.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[On this weeks&nbsp;Football Writers Podcast, Mike Calvin, Adrian Clarke and Dominic Fifield assess the current state of Liverpool and Manchester United both on and off the pitch, as rivalries renew once again this&nbsp;weekend.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is time up for Eddie Howe at Bournemouth?</title>
			<itunes:title>Is time up for Eddie Howe at Bournemouth?</itunes:title>
			<pubDate>Mon, 06 Jan 2020 17:08:13 GMT</pubDate>
			<itunes:duration>48:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/istimeupforeddiehoweatbournemouth-/media.mp3" length="45976046" type="audio/mpeg"/>
			<guid isPermaLink="false">0b55b5fb-b833-4dad-aeb6-f4c3feaa976a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/istimeupforeddiehoweatbournemouth-</link>
			<acast:episodeId>0b55b5fb-b833-4dad-aeb6-f4c3feaa976a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>istimeupforeddiehoweatbournemouth-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9rdQ9ppQWNZA0JUuDhk3ZtuKjT3HUVVdZU63bpxkRqFfTR4FJI+8fF3omnneXMMnMqpI5Nbs4OrzZJ29zzQ95lsFeAhVYfl65RTOuyPh7pbkvKiMrtTCxCgisnRja5YKSP2hQ9BZTRy+2tqR6NaXf0VA5SXZI+zURz/lLlfDG/UdtiUtZ8V96VkBBQYDoUqH0oi3kUOaNRrD8J+AVATCCfYJUEDAlAcEqPH/pg9XWLLto+YDFl2X94pYPZZKvZMcA]]></acast:settings>
			<itunes:subtitle>This week on the Football Writers podcast, Mike Calvin is joined by Darren Lewis and Seb Stafford-Bloor who look at the issues which lie ahead for the sides at the bottom of the Premier League table as the pressure begins to mount on relegation threate...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[This week on the Football Writers podcast, Mike Calvin is joined by Darren Lewis and Seb Stafford-Bloor who look at the issues which lie ahead for the sides at the bottom of the Premier League table as the pressure begins to mount on relegation threatened Bournemouth and their manager Eddie Howe.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[This week on the Football Writers podcast, Mike Calvin is joined by Darren Lewis and Seb Stafford-Bloor who look at the issues which lie ahead for the sides at the bottom of the Premier League table as the pressure begins to mount on relegation threatened Bournemouth and their manager Eddie Howe.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Dare to Dream: An FA Cup special.</title>
			<itunes:title>Dare to Dream: An FA Cup special.</itunes:title>
			<pubDate>Thu, 02 Jan 2020 06:00:00 GMT</pubDate>
			<itunes:duration>31:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/daretodream-anfacupspecial-/media.mp3" length="76020032" type="audio/mpeg"/>
			<guid isPermaLink="false">b3633cd1-4ee6-48af-8c19-ba68661bbf9d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/daretodream-anfacupspecial-</link>
			<acast:episodeId>b3633cd1-4ee6-48af-8c19-ba68661bbf9d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>daretodream-anfacupspecial-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRE8Ty5OUwElvlfC5adsmCimiz5SkW2ET9ywRFwb0ZB3t3cvCSG6Saqp1X5iOHVgXITFQ1kJ585k2RZzULR6YBkXzbF/DVS9JKZsZOMhsfE8vYrnWLeVE+zRvthPEnlQMicj07fiMrWSgQP+uqqw4mZ29OosjjIlR1J1fqqbZWc4NzkTPOe264+MBilPeqi1yc/JcEQUQaKSWUKy8L9ePaPR5PNXOhwJONWKkJDr8qbh9KA93ArCBrOOE58niJDyD7uxRLaZV83eGx1mI6FZaHH9vyHabYdg+utQ/cw9YDjMq]]></acast:settings>
			<itunes:subtitle>Mike Calvin, John Cross and David Preece search for impending upsets in the third round of the FA Cup. West Ham, Southampton, Norwich and Chelsea under threat? The panel make their judgements, and name their eventual winners.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and David Preece search for impending upsets in the third round of the FA Cup. West Ham, Southampton, Norwich and Chelsea under threat? The panel make their judgements, and name their eventual winners.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and David Preece search for impending upsets in the third round of the FA Cup. West Ham, Southampton, Norwich and Chelsea under threat? The panel make their judgements, and name their eventual winners.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>The Perfect Ten for BT Sport?</title>
			<itunes:title>The Perfect Ten for BT Sport?</itunes:title>
			<pubDate>Mon, 30 Dec 2019 06:00:00 GMT</pubDate>
			<itunes:duration>30:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/theperfecttenforbtsport-/media.mp3" length="72308612" type="audio/mpeg"/>
			<guid isPermaLink="false">116b4061-4558-4c3e-a7e9-9898e5171637</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/theperfecttenforbtsport-</link>
			<acast:episodeId>116b4061-4558-4c3e-a7e9-9898e5171637</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>theperfecttenforbtsport-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9766+h80PgALCi19eXDPZ4Td8fNvx/oxdkIiVPGRzmT5jAgwGZO3ZclF1FxBAUJcXaA/D53rBB4gs2K+zy6qYXTNpKuyg6f7NbMiCslEdiduz5kN++Us+eoUxxUF4ELqiJadTBQKakQge/T8TSbqQXme1iEu74dJ0BIDpUcitqhI0Lej0IfAnjRKhqKiHCGUO2Nt8bhajjDXKoB/fC6a5PFTcngMKtPkV7L7OGXTiRxM=]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by John Cross and David Preece to discuss the New Year’s programme, and focus on the job prospects of Ole Gunnar Solksjaer at Manchester United. They also name their breakthrough player of the season.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by John Cross and David Preece to discuss the New Year’s programme, and focus on the job prospects of Ole Gunnar Solksjaer at Manchester United. They also name their breakthrough player of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by John Cross and David Preece to discuss the New Year’s programme, and focus on the job prospects of Ole Gunnar Solksjaer at Manchester United. They also name their breakthrough player of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>First Europe. Now the World.</title>
			<itunes:title>First Europe. Now the World.</itunes:title>
			<pubDate>Mon, 23 Dec 2019 17:22:56 GMT</pubDate>
			<itunes:duration>32:25</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/firsteurope.nowtheworld-/media.mp3" length="77768732" type="audio/mpeg"/>
			<guid isPermaLink="false">c24f26a3-505c-4dcf-b765-b659c8301a15</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/firsteurope.nowtheworld-</link>
			<acast:episodeId>c24f26a3-505c-4dcf-b765-b659c8301a15</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>firsteurope.nowtheworld-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRNWxijeDZG2ZMimx40cgPFe8frxd9hLzzQy5g4I/31JnLV3EEaFZANb4Fm+2c/RWktlfGdVjmmrw3b3GaK2Rd4BbnG1LV/xgO5fBf+XLsIVpgTC5EB/uEV4qiHUMH9zDC9/V0gIrAXrhOVkLuStio5XNWq2oLoPTDCg9gwms16NMczC/d/kWlYI+3IRxUaxyEh7zbc0pRv5fHPXu5HqNNwCgduNg+F7qW+An35cq4QVeDvrmop4mCJ1WprqLc9qMKlGCkXg+cTJncL3ukcsKVI5+tpjWTg9IqJWDlbKwKcQm]]></acast:settings>
			<itunes:subtitle>Will Liverpool finally become champions of England in the Premier League era? Mike Calvin is joined by John Cross and David Preece to discuss the building of a Super Club on Merseyside. Also features analysis of the challenges facing Carlo Ancelotti, M...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Will Liverpool finally become champions of England in the Premier League era? Mike Calvin is joined by John Cross and David Preece to discuss the building of a Super Club on Merseyside. Also features analysis of the challenges facing Carlo Ancelotti, Mikel Arteta and Pep Guardiola.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Will Liverpool finally become champions of England in the Premier League era? Mike Calvin is joined by John Cross and David Preece to discuss the building of a Super Club on Merseyside. Also features analysis of the challenges facing Carlo Ancelotti, Mikel Arteta and Pep Guardiola.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Women’s Football Podcast: What’s next for women’s football?</title>
			<itunes:title>Women’s Football Podcast: What’s next for women’s football?</itunes:title>
			<pubDate>Thu, 19 Dec 2019 10:54:13 GMT</pubDate>
			<itunes:duration>44:51</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/women-sfootballpodcast-what-snextforwomen-sfootball-/media.mp3" length="42966974" type="audio/mpeg"/>
			<guid isPermaLink="false">ce978945-6fdb-48e8-ab8e-775dd7b69c60</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/women-sfootballpodcast-what-snextforwomen-sfootball-</link>
			<acast:episodeId>ce978945-6fdb-48e8-ab8e-775dd7b69c60</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>women-sfootballpodcast-what-snextforwomen-sfootball-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9RqtqZ7mljQQG5SthMiguR0yWLQ25Kt8oLkIrd+9jEBfUa+PCKRRKOSyodsbCp2LivcpnnUXrjHbvKPYSt8Cx/rjamJAT5plvQ1FN13mGng6ITk4716QKq4iN+B30bdgrQSOz0VoLeHTNlcHV0vNOO4Fgr2q/WTjjI1ux6R1kNxHVAV4vKKfKF0Qfv0eYFs7TxNkzpMfCUUCfiWDYm7+weBwPdKrzpxJUJ+U8bnMCocBo+FDB7nxXfUkYgWEhGfS0]]></acast:settings>
			<itunes:subtitle>After a breakthrough year, the Olympics beckon in 2020. Mike Calvin is joined by Suzy Wrack, Katie Whyatt and Kieran Theivam to discuss Team GB, and the rise of the WSL.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[After a breakthrough year, the Olympics beckon in 2020. Mike Calvin is joined by Suzy Wrack, Katie Whyatt and Kieran Theivam to discuss Team GB, and the rise of the WSL.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[After a breakthrough year, the Olympics beckon in 2020. Mike Calvin is joined by Suzy Wrack, Katie Whyatt and Kieran Theivam to discuss Team GB, and the rise of the WSL.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Liverpool? Man City? Barcelona? Who will win the 2019/20 Champions League?</title>
			<itunes:title>Liverpool? Man City? Barcelona? Who will win the 2019/20 Champions League?</itunes:title>
			<pubDate>Mon, 16 Dec 2019 17:38:39 GMT</pubDate>
			<itunes:duration>45:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/liverpool-mancity-barcelona-whowillwinthe2019-20championsleague-/media.mp3" length="43477382" type="audio/mpeg"/>
			<guid isPermaLink="false">c6565d55-5df9-4236-980d-a28220b00b8b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/liverpool-mancity-barcelona-whowillwinthe2019-20championsleague-</link>
			<acast:episodeId>c6565d55-5df9-4236-980d-a28220b00b8b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>liverpool-mancity-barcelona-whowillwinthe2019-20championsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRKUXfeSteZNqvEXCMxrYHLOmJ1ZN68ClOHnFjW6SUNDdtUfZsRzhW8oxH8THPnC64cFYDzJ5OQdX+HpeG8W5EZYb/AQFjy8DVy2diMqARoPljdhEOHh6CzjQaCJoLaf4yRwcdFdfuOzdBWgmp3/CLJ+Ax4ubBEjY97WqgNNYmjgZK8eXBFHKytYuOjKG58UNpkp4XMNeE0FTX9ZfmOslWJ4aR1eFDToJNcxSiUj1CcjOMHdyjigx3o3kEMmwasST6ehhwuEn1IjnxxEy2s+q2OiqILdwZQQgssN4NVUpPbwn]]></acast:settings>
			<itunes:subtitle><![CDATA[Tony Hodson and Miguel Delaney join Mike Calvin following the draw for the last 16 of the Champions League. Together they consider Jürgen Klopp's place among Liverpool's greatest managers, discuss Manchester City's chances of overcoming ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Tony Hodson and Miguel Delaney join Mike Calvin following the draw for the last 16 of the Champions League. Together they consider Jürgen Klopp's place among Liverpool's greatest managers, discuss Manchester City's chances of overcoming Real Madrid and whether the time is right for Mikel Arteta to make the move into management at Arsenal.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Tony Hodson and Miguel Delaney join Mike Calvin following the draw for the last 16 of the Champions League. Together they consider Jürgen Klopp's place among Liverpool's greatest managers, discuss Manchester City's chances of overcoming Real Madrid and whether the time is right for Mikel Arteta to make the move into management at Arsenal.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Could Liverpool go the whole Premier League season unbeaten?</title>
			<itunes:title>Could Liverpool go the whole Premier League season unbeaten?</itunes:title>
			<pubDate>Mon, 09 Dec 2019 16:55:35 GMT</pubDate>
			<itunes:duration>52:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/couldliverpoolgothewholepremierleagueseasonunbeaten-/media.mp3" length="101395013" type="audio/mpeg"/>
			<guid isPermaLink="false">a24b5ef8-a6b6-424b-96bb-d1414f486f53</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/couldliverpoolgothewholepremierleagueseasonunbeaten-</link>
			<acast:episodeId>a24b5ef8-a6b6-424b-96bb-d1414f486f53</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>couldliverpoolgothewholepremierleagueseasonunbeaten-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFNEEFrd16YmpALSOKEGyXIESmsSocuNEzptR9lpf5CxZU9adpsIXdXzQPFws8xTe/C9h8Hir3oMmKfDkNF7GLQD4ozsjsBakMEEQ+b0/44CUKfp4V84v4pNTuggK71N3vytEc3NZBStnKUNW1QRWiLuKRdznA/JCTYI9Z0SCGqOSTjCbx9tHa3y5iTVR4E8gFmD7sROjSlyVxhsxcTExTE8iNzzIGM6xZHnJffCprP5dVXoy3yuNsIH7DKO04LzVJp9cOj5u6m86QMnyrrd/GI9CCvLnJeF4M7nTpahDkGP]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Darren Lewis and Seb Stafford-Bloor to discuss Liverpool's firm grip on the Premier League title, Manchester United's blistering victory at rivals City, and the chances of all four English teams reaching the Champions...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Darren Lewis and Seb Stafford-Bloor to discuss Liverpool's firm grip on the Premier League title, Manchester United's blistering victory at rivals City, and the chances of all four English teams reaching the Champions League knockout stage.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Darren Lewis and Seb Stafford-Bloor to discuss Liverpool's firm grip on the Premier League title, Manchester United's blistering victory at rivals City, and the chances of all four English teams reaching the Champions League knockout stage.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Ljungberg the right man to succeed Emery at Arsenal?</title>
			<itunes:title>Is Ljungberg the right man to succeed Emery at Arsenal?</itunes:title>
			<pubDate>Mon, 02 Dec 2019 16:57:24 GMT</pubDate>
			<itunes:duration>48:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isljungbergtherightmantosucceedemeryatarsenal-/media.mp3" length="46350095" type="audio/mpeg"/>
			<guid isPermaLink="false">11cd15f1-b534-4d53-9591-bf79fe06a944</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isljungbergtherightmantosucceedemeryatarsenal-</link>
			<acast:episodeId>11cd15f1-b534-4d53-9591-bf79fe06a944</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isljungbergtherightmantosucceedemeryatarsenal-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz98+15uYOkt5Qg8NxjzWWI20MUinqE0vGATwxzByINAAbhQEk1aOkZTh4/jM/I4P+q/+YtqVk3xGyZSyXlZlACXJC9BF9QctriimdOtVwNqUcN3+X0qyeabt22xihSSxgT2fcMi8aHKHnaJtdIZ9DAe4bettkffFGjhmc5our9DPazAQ5cczhrFA1C93tReVXUF9lZobQck5Ok/NTwCUFeT1uaJEeggUgWs4BYzkrhIXvN79FOkVXCT3mCz7oePkb3]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, John Cross and David Preece discuss Arsenal's managerial options and look ahead to the midweek Premier League fixtures as Jose Mourinho returns to Old Trafford.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and David Preece discuss Arsenal's managerial options and look ahead to the midweek Premier League fixtures as Jose Mourinho returns to Old Trafford.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and David Preece discuss Arsenal's managerial options and look ahead to the midweek Premier League fixtures as Jose Mourinho returns to Old Trafford.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is José Mourinho a changed man?</title>
			<itunes:title>Is José Mourinho a changed man?</itunes:title>
			<pubDate>Mon, 25 Nov 2019 17:44:52 GMT</pubDate>
			<itunes:duration>47:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isjosemourinhoachangedman-/media.mp3" length="68068864" type="audio/mpeg"/>
			<guid isPermaLink="false">efe0509c-d76f-4d84-9cd2-6541802c446b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isjosemourinhoachangedman-</link>
			<acast:episodeId>efe0509c-d76f-4d84-9cd2-6541802c446b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isjosemourinhoachangedman-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBsFuZbFKy3V6lkmJGZqnq+JBxt01Ub+iLOuK0aJWol/S8PCKuD1+LlTLetM6HWnmnaEIFiJaHoJtjxZw9PAlyDB3Y3plsDYal220VyovYkkhUj/okdDE+XYqVPRqjMsdKBn6nlZOjJQWdOYJMbWeXCEG2k6K/WOhD8KgB1vQow6ESRxJB3YUcRB0j4g2MsIR5tgH6xEFpPALKfWyHr9Q7+1iEHm06vil6JDSi2xq8PyxK5CN0gWdXROMtrkTf/+cI/4usZiS+xN68CySIdLD/Hy3oOv+948GojvWo+8R+5n]]></acast:settings>
			<itunes:subtitle><![CDATA[Adrian Clarke and Dominic Fifield join Mike Calvin to discuss Tottenham's decision to replace Mauricio Pochettino with José Mourinho, and how the future looks for the North London club with the 'Humble One' at the helm.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Adrian Clarke and Dominic Fifield join Mike Calvin to discuss Tottenham's decision to replace Mauricio Pochettino with José Mourinho, and how the future looks for the North London club with the 'Humble One' at the helm.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Adrian Clarke and Dominic Fifield join Mike Calvin to discuss Tottenham's decision to replace Mauricio Pochettino with José Mourinho, and how the future looks for the North London club with the 'Humble One' at the helm.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>How do Spurs move forward?</title>
			<itunes:title>How do Spurs move forward?</itunes:title>
			<pubDate>Mon, 18 Nov 2019 17:56:14 GMT</pubDate>
			<itunes:duration>45:29</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/howdospursmoveforward-/media.mp3" length="65402104" type="audio/mpeg"/>
			<guid isPermaLink="false">7f338d25-695c-4f63-8d5b-454fa3fdf936</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/howdospursmoveforward-</link>
			<acast:episodeId>7f338d25-695c-4f63-8d5b-454fa3fdf936</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>howdospursmoveforward-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9qtNnJqRVqXafY3dEgJBhmo5DID8/DLz/t1g8yS3XDQUw8C8VJ1l/y0wOOYCt0PvQNlo0UWm6vks/86yG441apMZn9+j6/747D2cIz0bN7kRrR4mo9yb71ynbqD6C/adoZpJaNSM1Ba0XWQytI0b8toOpwvXvtxPjK5Wj+LXaQWAoI4jVMJzxM7wOp7FJj/sKJ2uGvWAet4A/9ymYfzlQFs5WqLKXzvtQzOejczAypAW0HTIMPdjySaSc3+KNeZIL]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Seb Stafford-Bloor and Andy Dillon look ahead to the London derby between West Ham and Spurs this weekend with both managers under pressure. The panel also assess England’s final Euro 2020 qualifiers and look at the club sides benefiting f...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford-Bloor and Andy Dillon look ahead to the London derby between West Ham and Spurs this weekend with both managers under pressure. The panel also assess England’s final Euro 2020 qualifiers and look at the club sides benefiting from the England setup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford-Bloor and Andy Dillon look ahead to the London derby between West Ham and Spurs this weekend with both managers under pressure. The panel also assess England’s final Euro 2020 qualifiers and look at the club sides benefiting from the England setup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Women's Football Podcast: Phil Neville: Is it time to get behind England’s struggling coach?]]></title>
			<itunes:title><![CDATA[Women's Football Podcast: Phil Neville: Is it time to get behind England’s struggling coach?]]></itunes:title>
			<pubDate>Tue, 12 Nov 2019 18:14:00 GMT</pubDate>
			<itunes:duration>39:25</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/womensfootballpodcast-philneville-isittimetogetbehindengland-sstrugglingcoach-/media.mp3" length="56683176" type="audio/mpeg"/>
			<guid isPermaLink="false">3cae05a0-0f6e-425e-b723-f48037b60e57</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/womensfootballpodcast-philneville-isittimetogetbehindengland-sstrugglingcoach-</link>
			<acast:episodeId>3cae05a0-0f6e-425e-b723-f48037b60e57</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>womensfootballpodcast-philneville-isittimetogetbehindengland-sstrugglingcoach-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz93iXx//Ez59cyD6s1IjTgQgORNGMqyCYa3VPKT9/tql2M9wOsW41QtpMOn05yCLo4VC5U0HLDMhZm8MJ4LUUHJhAuIOho+MqLnNZPqRc0zdrvIZ6ZdHul2BIhNahtdXTY/+8hwcFP67eHcmqSUEm4dReLgQjY4KBV6np4/xI6xm4Wa4FMzyMCEDRta/o64K4GiXHPQMmJfzqHlPjpHrE/E/8Cb1CyjW7w5hVJJjIXzOgqFNx9r0KKwqhEoWN7CVAL]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined on the women’s football podcast by journalist Anne Marie Batson, Sophie Downey, of Girls On the Ball and former England and Arsenal captain Faye White.After England’s defeat to Germany on Saturday, is Phil Neville’s tenure unde...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Mike Calvin is joined on the women’s football podcast by journalist Anne Marie Batson, Sophie Downey, of Girls On the Ball and former England and Arsenal captain Faye White.</p><br><p>After England’s defeat to Germany on Saturday, is Phil Neville’s tenure under threat? As Spurs play host to Arsenal at White Hart Lane, what can we expect from the big showpiece this weekend? Who can win the Champions League? Also 750 pubs across UK will be showcasing a feast of women’s football on BT Sport this weekend as this podcast was brought to you from London’s Red Lioness in Liverpool Street.</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Mike Calvin is joined on the women’s football podcast by journalist Anne Marie Batson, Sophie Downey, of Girls On the Ball and former England and Arsenal captain Faye White.</p><br><p>After England’s defeat to Germany on Saturday, is Phil Neville’s tenure under threat? As Spurs play host to Arsenal at White Hart Lane, what can we expect from the big showpiece this weekend? Who can win the Champions League? Also 750 pubs across UK will be showcasing a feast of women’s football on BT Sport this weekend as this podcast was brought to you from London’s Red Lioness in Liverpool Street.</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>A decisive day in the title race?</title>
			<itunes:title>A decisive day in the title race?</itunes:title>
			<pubDate>Mon, 11 Nov 2019 18:46:39 GMT</pubDate>
			<itunes:duration>45:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/adecisivedayinthetitlerace-/media.mp3" length="43541600" type="audio/mpeg"/>
			<guid isPermaLink="false">93c5e9a3-b4d2-4f93-89f0-bc1ffd668034</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/adecisivedayinthetitlerace-</link>
			<acast:episodeId>93c5e9a3-b4d2-4f93-89f0-bc1ffd668034</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>adecisivedayinthetitlerace-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRGjzbeBSSpEkVUukqn651SQmkeXGR+cutRsQg4TEVxaGcYMbispdL0W5w0WHMBxA19avKbStgXHbMz1jtyPC5+OeYNNNtIWbIxgJ+Gzp4QMEVFfWrgpIggkWbjlrgCBCSzUIgvGMLiF4iHyjkCYyiWs9eyVMUWnYgdhoDT6ucNPKmOm0L8cGKUUPOFdtoSHRFKi7o7KDnBT6L82KEahWSwtoHVJzsoTWhBV6CXLA5UKyi5Ql+v58MM2QGdw0tffzfRvmkU9b6F+FUHvw6h4MltDL+dVdDbFvkAVxfCiVSmFL]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Dave Kidd, and Tom Hopkinson discuss Liverpool's triumph over Man City and its implications for the title. They also talk about what Leicester's win over Arsenal means for the managers of both clubs and whether we will see a sack...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dave Kidd, and Tom Hopkinson discuss Liverpool's triumph over Man City and its implications for the title. They also talk about what Leicester's win over Arsenal means for the managers of both clubs and whether we will see a sacking during the coming International Break.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dave Kidd, and Tom Hopkinson discuss Liverpool's triumph over Man City and its implications for the title. They also talk about what Leicester's win over Arsenal means for the managers of both clubs and whether we will see a sacking during the coming International Break.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Women's Football Podcast: England v Germany – who comes out on top?]]></title>
			<itunes:title><![CDATA[Women's Football Podcast: England v Germany – who comes out on top?]]></itunes:title>
			<pubDate>Thu, 07 Nov 2019 06:00:00 GMT</pubDate>
			<itunes:duration>45:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/englandvgermany-whocomesoutontop-/media.mp3" length="43694222" type="audio/mpeg"/>
			<guid isPermaLink="false">227be8df-2841-4e25-8973-5a56d4b6eb62</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/englandvgermany-whocomesoutontop-</link>
			<acast:episodeId>227be8df-2841-4e25-8973-5a56d4b6eb62</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>englandvgermany-whocomesoutontop-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREyWG1aYmuyLiLuRHAGmHQSNamGxv2kjeKAKqYbuiLIjGoG92mwqSTD6PKaQoyG8IwOC5/28S7TUHq12MB488MVpmiQOC+6dk/BlnKXkwtUpheMOYplfSpyYHHUDGBDcIf+F+kJXgQJTLUYoWhk9jisB6lW+RrQqP7vZhn2/GJWaHglWlbqDQsXid0+AW05DvEGdyTz4s/D3nkkkfOjGt+FrbX4gKivUXqHugAXxYU4uBvZm7s8NDmFYQ0qPcva9TXbGq3KhzVxWbMqTAv0Kh97JOgjN6y5pGP8VwqjRRSl+]]></acast:settings>
			<itunes:subtitle>Ahead of a big week for England, Mike Calvin is joined by Molly Hudson, Glenn Moore and Anne-Marie Batson. 90,000 fans are expected to descend on Wembley to watch the Lionesses take on Germany on Saturday, but is our nations team in the best form possi...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Ahead of a big week for England, Mike Calvin is joined by Molly Hudson, Glenn Moore and Anne-Marie Batson. 90,000 fans are expected to descend on Wembley to watch the Lionesses take on Germany on Saturday, but is our nations team in the best form possible to make the most of the opportunity?</p><br><p>The four also discuss the upcoming Champions League draw, will anyone bring down favourites Lyon? And over in the Women’s Super League – how does it compare to similar leagues around the world and is enough being done to prevent and manage injuries amongst our top players?</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Ahead of a big week for England, Mike Calvin is joined by Molly Hudson, Glenn Moore and Anne-Marie Batson. 90,000 fans are expected to descend on Wembley to watch the Lionesses take on Germany on Saturday, but is our nations team in the best form possible to make the most of the opportunity?</p><br><p>The four also discuss the upcoming Champions League draw, will anyone bring down favourites Lyon? And over in the Women’s Super League – how does it compare to similar leagues around the world and is enough being done to prevent and manage injuries amongst our top players?</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Liverpool or Manchester City - who's under more pressure?]]></title>
			<itunes:title><![CDATA[Liverpool or Manchester City - who's under more pressure?]]></itunes:title>
			<pubDate>Mon, 04 Nov 2019 16:59:28 GMT</pubDate>
			<itunes:duration>47:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/liverpoolormanchestercity-whosundermorepressure-/media.mp3" length="45818420" type="audio/mpeg"/>
			<guid isPermaLink="false">2c40d8a8-d563-4364-b770-38de32a83b97</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/liverpoolormanchestercity-whosundermorepressure-</link>
			<acast:episodeId>2c40d8a8-d563-4364-b770-38de32a83b97</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>liverpoolormanchestercity-whosundermorepressure-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRCMlMTI4v/kISaRPobfP2d2/ioXd43cxPpfApPfSAB/X1XQYQRqNvfm4lRV0LmeCG03WbeZ2CjtF7ElocMavw+9erfYQ/Ql/LGrX+siLyv9NheIXag1/prYlFimqv9vPy4a2fFPOzaW8Z4imc9YPayjO7nnWBcbYedNwk8JLjXdyLtvXz6SZMDH5yuSi6Ft3PQVlWgocpP5Y69ywuvueDy8L3fGzDCThEFuuDpYWGUcQloNddRIMJQ91AQ5DEtuSTMTK6AzkOnWSFGK98JppT4tBaqv7tpNxcuMAHHVK9M6n]]></acast:settings>
			<itunes:subtitle><![CDATA[Daniel&nbsp;Storey and Alyson Rudd join Mike Calvin to discuss this week's top of the table clash between Liverpool and Manchester City. Will Liverpool's relentlessness see them add another three points at Anfield to extend their title ch...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Daniel&nbsp;Storey and Alyson Rudd join Mike Calvin to discuss this week's top of the table clash between Liverpool and Manchester City. Will Liverpool's relentlessness see them add another three points at Anfield to extend their title chances?</p><br><p>The three&nbsp;also&nbsp;talk about VAR, how long&nbsp;it will take to perfect and if it's really worth the wait.&nbsp;And,&nbsp;ahead of&nbsp;another week in Europe, how will our English teams fare?&nbsp;Chelsea are seemingly on a trajectory, but&nbsp;can Tottenham&nbsp;and Manchester Utd improve moods around their clubs.</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Daniel&nbsp;Storey and Alyson Rudd join Mike Calvin to discuss this week's top of the table clash between Liverpool and Manchester City. Will Liverpool's relentlessness see them add another three points at Anfield to extend their title chances?</p><br><p>The three&nbsp;also&nbsp;talk about VAR, how long&nbsp;it will take to perfect and if it's really worth the wait.&nbsp;And,&nbsp;ahead of&nbsp;another week in Europe, how will our English teams fare?&nbsp;Chelsea are seemingly on a trajectory, but&nbsp;can Tottenham&nbsp;and Manchester Utd improve moods around their clubs.</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Is Emery's time up at Arsenal?]]></title>
			<itunes:title><![CDATA[Is Emery's time up at Arsenal?]]></itunes:title>
			<pubDate>Mon, 28 Oct 2019 17:43:42 GMT</pubDate>
			<itunes:duration>48:35</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isemerystimeupatarsenal-/media.mp3" length="46537328" type="audio/mpeg"/>
			<guid isPermaLink="false">3d22140e-4fe3-4ec3-860a-15b245fece09</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isemerystimeupatarsenal-</link>
			<acast:episodeId>3d22140e-4fe3-4ec3-860a-15b245fece09</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isemerystimeupatarsenal-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRIeOPfIU7kPmbP7fp813k1zJzuuDNEvdm+hfI45hQi9D1Vw/wATVP8lO0yqiJ2oeiRO21jFq7MuYHEx396loLaFDbal6d0aTZoGbzlPD1FVQpkS6g3Ws/I5L7upic7A7ujyRQrw7THZowSedIrOaQ3JFLLoWa+WlnrHymF7DSGItfdpWDTMQwSrDiajgvJi+43q8IKnkfWVlIDEBOx3crWTxEdLjmgzDRhUkJW2q91igRqQ4uKZiur9BLyNQk5IpXE2UrDOETm0JKKOtxGbM5FtP4sX6+WyfbK7dM/OPc0Ki]]></acast:settings>
			<itunes:subtitle><![CDATA[John Cross of the Daily Mirror and Tony Hodson of The Coaches' Voice join Mike Calvin to cast their eye over the weekend of football. Is it Granit Xhaka, the fans or Unai Emery, who should take the blame for what happened at Emirates Stadium on Sa...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>John Cross of the Daily Mirror and Tony Hodson of The Coaches' Voice join Mike Calvin to cast their eye over the weekend of football. Is it Granit Xhaka, the fans or Unai Emery, who should take the blame for what happened at Emirates Stadium on Saturday? On the opposite side of the spectrum, Chelsea are flying under Frank Lampard. Should Arsenal follow the Blues' example and appoint a legendary player at the helm?</p><br><p>Liverpool continue to impress, but with Mo Salah being substituted with an ankle injury, do the Reds have the squad to cover? Their title rivals Manchester City kept up the pace with Raheem Sterling continuing his fine form...form which our team believe could take him to the Ballon d'Or.</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>John Cross of the Daily Mirror and Tony Hodson of The Coaches' Voice join Mike Calvin to cast their eye over the weekend of football. Is it Granit Xhaka, the fans or Unai Emery, who should take the blame for what happened at Emirates Stadium on Saturday? On the opposite side of the spectrum, Chelsea are flying under Frank Lampard. Should Arsenal follow the Blues' example and appoint a legendary player at the helm?</p><br><p>Liverpool continue to impress, but with Mo Salah being substituted with an ankle injury, do the Reds have the squad to cover? Their title rivals Manchester City kept up the pace with Raheem Sterling continuing his fine form...form which our team believe could take him to the Ballon d'Or.</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has Pochettino run his race at Tottenham?</title>
			<itunes:title>Has Pochettino run his race at Tottenham?</itunes:title>
			<pubDate>Mon, 21 Oct 2019 16:21:23 GMT</pubDate>
			<itunes:duration>46:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/haspochettinorunhisraceattottenham-/media.mp3" length="67171806" type="audio/mpeg"/>
			<guid isPermaLink="false">d40823c3-27a0-45f7-b93b-073ee32f5cf0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/haspochettinorunhisraceattottenham-</link>
			<acast:episodeId>d40823c3-27a0-45f7-b93b-073ee32f5cf0</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>haspochettinorunhisraceattottenham-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9dT4WBXYiS/MtVTTAoD74bq6YSii83pWfiMWxZtgsDMHLpW/79EjnBdIqkioPybqVlcKvya6rHAm+yVDrGxgOuyTJ7mB+Nusct3YQMoBtVYGhzNiowNDUp+rhmb+LkN1bLp4GX+In8kcANea2rfe5Je/yp43onRZgdM2L33r7bxmCowinxR2XZ5e+ObJzeOTqtO7TQChaA5iSNDgf6HUZYJDIGIz3HeXLyVF1oQwwdM0HEenIFQxTkP2PsTC9xB66]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Seb Stafford-Bloor and Adrian Clarke consider Mauricio Pochettino's future at Tottenham, reflect on more VAR drama in the Premier League and look ahead to this week's Champions League action.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Seb Stafford-Bloor and Adrian Clarke consider Mauricio Pochettino's future at Tottenham, reflect on more VAR drama in the Premier League and look ahead to this week's Champions League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Seb Stafford-Bloor and Adrian Clarke consider Mauricio Pochettino's future at Tottenham, reflect on more VAR drama in the Premier League and look ahead to this week's Champions League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>A return to the game for Jose Mourinho appears imminent but where?</title>
			<itunes:title>A return to the game for Jose Mourinho appears imminent but where?</itunes:title>
			<pubDate>Mon, 14 Oct 2019 17:06:22 GMT</pubDate>
			<itunes:duration>46:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/areturntothegameforjosemourinhoappearsimminentbutwhere-/media.mp3" length="67184326" type="audio/mpeg"/>
			<guid isPermaLink="false">3276f052-880f-4302-a92c-a0d876de8485</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/areturntothegameforjosemourinhoappearsimminentbutwhere-</link>
			<acast:episodeId>3276f052-880f-4302-a92c-a0d876de8485</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>areturntothegameforjosemourinhoappearsimminentbutwhere-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRNwhth3SMPO8tA/0G339JDAj/BhJ6MOWrw/pgdD0w2htf5+h8BDESy0HHEsv9CoA86xuY3K0/cLHsoatXUYYphGFtKvzG9dbXALVLgAD14YemrOpvoyuypH7GIo2W1jnAo3Vt5f5rUsd97GZ6sAZ5QFdotxIivVSNKFCKgrN4/DHL/vj7hsLHkXuLwAOhB9yWovc4Hj0E0X1pn59F2i3ilRiX+66EodENO1R2J3mIJ4MpW8zYkTCQkvKS6aFfVj5PyhthFNrp0u9yxGWLXYfO4/Vf5c0xFUfnZuYgp6Yxc99]]></acast:settings>
			<itunes:subtitle><![CDATA[Michael Calvin is joined by The Athletic's Dominic Fifield and football writer and broadcaster Daniel Storey.&nbsp;What next for Jose Mourinho? Can Liverpool make it 18 wins in a row at Old Trafford on Sunday? Is playing for an unfashionabl...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Michael Calvin is joined by The Athletic's Dominic Fifield and football writer and broadcaster Daniel Storey.&nbsp;</p><br><p>What next for Jose Mourinho? Can Liverpool make it 18 wins in a row at Old Trafford on Sunday? Is playing for an unfashionable club a detriment to international opportunities? Have Leicester got enough strength in depth to mount a top six bid?</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Michael Calvin is joined by The Athletic's Dominic Fifield and football writer and broadcaster Daniel Storey.&nbsp;</p><br><p>What next for Jose Mourinho? Can Liverpool make it 18 wins in a row at Old Trafford on Sunday? Is playing for an unfashionable club a detriment to international opportunities? Have Leicester got enough strength in depth to mount a top six bid?</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who is to blame for the demise at Manchester United?</title>
			<itunes:title>Who is to blame for the demise at Manchester United?</itunes:title>
			<pubDate>Mon, 07 Oct 2019 15:36:39 GMT</pubDate>
			<itunes:duration>46:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whoistoblameforthedemiseatmanchesterunited-/media.mp3" length="66222164" type="audio/mpeg"/>
			<guid isPermaLink="false">1a8d0d0b-006c-407c-9474-4f110aab4039</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whoistoblameforthedemiseatmanchesterunited-</link>
			<acast:episodeId>1a8d0d0b-006c-407c-9474-4f110aab4039</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whoistoblameforthedemiseatmanchesterunited-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9SZKImQW22XLzxDYacKfZXbI28LtLvCvKVWWSZoh3f6/U2b9E+bKyoAC4tSiEeTCYC7Bai91jDgnPW/0XuMoRF5JI1ZnhtTQS2r+ejCXCxdEDVsWJtydR/KTEK4nIvUnC1yh1Vxftnxw09OPEwAa+i/OH44oMoBd5GtiGrwijWaZ7LP6Iyj5DfZrz03kP/LNe5F3tNdyiBDYXcX0z3urwMtDpOP4NR5OWJWi0sJkq13KG97zvN7AeY+5gchRp42Wf]]></acast:settings>
			<itunes:subtitle>Michael Calvin is joined by Darren Lewis from the Daily Mirror and Chief football writer at the Independent in Miguel Delaney.The guys discuss the damage of defeats for Manchester United and Tottenham to Newcastle and Brighton respectively. Is the t...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Michael Calvin is joined by Darren Lewis from the Daily Mirror and Chief football writer at the Independent in Miguel Delaney.</p><br><p>The guys discuss the damage of defeats for Manchester United and Tottenham to Newcastle and Brighton respectively. Is the title race over? Is Sadio Mane regarded as one of the top three players in the world?</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Michael Calvin is joined by Darren Lewis from the Daily Mirror and Chief football writer at the Independent in Miguel Delaney.</p><br><p>The guys discuss the damage of defeats for Manchester United and Tottenham to Newcastle and Brighton respectively. Is the title race over? Is Sadio Mane regarded as one of the top three players in the world?</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Women's Football Podcast: With no competitive matches for Phil Neville between now and Euro 2021, will this affect England's chances?]]></title>
			<itunes:title><![CDATA[Women's Football Podcast: With no competitive matches for Phil Neville between now and Euro 2021, will this affect England's chances?]]></itunes:title>
			<pubDate>Thu, 03 Oct 2019 05:00:00 GMT</pubDate>
			<itunes:duration>41:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/womensfootballpodcast-withnocompetitivematchesforphilnevillebetweennowandeuro2021-willthisaffectenglandschances-/media.mp3" length="60293318" type="audio/mpeg"/>
			<guid isPermaLink="false">635687ff-c81e-40d0-8338-4ce64176127b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/womensfootballpodcast-withnocompetitivematchesforphilnevillebetweennowandeuro2021-willthisaffectenglandschances-</link>
			<acast:episodeId>635687ff-c81e-40d0-8338-4ce64176127b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>womensfootballpodcast-withnocompetitivematchesforphilnevillebetweennowandeuro2021-willthisaffectenglandschances-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRN8w0F5Khud0sbi1o7/V1jte8uiIho0PdITJdmForDjxc8ekqIUQOU8Z5HZ7bBt+TbxsTqlv+OcRm/iKfAG5VJjXTGJobAPbwYzykQ80laouBITDXwb11TVP+3KZOSMHB6OW6whO+cL8f48vOzWiOBy7OGv7dAJNyrHxaZx0ORNjvuBhE6JCzPRnn9EQwHgetySuWK8Ew7pygJB2LVe7a0so0NaJXGQgoMpBNiPofMLD9dln0CBA2nlJiK7UhjW19GeixWhLz3CMLhS/1F2RJC9n3ck7uu1WlcR+ZPEbj4Zl]]></acast:settings>
			<itunes:subtitle><![CDATA[Brazil head to Middlesbrough's Riverside Stadium on Saturday and a trip to Portugal awaits next Tuesday as England and manager Phil Neville look to get back to winning ways.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57473f947400122e4e4b.png"/>
			<description><![CDATA[Brazil head to Middlesbrough's Riverside Stadium on Saturday and a trip to Portugal awaits next Tuesday as England and manager Phil Neville look to get back to winning ways.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Brazil head to Middlesbrough's Riverside Stadium on Saturday and a trip to Portugal awaits next Tuesday as England and manager Phil Neville look to get back to winning ways.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>The Champions League returns and can Spurs put their troubles behind them with a vital win over Bayern?</title>
			<itunes:title>The Champions League returns and can Spurs put their troubles behind them with a vital win over Bayern?</itunes:title>
			<pubDate>Mon, 30 Sep 2019 16:25:44 GMT</pubDate>
			<itunes:duration>46:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/thechampionsleaguereturnsandcanspursputtheirtroublesbehindthemwithavitalwinoverbayern-/media.mp3" length="67412190" type="audio/mpeg"/>
			<guid isPermaLink="false">d212df19-2aeb-4a59-8021-5ab51963fbf9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/thechampionsleaguereturnsandcanspursputtheirtroublesbehindthemwithavitalwinoverbayern-</link>
			<acast:episodeId>d212df19-2aeb-4a59-8021-5ab51963fbf9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>thechampionsleaguereturnsandcanspursputtheirtroublesbehindthemwithavitalwinoverbayern-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9W2FVppeSphONii7uyJ7ktny/MYdu9cAbtuR7enhiojA9Tg/nFrKX3xomlbRqNhaxMHp23ME+GrZ7SK1FvMvgtOiiseEL7IDwrWwfjJZ+b0b8EsZosE/PWQC/fjOSr1mhFL1TdRqdvHTUtfO9QtNgeU4qPROyaepk8/2beKnkekJ1XNPvs1jNNi6cilSPGRI0vL7Q/AQ7A2KtugUHUk3/g0Ol7TL1CxOXDbII/zI3CKob80/oph/QlGvCrRR1KYSe]]></acast:settings>
			<itunes:subtitle>Michael Calvin is joined this week by debutant on the pod, Andy Dillon from The Sun and regular Adrian Clarke.The guys look ahead to a busy Champions League schedule with all eyes on under-pressure Mauricio Pochettino as Spurs face Bayern.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57473f947400122e4e52.png"/>
			<description><![CDATA[<p>Michael Calvin is joined this week by debutant on the pod, Andy Dillon from The Sun and regular Adrian Clarke.</p><p>The guys look ahead to a busy Champions League schedule with all eyes on under-pressure Mauricio Pochettino as Spurs face Bayern.</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Michael Calvin is joined this week by debutant on the pod, Andy Dillon from The Sun and regular Adrian Clarke.</p><p>The guys look ahead to a busy Champions League schedule with all eyes on under-pressure Mauricio Pochettino as Spurs face Bayern.</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Pochettino, Solskjaer, Silva? Which Premier League manager will be next to go?</title>
			<itunes:title>Pochettino, Solskjaer, Silva? Which Premier League manager will be next to go?</itunes:title>
			<pubDate>Mon, 23 Sep 2019 16:03:28 GMT</pubDate>
			<itunes:duration>48:25</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/pochettino-solskjaer-silva-whichpremierleaguemanagerwillbenexttogo-/media.mp3" length="69626352" type="audio/mpeg"/>
			<guid isPermaLink="false">cb0be3cb-a174-4169-ae71-6ab17a9c3b7a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/pochettino-solskjaer-silva-whichpremierleaguemanagerwillbenexttogo-</link>
			<acast:episodeId>cb0be3cb-a174-4169-ae71-6ab17a9c3b7a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>pochettino-solskjaer-silva-whichpremierleaguemanagerwillbenexttogo-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9ix7G8X1sND9I+lT/HhklydSEjwHMlGpWJ4tfFKbyZqyUv+iwEJrej39n/8+0pjye6lH5e/yjfTc9kPKTVulJlR08Lv74pKbB3pclo04//E07B1zCjs4qX8nrTSGV+U5jYK9dwsEbTvypDx8o8NpSLlFrG2XFM4JNnZw4KeGHIKSOIGCZvZ6gRsHBY08mLXNV58iiBdQa47RjJTNYALXLG4Xvcfob7giiviUQ6N09Uk1hEHsRM8Wk8E/rF5v2nb94]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Tom Hopkinson and Daniel Storey reflect on damaging defeats for Tottenham, Manchester United and Everton and round up the rest of the Premier League action.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Tom Hopkinson and Daniel Storey reflect on damaging defeats for Tottenham, Manchester United and Everton and round up the rest of the Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tom Hopkinson and Daniel Storey reflect on damaging defeats for Tottenham, Manchester United and Everton and round up the rest of the Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will City’s shaky defence cost them the league title?</title>
			<itunes:title>Will City’s shaky defence cost them the league title?</itunes:title>
			<pubDate>Mon, 16 Sep 2019 17:43:51 GMT</pubDate>
			<itunes:duration>49:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willcity-sshakydefencecostthemtheleaguetitle-/media.mp3" length="47812097" type="audio/mpeg"/>
			<guid isPermaLink="false">aeb0f2a2-3cf9-4943-8dfb-3bb23c791977</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willcity-sshakydefencecostthemtheleaguetitle-</link>
			<acast:episodeId>aeb0f2a2-3cf9-4943-8dfb-3bb23c791977</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willcity-sshakydefencecostthemtheleaguetitle-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9zkpJbo5FrJOuOd70FCWePmbTBzT4fDdy0Sn/VEyrY15hnDhV3yoLV92hyZvQtKmK+EJbolJzm/b63bsl0AtEFQK5mMY6vI0c276AtJs0vicL1zpz1wkPMg7r+gGNYE8e5oV52cdzyh84QqDGUiMnKz+UwSY2ukww/OnumwyRKej4QKq9z6rXgDXOOMs09v4MAseC64NvS1FxSugWgGXQCda8Egi215II2XhwpsyCwbnqxQhSiJxrRa3uXI8Hupp6]]></acast:settings>
			<itunes:subtitle>Mike Calvin, John Cross and Seb Stafford-Bloor review Manchester City’s shock defeat at Norwich, Chelsea’s youthful resurgence and look ahead to the return of the Champions League.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Seb Stafford-Bloor review Manchester City’s shock defeat at Norwich, Chelsea’s youthful resurgence and look ahead to the return of the Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Seb Stafford-Bloor review Manchester City’s shock defeat at Norwich, Chelsea’s youthful resurgence and look ahead to the return of the Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>The Premier League returns with a managerial casualty</title>
			<itunes:title>The Premier League returns with a managerial casualty</itunes:title>
			<pubDate>Mon, 09 Sep 2019 15:47:20 GMT</pubDate>
			<itunes:duration>46:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/thepremierleaguereturnswithamanagerialcasualty/media.mp3" length="44739641" type="audio/mpeg"/>
			<guid isPermaLink="false">5dc137d1-ff95-4d62-9481-30d0455639e2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/thepremierleaguereturnswithamanagerialcasualty</link>
			<acast:episodeId>5dc137d1-ff95-4d62-9481-30d0455639e2</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>thepremierleaguereturnswithamanagerialcasualty</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRHGcAa+/2aZNP53tXYN/7ZTl1cbm5LxR6AZvQuI0hAYv9gbOtzEEBW5zk6UHQF2I8GZQz2j2PQO5ylcV30lbs0NlVjJDUevJlZl005ATtFU2aGHBTk0S0H8B/qdMilAAD2Ryn/jdTYhj8CYY3CtXT7XgznmeMZzEigEi3kYxxl/PshPqA1g933cHVPLcPOUyx87xN7Pfb6DGuWOck4fDTngXWnq4o5j+JkECmCNakt2wNslkwl0nysgT1kExs/+prlFEgpK3FzLkQN+Wqurh8vUxWSoVdnmLPK9z0t9w8Fdv]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Tony Evans and Dominic Fifield discuss Javi Gracia’s sacking at Watford, Liverpool's title chances, whether Chelsea are strong enough, Wolves' European&nbsp;commitments&nbsp;and which teams are at risk of relegation.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Tony Evans and Dominic Fifield discuss Javi Gracia’s sacking at Watford, Liverpool's title chances, whether Chelsea are strong enough, Wolves' European&nbsp;commitments&nbsp;and which teams are at risk of relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tony Evans and Dominic Fifield discuss Javi Gracia’s sacking at Watford, Liverpool's title chances, whether Chelsea are strong enough, Wolves' European&nbsp;commitments&nbsp;and which teams are at risk of relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Liverpool & Man City - Head and shoulders apart?]]></title>
			<itunes:title><![CDATA[Liverpool & Man City - Head and shoulders apart?]]></itunes:title>
			<pubDate>Mon, 02 Sep 2019 15:26:44 GMT</pubDate>
			<itunes:duration>46:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/liverpool-mancity-headandshouldersapart-/media.mp3" length="45015278" type="audio/mpeg"/>
			<guid isPermaLink="false">202a90d4-aeb3-454b-92e2-7631c9f63abe</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/liverpool-mancity-headandshouldersapart-</link>
			<acast:episodeId>202a90d4-aeb3-454b-92e2-7631c9f63abe</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>liverpool-mancity-headandshouldersapart-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9bWJULcCufkY7Isyt+7M+9ZymEpp+24KxBRPsXwupq1zpJ7LZrwklQQJW19nlM6ez94PJ3WhBRq3lXcqfyix2tVm0g6kYsrTzj4KRmoyjCmNm4/Y6vWbdIfZ2Z5lQSNOITIs0dlHHHOmN2XUHCYIi0Fhg1wqxcdm+xvjowzDnp4xF0tb3Dit1LvqkHT595NTcXm4TvP4OQ6FdQtQG6S1la+OA+u66yiKznT+8ie4CcSMYNyz+tUlgR+1MnqIoTp2p]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Daniel Storey, and Tony Hodson discuss the gulf between the league leaders and the rest, England's best right-back, and whether English football can avoid another Bury.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Daniel Storey, and Tony Hodson discuss the gulf between the league leaders and the rest, England's best right-back, and whether English football can avoid another Bury.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Daniel Storey, and Tony Hodson discuss the gulf between the league leaders and the rest, England's best right-back, and whether English football can avoid another Bury.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Women's Football Podcast: Is the WSL ready to capitalise on the success of the Women's World Cup?]]></title>
			<itunes:title><![CDATA[Women's Football Podcast: Is the WSL ready to capitalise on the success of the Women's World Cup?]]></itunes:title>
			<pubDate>Thu, 29 Aug 2019 05:00:31 GMT</pubDate>
			<itunes:duration>48:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/womensfootballpodcast-isthewslreadytocapitaliseonthesuccessofthewomensworldcup-/media.mp3" length="46326326" type="audio/mpeg"/>
			<guid isPermaLink="false">043373cb-45ab-4832-8de1-365c38e3f6ad</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/womensfootballpodcast-isthewslreadytocapitaliseonthesuccessofthewomensworldcup-</link>
			<acast:episodeId>043373cb-45ab-4832-8de1-365c38e3f6ad</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>womensfootballpodcast-isthewslreadytocapitaliseonthesuccessofthewomensworldcup-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRIABZxJQDcfCb5IlcxRpKi/FPo2AwXqyrtFA2KbVRrmKIhv+KsgjzoeKQV1S68+XsLFP2LUG52Qb/bvzfI26pCa0hGY6+oEgkoxM/pVguACyZMKPrdpp9ITLS6uqrS/YCmEpnu2Kp4dnC4dY0rRcoRc2/cKGVsOMZK+1y/qTQ10708TlpgxGq65eMQ1maRxbAcVX4klIfh1SMbIn2xUSkPO+4BWj+hHVXyPRgP8Cjz7hm4FJJl+PRG4OmW/OmSq/VPrBuO1lIGIDqB1vrLnvIF1e9uSyqIMZIzUcxBvGEWEL]]></acast:settings>
			<itunes:subtitle><![CDATA[Ahead of the most important season for women's football in living memory, Suzy Wrack, Rachel O'Sullivan and Kieran Theivam join Mike Calvin to consider whether Women's Super League clubs are ready to capitalise on the success of the Wome...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Ahead of the most important season for women's football in living memory, Suzy Wrack, Rachel O'Sullivan and Kieran Theivam join Mike Calvin to consider whether Women's Super League clubs are ready to capitalise on the success of the Women's World Cup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Ahead of the most important season for women's football in living memory, Suzy Wrack, Rachel O'Sullivan and Kieran Theivam join Mike Calvin to consider whether Women's Super League clubs are ready to capitalise on the success of the Women's World Cup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who has the better chance of survival? Lampard or Solskjaer?</title>
			<itunes:title>Who has the better chance of survival? Lampard or Solskjaer?</itunes:title>
			<pubDate>Tue, 27 Aug 2019 15:26:55 GMT</pubDate>
			<itunes:duration>43:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whohasthebetterchanceofsurvival-lampardorsolskjaer-/media.mp3" length="41300225" type="audio/mpeg"/>
			<guid isPermaLink="false">5c294255-38b0-441b-b516-497c12d618a8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whohasthebetterchanceofsurvival-lampardorsolskjaer-</link>
			<acast:episodeId>5c294255-38b0-441b-b516-497c12d618a8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whohasthebetterchanceofsurvival-lampardorsolskjaer-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Cafg7FWYY5noOADvAmKB5KHDkH5xhAuihUHIpVF8VQmLFFC+FSpA4FLloWWU2VfgwNeX2oAxdRvMwsM3uKF1g9IlerCiZYyC8N/3mlCvY6Qd0E4u8ScRy3Qm/yD8DeL8qRlxpN7AVHkdMGHbtE+Y5qLpzGCN6tMakUW7s0L5KXkgFjEZKGWmkIm/jWNk9W3O3hsMaY9nsWhF8Wq7hEWaTx+v8ZNEkD/5c7FOzwhsL7hh7//nPdAsiIzhqSZRIJbC]]></acast:settings>
			<itunes:subtitle>Jonathan Northcroft and Alyson Rudd join Mike Calvin to discuss the future of Chelsea and Manchester United after both teams showed an act of faith by appointing club legends Frank Lampard and Ole Gunnar Solskjaer to take the reins at Stamford Bridge a...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Jonathan Northcroft and Alyson Rudd join Mike Calvin to discuss the future of Chelsea and Manchester United after both teams showed an act of faith by appointing club legends Frank Lampard and Ole Gunnar Solskjaer to take the reins at Stamford Bridge and Old Trafford respectively,&nbsp;despite&nbsp;their little managerial experience.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Jonathan Northcroft and Alyson Rudd join Mike Calvin to discuss the future of Chelsea and Manchester United after both teams showed an act of faith by appointing club legends Frank Lampard and Ole Gunnar Solskjaer to take the reins at Stamford Bridge and Old Trafford respectively,&nbsp;despite&nbsp;their little managerial experience.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Women's Football Podcast: Analysing England's World Cup]]></title>
			<itunes:title><![CDATA[Women's Football Podcast: Analysing England's World Cup]]></itunes:title>
			<pubDate>Thu, 22 Aug 2019 05:00:31 GMT</pubDate>
			<itunes:duration>43:11</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/womensfootballpodcast-analysingenglandsworldcup/media.mp3" length="41362358" type="audio/mpeg"/>
			<guid isPermaLink="false">7969bf28-9457-4d79-b9e7-3a831b5c1e16</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/womensfootballpodcast-analysingenglandsworldcup</link>
			<acast:episodeId>7969bf28-9457-4d79-b9e7-3a831b5c1e16</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>womensfootballpodcast-analysingenglandsworldcup</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9t6zVu90i8XFQejoxkL2HRqwgmF8uvrGdOgM3goezaW0M/eQDwROi3j/2L0KxKZiXowI7Yia+PtvCFWXv21S04tJtGKgSsjQaBwwitA9rL8X8cJGUZk/fl17D+zeTnY4kIRgINQOHJFdrivB6hD6TrBHo+22j4w0mzrgfnL/mh3llByARSRYcTCk62KZUxk2/2gH/KfeRvHEs9dbWv5iIDFvKlsMLDDr3kHVpHYEKXYjsP/TLBbXj6M+WBvpM/grn]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Anne-Marie Batson, Molly Hudson and Rich Laverty debate whether England's World Cup performance should be considered a success or missed opportunity and discuss the evolution under Phil Neville.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Anne-Marie Batson, Molly Hudson and Rich Laverty debate whether England's World Cup performance should be considered a success or missed opportunity and discuss the evolution under Phil Neville.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Anne-Marie Batson, Molly Hudson and Rich Laverty debate whether England's World Cup performance should be considered a success or missed opportunity and discuss the evolution under Phil Neville.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is VAR destructive to the Premier League?</title>
			<itunes:title>Is VAR destructive to the Premier League?</itunes:title>
			<pubDate>Mon, 19 Aug 2019 14:49:54 GMT</pubDate>
			<itunes:duration>48:51</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isvardestructivetothepremierleague-/media.mp3" length="46794200" type="audio/mpeg"/>
			<guid isPermaLink="false">aceef78c-2f10-41f5-b5ea-febeb797a449</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isvardestructivetothepremierleague-</link>
			<acast:episodeId>aceef78c-2f10-41f5-b5ea-febeb797a449</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isvardestructivetothepremierleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBPxj/pQCS4Vg4GznYpbGq2fl24iODU2UfmRYRLbh7G3topYJO/TxDs59ssLUpLxrMeegPHmIsMqUXH6xlQYjlMzyaScnf0ORnrSd+eW14aKppCy9xoMLhVeYR1c9BZu1WSCIF4pvRWwC/TD88pbav8KkeC+x69YOXpetZzjJ/TDxSKSAsl9ALfd++SclFvF2pWfmvu8jgF3j7hrFKr5KRgpC46jn1qzvFhc3rx8pVGFgL3XJM3XjS9OI6eFDEUFTk8tsNBuX7JNCFwCETKVEp+a2V3V0QHT1hhaI8N5FoB8]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Dave Kidd and Seb Stafford-Bloor round up the second weekend of the Premier League season as Manchester City controversially drop points at home to Spurs as Liverpool go top.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dave Kidd and Seb Stafford-Bloor round up the second weekend of the Premier League season as Manchester City controversially drop points at home to Spurs as Liverpool go top.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dave Kidd and Seb Stafford-Bloor round up the second weekend of the Premier League season as Manchester City controversially drop points at home to Spurs as Liverpool go top.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Man Utd stop the two-horse race?</title>
			<itunes:title>Can Man Utd stop the two-horse race?</itunes:title>
			<pubDate>Mon, 12 Aug 2019 15:43:07 GMT</pubDate>
			<itunes:duration>49:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canmanutdstopthetwo-horserace-/media.mp3" length="46995611" type="audio/mpeg"/>
			<guid isPermaLink="false">da7c8a6a-cd86-4681-ad3a-55aba7897be2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canmanutdstopthetwo-horserace-</link>
			<acast:episodeId>da7c8a6a-cd86-4681-ad3a-55aba7897be2</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canmanutdstopthetwo-horserace-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9XGfj1uogJy3he/NltPZ02g2m4zif4HEUeNcVDVnzPJPXcBlfAyXO7F32GSwHdXU1ByLVofP0xzCVIC16aUp2KWtvw6AJ5ipHQCDpOi87xdGyyXe31PJVQxSxRzgx2ZEwcN0RXZtB1TekgRwkyE+JzqKPKulbL6kjyoFs9LgWOtUSCh7UFm1IaiDxRyM6LN1Sbdyt3qxTKIjo5MoQlVEE5vg9a9jEANnu6Sbxn2KYU/IFEpJ8HhDYW+i853AKC3bL]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Darren Lewis and Dominic Fifield to discuss the opening weekend of the Premier League season. Man City and Liverpool began with dominant displays but did Tottenham and Manchester United show enough to reel them in? Should Chels...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Darren Lewis and Dominic Fifield to discuss the opening weekend of the Premier League season. Man City and Liverpool began with dominant displays but did Tottenham and Manchester United show enough to reel them in? Should Chelsea fans expect more tough results and how did the newly promoted sides do?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Darren Lewis and Dominic Fifield to discuss the opening weekend of the Premier League season. Man City and Liverpool began with dominant displays but did Tottenham and Manchester United show enough to reel them in? Should Chelsea fans expect more tough results and how did the newly promoted sides do?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Premier League 19/20 Preview: Every team analysed</title>
			<itunes:title>Premier League 19/20 Preview: Every team analysed</itunes:title>
			<pubDate>Mon, 05 Aug 2019 15:48:44 GMT</pubDate>
			<itunes:duration>1:01:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/premierleague19-20preview-everyteamanalysed/media.mp3" length="59096534" type="audio/mpeg"/>
			<guid isPermaLink="false">b641be96-64d0-47c4-84ba-ac3386c7368e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/premierleague19-20preview-everyteamanalysed</link>
			<acast:episodeId>b641be96-64d0-47c4-84ba-ac3386c7368e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>premierleague19-20preview-everyteamanalysed</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREWeTdXBhBVVeHhRR7epaVbx1VccWqKdLl7WLzegF6/uXZrfyo7n1VU0dNpHdhhWNybqHnbxtJm17Z7Trq9iAFi5+RJPVnkADdKd3bFxKyNfb5c48WbJ7l6LsY1Of7j6URz0lStX5v0Ii43NCbe2ooSpkPvDkFU/1W7JWH9w5+XKDsTfHJ8WDWNhtzZEUw6bRNpi4czdYhbOWROskEAwKCH/e1vPDBOvkrV6M/dWG9eKMVzVFAebuxRWRrKyxZ31QbfticEoaxu2xTtW7kp9JIoWDUv+d1GR/I9GyYk6Ma4i]]></acast:settings>
			<itunes:subtitle>Mike Calvin, John Cross and Miguel Delaney dissect every single Premier League team in detail ahead of the new season and give their predictions for relegation, top four and surprise package.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Miguel Delaney dissect every single Premier League team in detail ahead of the new season and give their predictions for relegation, top four and surprise package.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Miguel Delaney dissect every single Premier League team in detail ahead of the new season and give their predictions for relegation, top four and surprise package.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Which clubs look best placed for Premier League success?</title>
			<itunes:title>Which clubs look best placed for Premier League success?</itunes:title>
			<pubDate>Mon, 29 Jul 2019 16:43:50 GMT</pubDate>
			<itunes:duration>48:18</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whichclubslookbestplacedforpremierleaguesuccess-/media.mp3" length="46272116" type="audio/mpeg"/>
			<guid isPermaLink="false">9cde2ee2-e923-47c4-a698-1bb65c34bd53</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whichclubslookbestplacedforpremierleaguesuccess-</link>
			<acast:episodeId>9cde2ee2-e923-47c4-a698-1bb65c34bd53</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whichclubslookbestplacedforpremierleaguesuccess-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFHfT9HLqRsxZiu0bAOKeRPd5WyAp623fYNACwyzoYJwAPZmOeFO5FuOMJ1beha0ZRUbAtIez1KV6LFvLp/7wTpN8ix8EP1SJFGv5sSycdnlWK93GPDGjKAk4QivBZbJIYB5fGKwmpJgoGvMC8oGIafxnBDK/TSnPdfkw2wVRlh26OzlUJIXDqMm9kNGT9iw4ACrbBuXvrhlV6RY6KIOKtqzZlloBpvPFhpU+ccf8izOOZzKDJ1gR2PTPqzr1DHf7mutGgQY/8Ua/hmwtvZzq/ZAp5S8aI3AbMI1ZLAWYgK1]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and Tom Hopkinson dissect the latest pre-season news and transfer stories and give their verdict on the newly-promoted clubs.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Tom Hopkinson dissect the latest pre-season news and transfer stories and give their verdict on the newly-promoted clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Tom Hopkinson dissect the latest pre-season news and transfer stories and give their verdict on the newly-promoted clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Newcastle and Arsenal in disarray as new season beckons</title>
			<itunes:title>Newcastle and Arsenal in disarray as new season beckons</itunes:title>
			<pubDate>Mon, 15 Jul 2019 17:02:42 GMT</pubDate>
			<itunes:duration>46:01</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/newcastleandarsenalindisarrayasnewseasonbeckons/media.mp3" length="44082449" type="audio/mpeg"/>
			<guid isPermaLink="false">3fc668a9-2713-4af6-ad6b-6efa5faeddcc</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/newcastleandarsenalindisarrayasnewseasonbeckons</link>
			<acast:episodeId>3fc668a9-2713-4af6-ad6b-6efa5faeddcc</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>newcastleandarsenalindisarrayasnewseasonbeckons</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRHZ8uRCsB0r9rIO9QJC/hjzg0cT9NtIarrWzhvPb/OtOK0NRIV9nlG1FwT88LGyAqSAigfmDurmPQREHoeODNDdHToKcZWZRRpc/Se6LkPSWGqzD6m39b0HZ+QmynEpHnHv7qrpRz0N/NcEFUieC2cAb/I37IHraHeB8mfwZlbTr/egSx5kUlFDt+gYr1Ad99rCuh6uqxBq5hss8zhqCBM7dYnAgu52KBiLxpy38/y9twfiLL8JCuKJPZzi527DgdptLAXqiantuvoEM+nxVLsG33mfarhVKfyVa0xK9lw4+]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Daniel Storey and Seb Stafford-Bloor discuss the incompetent management at Newcastle United and Arsenal and reflect on all the Premier League transfer activity and latest rumours.&nbsp;]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Daniel Storey and Seb Stafford-Bloor discuss the incompetent management at Newcastle United and Arsenal and reflect on all the Premier League transfer activity and latest rumours.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Daniel Storey and Seb Stafford-Bloor discuss the incompetent management at Newcastle United and Arsenal and reflect on all the Premier League transfer activity and latest rumours.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[How does women's football build on World Cup success?]]></title>
			<itunes:title><![CDATA[How does women's football build on World Cup success?]]></itunes:title>
			<pubDate>Mon, 08 Jul 2019 17:18:08 GMT</pubDate>
			<itunes:duration>1:04:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/howdoeswomensfootballbuildonworldcupsuccess-/media.mp3" length="0" type="audio/mpeg"/>
			<guid isPermaLink="false">8e508b8e-2e97-4af6-b631-f810380c0aae</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/howdoeswomensfootballbuildonworldcupsuccess-</link>
			<acast:episodeId>8e508b8e-2e97-4af6-b631-f810380c0aae</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>howdoeswomensfootballbuildonworldcupsuccess-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRCKWNSd1Apz5nI+djmNcQSpBmVom1nGylCkpF2p5QsodOTWvsofoWtUfvfjApMBz8m2mv+xJXXoFu/v7x8r9S0lK6mwOJn2Y966lGeTchTGn8YVyUmkFAYKXjFakkuStI6J8/PC5bPqVFCIhcYajO9j8NpgTSp8myiJNzN5NezE4RYbslJX2kabKCNxoAmE2nzo+QUbXhzPP2lTAoaQge42zp/VD/3ZdJX6BcornTBs83wpyKOLu9F80Q0s4jWwiTDbR4a69xqTe0NBRnAXIq1GYiyZiFKR6sH1Sr9CEb8Y6]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jonathan Northcroft, Rich Laverty and John Cross run the rule over England's World Cup campaign and discuss how the Lionesses can continue their success into the upcoming WSL season. They also examine the goings on at Manchester Unite...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft, Rich Laverty and John Cross run the rule over England's World Cup campaign and discuss how the Lionesses can continue their success into the upcoming WSL season. They also examine the goings on at Manchester United, Chelsea and Leicester and discuss their hopes for the new Premier League campaign.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft, Rich Laverty and John Cross run the rule over England's World Cup campaign and discuss how the Lionesses can continue their success into the upcoming WSL season. They also examine the goings on at Manchester United, Chelsea and Leicester and discuss their hopes for the new Premier League campaign.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Mixed Results for England and Listener Mailbag</title>
			<itunes:title>Mixed Results for England and Listener Mailbag</itunes:title>
			<pubDate>Mon, 10 Jun 2019 16:44:35 GMT</pubDate>
			<itunes:duration>44:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mixedresultsforenglandandlistenermailbag/media.mp3" length="42499934" type="audio/mpeg"/>
			<guid isPermaLink="false">b2d4654c-5759-4f5b-a1d8-af431c4bc166</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mixedresultsforenglandandlistenermailbag</link>
			<acast:episodeId>b2d4654c-5759-4f5b-a1d8-af431c4bc166</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mixedresultsforenglandandlistenermailbag</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9T5Iq+9X6MEc6ZcV+V1jTx1hyNZ54GlMvclfTl2xZGXz0fnjBD2nDiGeqffcjrIPdyUfwGYDQuZYITdvyUnWZqqej9mGFzXvIW0MjHHZ3APKPr/OM36KYhvtiLqLS2D/KSlbvIRmHhFEfHWa/WbvQ7a/ecjtDPpso3F7yjkW4UzEt28hB7XRhRlHwqoHzCJlqDl1Ch2d61EBp1LLQz6qWUdlfeJ2+duriLEKv7zS0DXUdLt1kduTQgQXexyZ4JqFb]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Tony Evans, and Tom Hopkinson evaluate the performances of England at both the Nations League and the Women's World Cup before answering your questions ahead of a busy summer.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Tony Evans, and Tom Hopkinson evaluate the performances of England at both the Nations League and the Women's World Cup before answering your questions ahead of a busy summer.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tony Evans, and Tom Hopkinson evaluate the performances of England at both the Nations League and the Women's World Cup before answering your questions ahead of a busy summer.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can England do it in France? A Women’s World Cup preview special</title>
			<itunes:title>Can England do it in France? A Women’s World Cup preview special</itunes:title>
			<pubDate>Thu, 06 Jun 2019 05:00:12 GMT</pubDate>
			<itunes:duration>40:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canenglanddoitinfrance-awomen-sworldcuppreviewspecial/media.mp3" length="38740262" type="audio/mpeg"/>
			<guid isPermaLink="false">50dd2ea3-344d-4724-a9ce-5c184927654f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canenglanddoitinfrance-awomen-sworldcuppreviewspecial</link>
			<acast:episodeId>50dd2ea3-344d-4724-a9ce-5c184927654f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canenglanddoitinfrance-awomen-sworldcuppreviewspecial</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBcJw7Os1/qJPwRpZkcEiwFa5p/ZXbZ9LGnDTEi+SeZxlvTZ8mA6KwtVLbx+6Z7H1HydZ03ArXI8C3+ExpTvWSOvqjD4Jvc9ei+KioCF9oH/i5jz0uB2uK9EdCM7g3qiyl3WC45tpopnE3thVKI6FQ+PYajL2nEhpvlBkus5ROJK0qXXl6avWHlkMuVoEwHiNoRadGq2UfpYcQOzjsQEiMuhzMsDgzp1c7BiqX5VdEnWyHfD+U65eCbNCm4y6hln88wSxLpC75aRWSJebvDm6kHqGCQnNzDiJiO5lPf8fwGu]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Ann Marie Batson, Glenn Moore, and Rich Laverty as the Football Writers’ Podcast looks ahead to the 2019 Women’s World Cup which begins on Friday. The group assess England’s chances in France ahead of their opening game against...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Ann Marie Batson, Glenn Moore, and Rich Laverty as the Football Writers’ Podcast looks ahead to the 2019 Women’s World Cup which begins on Friday. The group assess England’s chances in France ahead of their opening game against Scotland. Standing in England’s way are a raft of challengers including France, Spain, Japan and USA and the group discuss who may be lifting the trophy come July.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Ann Marie Batson, Glenn Moore, and Rich Laverty as the Football Writers’ Podcast looks ahead to the 2019 Women’s World Cup which begins on Friday. The group assess England’s chances in France ahead of their opening game against Scotland. Standing in England’s way are a raft of challengers including France, Spain, Japan and USA and the group discuss who may be lifting the trophy come July.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Klopp build a dynasty and can England bring Nations League glory home?</title>
			<itunes:title>Can Klopp build a dynasty and can England bring Nations League glory home?</itunes:title>
			<pubDate>Mon, 03 Jun 2019 16:16:07 GMT</pubDate>
			<itunes:duration>40:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/cankloppbuildadynastyandcanenglandbringnationsleaguegloryhome-/media.mp3" length="39070526" type="audio/mpeg"/>
			<guid isPermaLink="false">b80f16eb-63a2-47a7-baa0-2372f2a6d584</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/cankloppbuildadynastyandcanenglandbringnationsleaguegloryhome-</link>
			<acast:episodeId>b80f16eb-63a2-47a7-baa0-2372f2a6d584</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>cankloppbuildadynastyandcanenglandbringnationsleaguegloryhome-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRNjW0FEiDTFB/3YWTtUnRo8VwC7i/g2uIfGAeN/YkCni3yJWKQP1FK9jVpluGQj6i/SSR8+K/VniBvbAOT7h3pkW71zN/RexR+N6wueEQ6f+Gc9FFo4uykzeOcSrussHT33nNebV4qV/5WeS8dXQ1rFPzoaIvJdNZmAHykFRHmTxIgzX8FIrTaeS+aNTON3uPkVur/eOaX408nn/JoywXCnH3VHfggw7t0Oax7oto1xzaSUPkM38YShnUpy72Mt2wmHeid3h/73U6P6j9MJPGTK6UzzGSeKmkWPibhtWZI5c]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke, and Seb Stafford-Bloor discuss the fall-out from the Champions League final and ask if Liverpool can build on a sixth European Cup triumph. The trio also debates England's chances in the Nations League finals and look a...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke, and Seb Stafford-Bloor discuss the fall-out from the Champions League final and ask if Liverpool can build on a sixth European Cup triumph. The trio also debates England's chances in the Nations League finals and look ahead to a big summer for Chelsea, Arsenal and Spurs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke, and Seb Stafford-Bloor discuss the fall-out from the Champions League final and ask if Liverpool can build on a sixth European Cup triumph. The trio also debates England's chances in the Nations League finals and look ahead to a big summer for Chelsea, Arsenal and Spurs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Premier League Domination? A look ahead to European finals</title>
			<itunes:title>Premier League Domination? A look ahead to European finals</itunes:title>
			<pubDate>Tue, 28 May 2019 16:57:17 GMT</pubDate>
			<itunes:duration>40:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/europeandomination-alookaheadtoeuropeanfinals/media.mp3" length="58579956" type="audio/mpeg"/>
			<guid isPermaLink="false">27f64bce-0f38-42c0-bedb-e98c79424616</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/europeandomination-alookaheadtoeuropeanfinals</link>
			<acast:episodeId>27f64bce-0f38-42c0-bedb-e98c79424616</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>europeandomination-alookaheadtoeuropeanfinals</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9MTRK6Zp7XLpCaIXaAmu2k9DO8WIjI3S2ssTqR0xkurWYZ6bpMQQaQmy0U9jSeIjIomvDsfoL9a0vxCOojKc/kGixlKY2aY5EJmfhQett2YxrKlYhGA9Jk/WztjBAi1LezGuKF40XbvknR409E7zLQDybNauYpiwYDfKg1hWRC6PAR8n59WiLGzZPnGFyy/JYVPWNhTodeZywDo1yYL0sV3gRXmhSUUpACWVSKf0QiEkfVuRJ6q0gfTjsI4r4SxCd]]></acast:settings>
			<itunes:subtitle>Is this the start of Premier League domination of Europe? Jonathan Northcroft and Daniel Storey join Mike Calvin to discuss this week’s finals.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Is this the start of Premier League domination of Europe? Jonathan Northcroft and Daniel Storey join Mike Calvin to discuss this week’s finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Is this the start of Premier League domination of Europe? Jonathan Northcroft and Daniel Storey join Mike Calvin to discuss this week’s finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>End of season awards</title>
			<itunes:title>End of season awards</itunes:title>
			<pubDate>Mon, 20 May 2019 15:57:33 GMT</pubDate>
			<itunes:duration>46:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/endofseasonawards/media.mp3" length="66160816" type="audio/mpeg"/>
			<guid isPermaLink="false">84137d7e-8ae7-4f83-9def-d3bc8b0c4b17</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/endofseasonawards</link>
			<acast:episodeId>84137d7e-8ae7-4f83-9def-d3bc8b0c4b17</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>endofseasonawards</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRAd3xD5kP6EEnIbUYIKjGPDI0SvdAo7iXP+IgPQooFPn+yy2mao7kjWAx/L7mHoqp2vIvVc56gDBlrMuWQwzVPWRdTcopz3wwXFPoBOGzJUVOWXd8Q9FjloCnpSop8EBh/aLiSHW8cKdqgFfCmjvTS+K5uhytku7vJGGxq7FtC0JqNy42rnpc/3bXQYqCHhVBHIjV/+FZ+pUOU2m5tbW5P5H5wUTzV64/c7+mrt/MnV2J9Ubx+oZKe0grYwCwvU3FB/Fw5NjlXh3fO5YpQDFaFWT1zbOdl00EGxmw+m/fFUK]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Dave Kidd and Tom Hopkinson to wrap up the domestic season, including Manchester City's emphatic FA Cup final win over Watford.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Dave Kidd and Tom Hopkinson to wrap up the domestic season, including Manchester City's emphatic FA Cup final win over Watford.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Dave Kidd and Tom Hopkinson to wrap up the domestic season, including Manchester City's emphatic FA Cup final win over Watford.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Is Pep Guardiola Manchester City's answer to Sir Alex?]]></title>
			<itunes:title><![CDATA[Is Pep Guardiola Manchester City's answer to Sir Alex?]]></itunes:title>
			<pubDate>Mon, 13 May 2019 16:54:56 GMT</pubDate>
			<itunes:duration>47:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/ispepguardiolamanchestercitysanswertosiralex-/media.mp3" length="68847608" type="audio/mpeg"/>
			<guid isPermaLink="false">bf5c6dee-1b53-4c60-9272-781861675c42</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/ispepguardiolamanchestercitysanswertosiralex-</link>
			<acast:episodeId>bf5c6dee-1b53-4c60-9272-781861675c42</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>ispepguardiolamanchestercitysanswertosiralex-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRGlwss6NLWS59SQyPt9jBpz615zGdscqEGfUdPlHEIg7Ouj9KFeodhFSzbv46nFGad8n1fxdq/qh0284hy3G/Dt3IdIkyL8VrNf3jLxlG2+c47FiDWMt4JSmIOSHa9uX/2CvhamzdEkiqbXreXG7LAFT784hb0VfzobcJLfg27GIRsleVvtGn0aI4czuYJtNpVGPiCQY3h33kKtarTeo298+orKE7779stPZg7pa/7grMK47BMCtiN3yI+6TzYJ+Lm63J5fnAGy4zvcQ4NXMTZoBTtp7oAo0wyzFS7WFEvQM]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Dom Fifield and John Cross to review the 2018/19 Premier League season and look ahead to the Emirates FA Cup final.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Dom Fifield and John Cross to review the 2018/19 Premier League season and look ahead to the Emirates FA Cup final.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Dom Fifield and John Cross to review the 2018/19 Premier League season and look ahead to the Emirates FA Cup final.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>English teams light up Europe ahead of title race deciders</title>
			<itunes:title>English teams light up Europe ahead of title race deciders</itunes:title>
			<pubDate>Fri, 10 May 2019 14:31:22 GMT</pubDate>
			<itunes:duration>44:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/englishteamslightupeuropeaheadoftitleracedeciders/media.mp3" length="64699106" type="audio/mpeg"/>
			<guid isPermaLink="false">3b620896-6dcf-4096-a283-d5c8a7a1e532</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/englishteamslightupeuropeaheadoftitleracedeciders</link>
			<acast:episodeId>3b620896-6dcf-4096-a283-d5c8a7a1e532</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>englishteamslightupeuropeaheadoftitleracedeciders</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRC0qnxRIdl4fm4OEl/y+JcXOO3nZS5V2utqw3y/8cn/j667LFK5qZT/aSuS6s1d2T1pqPiRrr8yRd1teAcIPPowbNtNYaDa76vZ2Wtu9bYS76NYLTzyquyKTPDAZnDxJ7iJIY5DnUGHv+vdNxKXDuV2D76qlqARU508d69JSDnHv2QFB3rDFQgJuwCY/M8fc1p+OFMnw7c+RCvGMYBl/65WCcoMoYXLoioRCTQow4Yh5MiMRuCL+t4YMGPaJfPBrcp7PfeuYyC3NLkid4DTaj+ziM6rY7rQfiM1OFbuSW0Ke]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Daniel Storey and Seb Stafford-Bloor reflect on the incredible Champions League semi-final turnarounds by Liverpool and Spurs and preview the final day of the Premier League title race.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Daniel Storey and Seb Stafford-Bloor reflect on the incredible Champions League semi-final turnarounds by Liverpool and Spurs and preview the final day of the Premier League title race.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Daniel Storey and Seb Stafford-Bloor reflect on the incredible Champions League semi-final turnarounds by Liverpool and Spurs and preview the final day of the Premier League title race.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>A huge week ahead</title>
			<itunes:title>A huge week ahead</itunes:title>
			<pubDate>Mon, 06 May 2019 16:52:21 GMT</pubDate>
			<itunes:duration>49:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/ahugeweekahead/media.mp3" length="71585732" type="audio/mpeg"/>
			<guid isPermaLink="false">ce8af48e-ae13-4ec6-b83b-0e0c2ab4c52b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/ahugeweekahead</link>
			<acast:episodeId>ce8af48e-ae13-4ec6-b83b-0e0c2ab4c52b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>ahugeweekahead</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRGYVnc29Drvo75vqKoDFoGUQfbEHMGuI9Ppf++5kaTS4YLZI2oxLNstHQXeE1V3CYAL54STjFOMYWAAM3eamsEGKuClA6iU3KEPrMpqUdJj/M2X6xwfDHJpRr0r40+p36GZil/JJmxM5OqLkogDZA2PRpkRgKhQUMYxPTycMbrRxkaRsp/EDR8iZYawYDe0gpnF69g2Cv+uXaCcTv20O8mVUG+S3nb4jUGFnwSdK5rC8PGNBLG1mTqluepi2C7Y60NHVjvT3Q2dKYe3sFLIMAoTyPcicM6JGAXV6rjMoEbI9]]></acast:settings>
			<itunes:subtitle>John Cross and Tony Evans join Mike Calvin to preview the four European semi final second legs.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[John Cross and Tony Evans join Mike Calvin to preview the four European semi final second legs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[John Cross and Tony Evans join Mike Calvin to preview the four European semi final second legs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Women's Football Podcast: Can West Ham, a team created in six weeks, deny Manchester City the FA Cup?]]></title>
			<itunes:title><![CDATA[Women's Football Podcast: Can West Ham, a team created in six weeks, deny Manchester City the FA Cup?]]></itunes:title>
			<pubDate>Thu, 02 May 2019 05:00:00 GMT</pubDate>
			<itunes:duration>44:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/womensfootballpodcast-canwestham-ateamcreatedinsixweeks-denymanchestercitythefacup-/media.mp3" length="63795788" type="audio/mpeg"/>
			<guid isPermaLink="false">4e490028-b414-49f2-b710-f5d99979c61f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/womensfootballpodcast-canwestham-ateamcreatedinsixweeks-denymanchestercitythefacup-</link>
			<acast:episodeId>4e490028-b414-49f2-b710-f5d99979c61f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>womensfootballpodcast-canwestham-ateamcreatedinsixweeks-denymanchestercitythefacup-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRNS29qAbr4nHxNeX70NcEwbJN79w1pWOwmANyvVmLiQJtz2BZ0anQtWiTqns7ijVejaVmDclNxpa5KW6E6wBjewUNUEUNvpfUr18MyWdrtAdNeAkWm7wPvgDxaGXwa/of5UKYWFAY6i33SKlIlbam6Wf2MmdBInq9ndC1aOzo1abepGpvE11sagUeN5RJeu6GvdAl2jPtZPQt0qzb2ShADZh8pO/6hMwoxyspssiPgb9ns7fC+4Hz7Icp+nBOLFyBe30OGwn3g0xcGvzYGDLwBEo5zWv0Vjbd96eH2+VKZQU]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Suzy Wrack, Katie&nbsp;Whyatt and Rich Laverty.&nbsp;]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Suzy Wrack, Katie&nbsp;Whyatt and Rich Laverty.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Suzy Wrack, Katie&nbsp;Whyatt and Rich Laverty.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Liverpool and Spurs grab first leg advantage?</title>
			<itunes:title>Can Liverpool and Spurs grab first leg advantage?</itunes:title>
			<pubDate>Mon, 29 Apr 2019 17:23:59 GMT</pubDate>
			<itunes:duration>49:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canliverpoolandspursgrabfirstlegadvantage-/media.mp3" length="70643602" type="audio/mpeg"/>
			<guid isPermaLink="false">06448aad-60f9-445f-b6a3-c64fa75dc73d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canliverpoolandspursgrabfirstlegadvantage-</link>
			<acast:episodeId>06448aad-60f9-445f-b6a3-c64fa75dc73d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canliverpoolandspursgrabfirstlegadvantage-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/J5aezIGfvNf36eRIX7uKPRJ5hUrItTBobRTK1aMRxPUs0ESD4pVaJQJKKMpTeixG6Ftq3AkX51hLaaH6NJaR4WRqdmBSBW8Hmg+I6xRxAvHL4ud/080BfK0ptnrsQ46pG4FxZvC/FYiV7Bwk8TMAvTw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Jonathan Northcroft and Darren Lewis to preview Liverpool and Tottenham's UEFA Champions League semi-finals against Barcelona and Ajax.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Jonathan Northcroft and Darren Lewis to preview Liverpool and Tottenham's UEFA Champions League semi-finals against Barcelona and Ajax.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Jonathan Northcroft and Darren Lewis to preview Liverpool and Tottenham's UEFA Champions League semi-finals against Barcelona and Ajax.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Man United deny City the Premier League title?</title>
			<itunes:title>Will Man United deny City the Premier League title?</itunes:title>
			<pubDate>Tue, 23 Apr 2019 16:42:04 GMT</pubDate>
			<itunes:duration>47:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willmanuniteddenycitythepremierleaguetitle-/media.mp3" length="67902974" type="audio/mpeg"/>
			<guid isPermaLink="false">f3272924-abb7-4595-886b-d1eb5c27a04b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willmanuniteddenycitythepremierleaguetitle-</link>
			<acast:episodeId>f3272924-abb7-4595-886b-d1eb5c27a04b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willmanuniteddenycitythepremierleaguetitle-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRAHKkv+fdwHMKqNNHnHyguBVV56bPiANyGK8HNGfnkhGcdSgHxogOhysP/O0ao7QWkCjq9sIie5WwF/pNRssSrE2hda5PDkUJuibkrWtpHSWOSCxWonl0o7G+CjdCYyFlUkwpxPP7ecNN1S84IbaVY51LK6jKRkVSDllab343U6tqf4hmeBRZEHhVYkesZUyGdhtUBESigrB37Sh6t804EmRbvO6LlU6ezk7XrbanxV5pI/mted3G4aOGg8FeKfDIx1uevI+AiCaXibfG3Our9X1YFsH4WyqRze75MtHt5oP]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Daniel Storey and Seb Stafford-Bloor discuss Manchester United's sharp decline in form ahead of the potentially title-deciding Manchester derby and the race for the top four.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Daniel Storey and Seb Stafford-Bloor discuss Manchester United's sharp decline in form ahead of the potentially title-deciding Manchester derby and the race for the top four.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Daniel Storey and Seb Stafford-Bloor discuss Manchester United's sharp decline in form ahead of the potentially title-deciding Manchester derby and the race for the top four.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will three English teams advance to Champions League semis?</title>
			<itunes:title>Will three English teams advance to Champions League semis?</itunes:title>
			<pubDate>Mon, 15 Apr 2019 16:39:03 GMT</pubDate>
			<itunes:duration>47:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willthreeenglishteamsadvancetochampionsleaguesemis-/media.mp3" length="68056970" type="audio/mpeg"/>
			<guid isPermaLink="false">de5a562a-7c84-49e7-8163-0e7df8ae5e93</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willthreeenglishteamsadvancetochampionsleaguesemis-</link>
			<acast:episodeId>de5a562a-7c84-49e7-8163-0e7df8ae5e93</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willthreeenglishteamsadvancetochampionsleaguesemis-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRF2TWnZxezuj/GW1kgdgoy7k3jOfXjkksHqRlcE5YlSnrDiMU4VsyoZa7cSVWvQI8il8vQAchVdLvpPSFKp/RekoD2ZiP56BY/JXPYATdyyXgMvG+gxicg6MVJspqqW9hluE0UxzoWfi/goeKWX4O5tEzcQj+uTTLBSzVFjYFO5D8BfGleDY81E09VH9zIKxx6wRqsc8w0D/jiJdxuNorNvxRZTbJTRzfjWS9ZSYdy/rr9roJT51phzxGVEJGnRwr/J6C/l5pUjstS/BMM7+NYhVAe+8Xn1EEVyq3ESR66fu]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Adrian Clarke and Dave Kidd to preview the second legs of the UEFA Champions League quarter-finals, exclusively live on BT Sport.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Adrian Clarke and Dave Kidd to preview the second legs of the UEFA Champions League quarter-finals, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Adrian Clarke and Dave Kidd to preview the second legs of the UEFA Champions League quarter-finals, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Champions League quarter-final preview</title>
			<itunes:title>Champions League quarter-final preview</itunes:title>
			<pubDate>Mon, 08 Apr 2019 16:58:29 GMT</pubDate>
			<itunes:duration>48:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/championsleaguequarter-finalpreview/media.mp3" length="69685822" type="audio/mpeg"/>
			<guid isPermaLink="false">fecca206-1a11-4fb3-ac6c-8a176b82f5ac</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/championsleaguequarter-finalpreview</link>
			<acast:episodeId>fecca206-1a11-4fb3-ac6c-8a176b82f5ac</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>championsleaguequarter-finalpreview</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/J5aezIGfvNf36eRIX7uKPRJ5hUrItTBobRTK1aMRxPUs0ESD4pVaJQJKKMpTeixG6Ftq3AkX51hLaaH6NJaR4WRqdmBSBW8Hmg+I6xRxAvHL4ud/080BfK0ptnrsQ46pGh5RiH7d5HRG28qeDHOxCMA==]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and Dom Fifield look ahead to Tottenham v Man City, Man United v Barcelona and Liverpool v Porto, all live on BT Sport.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Dom Fifield look ahead to Tottenham v Man City, Man United v Barcelona and Liverpool v Porto, all live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Dom Fifield look ahead to Tottenham v Man City, Man United v Barcelona and Liverpool v Porto, all live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Blues boo Sarri as Liverpool leave it late to dent Spurs’ top-four hopes</title>
			<itunes:title>Blues boo Sarri as Liverpool leave it late to dent Spurs’ top-four hopes</itunes:title>
			<pubDate>Mon, 01 Apr 2019 17:25:49 GMT</pubDate>
			<itunes:duration>52:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/bluesboosarriasliverpoolleaveitlatetodentspurs-top-fourhopes/media.mp3" length="74787722" type="audio/mpeg"/>
			<guid isPermaLink="false">01dba25d-a8b7-4d23-818c-e2534f48d53e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/bluesboosarriasliverpoolleaveitlatetodentspurs-top-fourhopes</link>
			<acast:episodeId>01dba25d-a8b7-4d23-818c-e2534f48d53e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>bluesboosarriasliverpoolleaveitlatetodentspurs-top-fourhopes</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz95s2U9r8oiyiDybB3sfUJp6vBNt+HLgBnuNhNp0nSyVCmF1SR2L7INj6Mft1IcGUNZ88fgovRRs8YDawe3N/ddECQjADvw2T2Fjr0zd55j4e44sSg1FY/VFklsk8lwuS3Zm/iq+tQ5G7nT3OyNdfJ08lUfHQG79EP1L3aDUEC57bZFvKDi9kuF5do1yXAdZWCyuV66w5oXgYyiGcf7x2+E6P80zjknE4IRHdzuO1JXRDF04glfy1DTLHJT2b78UF8]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Alyson Rudd and John Cross dissect another blockbuster Premier League weekend and look ahead to the FA Cup semi-finals.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Alyson Rudd and John Cross dissect another blockbuster Premier League weekend and look ahead to the FA Cup semi-finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Alyson Rudd and John Cross dissect another blockbuster Premier League weekend and look ahead to the FA Cup semi-finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>How will Tottenham’s new stadium affect their season?</title>
			<itunes:title>How will Tottenham’s new stadium affect their season?</itunes:title>
			<pubDate>Mon, 25 Mar 2019 17:59:17 GMT</pubDate>
			<itunes:duration>48:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/howwilltottenham-snewstadiumaffecttheirseason-/media.mp3" length="69323994" type="audio/mpeg"/>
			<guid isPermaLink="false">e759c743-85d6-4a55-8327-3340e6f4e21b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/howwilltottenham-snewstadiumaffecttheirseason-</link>
			<acast:episodeId>e759c743-85d6-4a55-8327-3340e6f4e21b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>howwilltottenham-snewstadiumaffecttheirseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRCrvDHabQEP6pmnfyQXLa+Pjc1duPu+A305kpk/RSV1OjEZsodCzprGjMQXBXpWit19U4LjAj1j03GTxU2y4mnd3L2hTFd48xg1ejEzAlihZ+DF6K+Ck0jdRAVX7OeIIC7kBafwvK2fBwaXqPdI1SJPILbYtz7y2n22FRcMuIaWGoVdl9aCbMuVcLfoiFh2R5TAHko2JSea40G0ba2JIHf4qjgnj0M3jkVOpnEOLF27TQl9LGlh9AczUeFokYOitBM0+h/gi+62xW9yOlX2COscd5OGvxnE49tzutF19fP/p]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Darren Lewis and Tom Hopkinson discuss Spurs’ new stadium, Zinedine Zidane’s transfer targets for Real Madrid, UEFA’s weekend plans for the Champions League and England’s continued progression under Gareth Southgate.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Tom Hopkinson discuss Spurs’ new stadium, Zinedine Zidane’s transfer targets for Real Madrid, UEFA’s weekend plans for the Champions League and England’s continued progression under Gareth Southgate.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Tom Hopkinson discuss Spurs’ new stadium, Zinedine Zidane’s transfer targets for Real Madrid, UEFA’s weekend plans for the Champions League and England’s continued progression under Gareth Southgate.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Women's Football Podcast: Is this the year of greatest opportunity for women’s football?]]></title>
			<itunes:title><![CDATA[Women's Football Podcast: Is this the year of greatest opportunity for women’s football?]]></itunes:title>
			<pubDate>Wed, 20 Mar 2019 17:57:19 GMT</pubDate>
			<itunes:duration>46:46</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/womensfootballpodcast-isthistheyearofgreatestopportunityforwomen-sfootball-/media.mp3" length="67263828" type="audio/mpeg"/>
			<guid isPermaLink="false">745b7731-184a-47b7-bb9f-1605c8d37773</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/womensfootballpodcast-isthistheyearofgreatestopportunityforwomen-sfootball-</link>
			<acast:episodeId>745b7731-184a-47b7-bb9f-1605c8d37773</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>womensfootballpodcast-isthistheyearofgreatestopportunityforwomen-sfootball-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRKhf94qdJsK/aQxEc1lUdsa+OpqgOUZDlAtg4AEEQ6vmY99tuO/iGyV1L/C/xQai6OisPUlv3YcpuuHAW5w+id3AbQNnfgmM6PK8FKzcPsf2PWlq+H2pkaFvdTa7VWOqXPSVtNVo9P4fyUzc9bTV88MqAmVaHwRCg3Ey/SkeCst3z0MLo9B/QN/I+2uycGtEoRSiDUvhvivCxp8Lq4Q44Ee10dY7XDKuGQ62HP6+SzhoD5GhNkPQw/ExSCg3iGow2+LbFGDYJJUGiaUPTd8yJaNbsdZ1ja3k+b7m3qydo9bj]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jacqui Oatley, Pippa Monique and Glenn Moore look ahead to the 2019 World Cup and discuss how clubs could do more to raise awareness of the women's game.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Mike Calvin, Jacqui Oatley, Pippa Monique and Glenn Moore look ahead to the 2019 World Cup and discuss how clubs could do more to raise awareness of the women's game.</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Mike Calvin, Jacqui Oatley, Pippa Monique and Glenn Moore look ahead to the 2019 World Cup and discuss how clubs could do more to raise awareness of the women's game.</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Liverpool stop Man City’s quadruple dream?</title>
			<itunes:title>Can Liverpool stop Man City’s quadruple dream?</itunes:title>
			<pubDate>Mon, 18 Mar 2019 18:37:10 GMT</pubDate>
			<itunes:duration>43:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canliverpoolstopmancity-squadrupledream-/media.mp3" length="41567996" type="audio/mpeg"/>
			<guid isPermaLink="false">28e20d2e-d7b5-4338-a00c-1ba2532d1acf</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canliverpoolstopmancity-squadrupledream-</link>
			<acast:episodeId>28e20d2e-d7b5-4338-a00c-1ba2532d1acf</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canliverpoolstopmancity-squadrupledream-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9TLYDEByNYw1bQmqehtOfR4Csf7pS9D5BKahF4ZYdX8tSlRG/MNYf097SvfKG4zZt8jtPZ04iXjKjfYAtO3pn1OYnNE3bE/6GfTb9WxWrYRoFqE6bmdUccsif+KLC+O7U3EAqRBaAhET5briZMHyT12hd1fNdyM2yVsC9RO1DCrI5D0eCs/rFWV3CvQelSdoqFKoTCIJBRZ3HVGFIXThS/PQAqlhhoQ8XjlyzdQViwMHJRVFQypbFkCOR8XrG6usp]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Tony Evans and Seb Stafford-Bloor discuss the Premier League title race, the Champions League and Europa League draws, and England’s upcoming international qualifiers.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Tony Evans and Seb Stafford-Bloor discuss the Premier League title race, the Champions League and Europa League draws, and England’s upcoming international qualifiers.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tony Evans and Seb Stafford-Bloor discuss the Premier League title race, the Champions League and Europa League draws, and England’s upcoming international qualifiers.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Would a Champions League exit be good for Liverpool?</title>
			<itunes:title>Would a Champions League exit be good for Liverpool?</itunes:title>
			<pubDate>Mon, 11 Mar 2019 18:56:53 GMT</pubDate>
			<itunes:duration>47:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/wouldachampionsleagueexitbegoodforliverpool-/media.mp3" length="68222860" type="audio/mpeg"/>
			<guid isPermaLink="false">97cd1d48-bc8f-4227-8a75-9260fbdd2655</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/wouldachampionsleagueexitbegoodforliverpool-</link>
			<acast:episodeId>97cd1d48-bc8f-4227-8a75-9260fbdd2655</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>wouldachampionsleagueexitbegoodforliverpool-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz94Mgw6lC0mNx4pVSMIjy5eb4WFghezrsKLpLSIgYZ5unf4VPGwCkGtxXfNGvdDOHGajUv+L/u7a1o1tH4/57XJCCWqDZdbSOQX40syzLcrqnWD4AzH6hYNpc1z38RzF+kNNypnHgLyC9ghpBcBReHjPN4ieWjm3sKIaGTCW4m+EE9gZo7Utu0M19IZ2zp7ULzgjqawFYuqZq26daQ2tuJd4EPmXp546qBShyD2C1MZAXwqBgwl3vA4u3hwUGAArWp]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Darren Lewis and Daniel Storey to preview the final batch of round of 16 games from the UEFA Champions League, including Bayern Munich v Liverpool exclusively live on BT Sport.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Darren Lewis and Daniel Storey to preview the final batch of round of 16 games from the UEFA Champions League, including Bayern Munich v Liverpool exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Darren Lewis and Daniel Storey to preview the final batch of round of 16 games from the UEFA Champions League, including Bayern Munich v Liverpool exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Is Tottenham's season on verge of collapse?]]></title>
			<itunes:title><![CDATA[Is Tottenham's season on verge of collapse?]]></itunes:title>
			<pubDate>Mon, 04 Mar 2019 17:18:54 GMT</pubDate>
			<itunes:duration>46:10</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/istottenhamsseasononvergeofcollapse-/media.mp3" length="66381794" type="audio/mpeg"/>
			<guid isPermaLink="false">9a1c6697-55ce-4fd4-906e-827bc4ea300b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/istottenhamsseasononvergeofcollapse-</link>
			<acast:episodeId>9a1c6697-55ce-4fd4-906e-827bc4ea300b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>istottenhamsseasononvergeofcollapse-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9ubs30LyQlnzhw3MQEaBY9LSDQtFxhtoxhUJoUIgi8iESCQxx/dY9jsdttewfa/AaVLQEwovq+OEAmuQiZSnbslSQVm+FwlF+vzgSkFpc0HI6mSQ4o24wNBdYIJodBhbj9QgzvNPRsODIKEkRIHkxQU7HggG9P+T2eoCYU9xTz85Vmne8rkJI1DcxTrkJLdNyMG+Bj4NTeCuLGWL6CnOGLgH1cjDCpw97s+VG9ooeOru5WWyXqFdmUkfEKyGEYHHo]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jonathan Northcroft and Sarah Shephard reflect on the North London and Merseyside derbies and preview this week's Champions League fixtures, exclusively live on BT Sport.​]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Sarah Shephard reflect on the North London and Merseyside derbies and preview this week's Champions League fixtures, exclusively live on BT Sport.​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Sarah Shephard reflect on the North London and Merseyside derbies and preview this week's Champions League fixtures, exclusively live on BT Sport.​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Does Kepa's rebellion signal the end for Sarri at Chelsea?]]></title>
			<itunes:title><![CDATA[Does Kepa's rebellion signal the end for Sarri at Chelsea?]]></itunes:title>
			<pubDate>Mon, 25 Feb 2019 17:13:26 GMT</pubDate>
			<itunes:duration>45:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/doeskepasrebellionsignaltheendforsarriatchelsea-/media.mp3" length="108876800" type="audio/mpeg"/>
			<guid isPermaLink="false">df0643d8-f81c-4a15-8df7-f924a8266741</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/doeskepasrebellionsignaltheendforsarriatchelsea-</link>
			<acast:episodeId>df0643d8-f81c-4a15-8df7-f924a8266741</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>doeskepasrebellionsignaltheendforsarriatchelsea-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9lp2otocfMyT9eAAacRleiylRbjoRdXxEbJWy8ioSH2fD8G1+uoH8K5UiZgV7nZZf7nssiwWgijSZg3oTiGo5FX6gH0WharaJoyT2yMM/25PPpb6SAiZ9B6RJtnkUxz7pNyZ5HNlIAd+ODjMnRGO4meaF2QuFVYtoRHv+XH2W13CTcl9AagGlK4wYGbH+QkZjZT+3m1erI78J6ayBodVJlOuyiRerJQNOlPOiVyqE6kCjd/23hU3RSI7NJFYLyfHT]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Dominic Fifield and Dave Kidd reflect on Chelsea goalkeeper Kepa Arrizabalaga's bizarre refusal to come off in the League Cup final against Manchester City, Leicester's sacking of Claude Puel and the Premier League title race.​]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dominic Fifield and Dave Kidd reflect on Chelsea goalkeeper Kepa Arrizabalaga's bizarre refusal to come off in the League Cup final against Manchester City, Leicester's sacking of Claude Puel and the Premier League title race.​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dominic Fifield and Dave Kidd reflect on Chelsea goalkeeper Kepa Arrizabalaga's bizarre refusal to come off in the League Cup final against Manchester City, Leicester's sacking of Claude Puel and the Premier League title race.​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Can Phil Neville's Lionesses emulate Southgate's summer of success?]]></title>
			<itunes:title><![CDATA[Can Phil Neville's Lionesses emulate Southgate's summer of success?]]></itunes:title>
			<pubDate>Thu, 21 Feb 2019 06:00:42 GMT</pubDate>
			<itunes:duration>50:16</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canphilnevilleslionessesemulatesouthgatessummerofsuccess-/media.mp3" length="120556028" type="audio/mpeg"/>
			<guid isPermaLink="false">0ebd13d6-b6be-4052-b946-f1302b576756</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canphilnevilleslionessesemulatesouthgatessummerofsuccess-</link>
			<acast:episodeId>0ebd13d6-b6be-4052-b946-f1302b576756</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canphilnevilleslionessesemulatesouthgatessummerofsuccess-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9SoVFN1GDFNT1O5cz78GDEPExxJ2fF4pCx/FY9FSg58Ch0aEK2x4wyVnw6kHizgFp6vsGIro1v6PkteBkGmsAkbMLsIpv08Qa28X97GuXhwKCYS2lkzurnlqdKAkScwUD8V7lbhGVxJ3D9X4CzGoZFMquzUsb+2TYDYm42t5Af6EimGLpyNrs4whRyAVHFMVIJMHYNZb4o9gDTlIOsSYpRNrv95pN0ZJGCmG4RuNEeEINxGHhgBsiBnnsKgNqRpSO]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Molly Hudson, Rich Laverty and Anne-Marie Batson discuss Arsenal vs Man City, opportunities for women's coaching, English football trying to catch Lyon and Wolfsburg and Phil Neville's England.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Molly Hudson, Rich Laverty and Anne-Marie Batson discuss Arsenal vs Man City, opportunities for women's coaching, English football trying to catch Lyon and Wolfsburg and Phil Neville's England.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Molly Hudson, Rich Laverty and Anne-Marie Batson discuss Arsenal vs Man City, opportunities for women's coaching, English football trying to catch Lyon and Wolfsburg and Phil Neville's England.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Liverpool face season-defining week</title>
			<itunes:title>Liverpool face season-defining week</itunes:title>
			<pubDate>Mon, 18 Feb 2019 17:43:53 GMT</pubDate>
			<itunes:duration>44:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/liverpoolfaceseason-definingweek/media.mp3" length="107053976" type="audio/mpeg"/>
			<guid isPermaLink="false">76dfed89-fa2d-4209-811e-d1c5dc188c95</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/liverpoolfaceseason-definingweek</link>
			<acast:episodeId>76dfed89-fa2d-4209-811e-d1c5dc188c95</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>liverpoolfaceseason-definingweek</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9GkOpVK/4timO59FEjhvFShoTjJ80f1a9VbhIPrayCyObA2Qa+CyZDs7/pYBlNJ0qPqQ6mTRZldSOcjR4Oyr15EwaRitZ8kIRqruWSrmc6Z7I/RfiZSxcRYXNhFR3ww685s9LxViLgGQA5idB+dwGNiTB0/gnbPuDt3duCKb+8EFfHSK5wLkaoaV7QjaH7XHE85QV/aTN2WFHqN+aVUyKHQwlzWELWedHxQlIZruQPfFFwhrUQQ+UAjYD/rWiCtSQ]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Adrian Clarke and Tom Hopkinson to preview the latest round of UEFA Champions League round of 16 ties, including Liverpool v Bayern Munich, which is exclusively live on BT Sport 2 and 4K UHD from 7pm on Tuesday.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Adrian Clarke and Tom Hopkinson to preview the latest round of UEFA Champions League round of 16 ties, including Liverpool v Bayern Munich, which is exclusively live on BT Sport 2 and 4K UHD from 7pm on Tuesday.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Adrian Clarke and Tom Hopkinson to preview the latest round of UEFA Champions League round of 16 ties, including Liverpool v Bayern Munich, which is exclusively live on BT Sport 2 and 4K UHD from 7pm on Tuesday.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA["Solskjær has changed everything at United"]]></title>
			<itunes:title><![CDATA["Solskjær has changed everything at United"]]></itunes:title>
			<pubDate>Mon, 11 Feb 2019 16:40:41 GMT</pubDate>
			<itunes:duration>46:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/solskj-rhaschangedeverythingatunited/media.mp3" length="112597616" type="audio/mpeg"/>
			<guid isPermaLink="false">52653b09-8d17-4bef-bc18-6a9852691210</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/solskj-rhaschangedeverythingatunited</link>
			<acast:episodeId>52653b09-8d17-4bef-bc18-6a9852691210</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>solskj-rhaschangedeverythingatunited</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFZs2KsuzlkR/j9t35O4LI8NWKkjs7T7w+rzXd28mhPri21srDOmOEfDIYLI71KSuR99QpIqCVSDIhMgrlXug8ntX8Nv7UWc2xFb5Tw8mG6v9hPEn/w2Xf8ei9fy/KY97HWrSDJvqJ4x/qQOQeoULcOeGRvqXvSXbFh92mIs53c5ps0Jk7YiNGXhS4DanaiYTvv/QYa+trKTaNfVJOBy2dykdyUB00/PbYNtNTrNiq+Bg8ALsDq51hyp5xHY3Yap9IrekCRGWaN2tTg71SDoxJjdBgr74lg7MaYazD24bY24]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by John Cross and Daniel Storey to preview the UEFA Champions League round of 16, that kicks off with Manchester United v Paris Saint-Germain, exclusively live on BT Sport.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by John Cross and Daniel Storey to preview the UEFA Champions League round of 16, that kicks off with Manchester United v Paris Saint-Germain, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by John Cross and Daniel Storey to preview the UEFA Champions League round of 16, that kicks off with Manchester United v Paris Saint-Germain, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Season-defining week for City? Should Everton sack Silva?</title>
			<itunes:title>Season-defining week for City? Should Everton sack Silva?</itunes:title>
			<pubDate>Mon, 04 Feb 2019 17:05:56 GMT</pubDate>
			<itunes:duration>44:16</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/season-definingweekforcity-shouldevertonsacksilva-/media.mp3" length="106188516" type="audio/mpeg"/>
			<guid isPermaLink="false">31b255ee-c20b-4080-8dab-4cda33f06527</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/season-definingweekforcity-shouldevertonsacksilva-</link>
			<acast:episodeId>31b255ee-c20b-4080-8dab-4cda33f06527</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>season-definingweekforcity-shouldevertonsacksilva-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz92ZXlssFs/0lg7ySv4oLl3LvBf29CJuUGyL+wJeh27X0RAvwB4lbs1GoRT7B2MUkMXgb3F2SedENRo86K9qQdebnXRDtqQMhgdJ7jG8n45NMrLnYs8BDH9voSsz17mxalyRrXisCCJ2jQxB38X6IELN3MKwHeicbRkB5pWcAzJta7McMXs53T/NKXoKSQI/6A+ib2Or+GXYuDXsNYIbtsCnhE8qq4cJ0+PSI+KyzB/49s9Ik1R/6jwBwDgXJLrmrd]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jonathan Northcroft and Alyson Rudd break down all the key talking points from another blockbuster Premier League weekend as Man City cruise past Arsenal, the boos grow louder for Marco Silva and Neil Warnock keeps Cardiff's survival ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Alyson Rudd break down all the key talking points from another blockbuster Premier League weekend as Man City cruise past Arsenal, the boos grow louder for Marco Silva and Neil Warnock keeps Cardiff's survival hopes alive.​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Alyson Rudd break down all the key talking points from another blockbuster Premier League weekend as Man City cruise past Arsenal, the boos grow louder for Marco Silva and Neil Warnock keeps Cardiff's survival hopes alive.​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Quadruple for City and where next for Pochettino?</title>
			<itunes:title>Quadruple for City and where next for Pochettino?</itunes:title>
			<pubDate>Mon, 28 Jan 2019 18:26:48 GMT</pubDate>
			<itunes:duration>41:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/quadrupleforcityandwherenextforpochettino-/media.mp3" length="99136280" type="audio/mpeg"/>
			<guid isPermaLink="false">fdc3b4f4-f6bd-4697-a54a-1e7424d9e6de</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/quadrupleforcityandwherenextforpochettino-</link>
			<acast:episodeId>fdc3b4f4-f6bd-4697-a54a-1e7424d9e6de</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>quadrupleforcityandwherenextforpochettino-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9xVVEUP/z31tT75qrT5tIS/5o0r4qsRLWR73IU3mxG86JBnTUfg7qceY+D83ublfSBoYQ6nupBnHiic3HSUT/8xMNtQWX18ILtGiEGydck5/ugQR/s5QfunQYWT0e7xIRCnazHOudOpTJqgE4RrkV+Yh5d69g7qPJe+G6TB/MCYj0USHkMA/7+FtmkXy7kQ0IggXB4qvCLyx+jpLJL+j42rRTy3wgfUsBb5tSz0I1i5f0tm+xzE8I3YtsolZRdlI6]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Seb Stafford-Bloor and Tony Evans as they look back on the fourth round of the FA Cup. Tony Evans defends Mo Salah's run-ins with referees and fears that Tottenham's trophy win could be over before it's even begu...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Seb Stafford-Bloor and Tony Evans as they look back on the fourth round of the FA Cup. Tony Evans defends Mo Salah's run-ins with referees and fears that Tottenham's trophy win could be over before it's even begun. Seb Stafford-Bloor is impressed by Ole Gunnar Solskjaer's incredible start but sees a big job at the Emirates as Arsenal struggle.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Seb Stafford-Bloor and Tony Evans as they look back on the fourth round of the FA Cup. Tony Evans defends Mo Salah's run-ins with referees and fears that Tottenham's trophy win could be over before it's even begun. Seb Stafford-Bloor is impressed by Ole Gunnar Solskjaer's incredible start but sees a big job at the Emirates as Arsenal struggle.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Women’s football podcast: How can the FA Women’s Super League go to the next level?</title>
			<itunes:title>Women’s football podcast: How can the FA Women’s Super League go to the next level?</itunes:title>
			<pubDate>Thu, 24 Jan 2019 06:00:00 GMT</pubDate>
			<itunes:duration>43:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/women-sfootballpodcast-howcanthefawomen-ssuperleaguegotothenextlevel-/media.mp3" length="103307060" type="audio/mpeg"/>
			<guid isPermaLink="false">311aadc8-67bb-4164-9b02-258d00b69194</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/women-sfootballpodcast-howcanthefawomen-ssuperleaguegotothenextlevel-</link>
			<acast:episodeId>311aadc8-67bb-4164-9b02-258d00b69194</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>women-sfootballpodcast-howcanthefawomen-ssuperleaguegotothenextlevel-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9SPyAvv9GDLcJ3u8Ug+pV//YAiAtDPLKlp5uYPc1vbC4A2yobpigGTFvRdHgWe04RH/eN7Cn5uZ9nnnYMSLSjJG6t4wwI+AuEWEQXH/9/s1njuvCuRH4IsX0dQBEc6yStvION4Q2Oa2lLzFtqGzXqwxd1rcFHKgzQ0cAQyGmBcESvaflmTFwII34UojacFtOB74y4XwdP5uRmuOO4yHH8S4rQtMjL8yjKqovnZ3crcyA6d83xkfFEJHh/DJ0k52i0]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Suzy Wrack, Katie Whyatt and Glenn Moore discuss the biggest stories in the women’s game, the WSL title race and the impact of the sport in America.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Suzy Wrack, Katie Whyatt and Glenn Moore discuss the biggest stories in the women’s game, the WSL title race and the impact of the sport in America.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Suzy Wrack, Katie Whyatt and Glenn Moore discuss the biggest stories in the women’s game, the WSL title race and the impact of the sport in America.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>FA Cup fourth round preview</title>
			<itunes:title>FA Cup fourth round preview</itunes:title>
			<pubDate>Mon, 21 Jan 2019 16:16:13 GMT</pubDate>
			<itunes:duration>43:39</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/facupfourthroundpreview/media.mp3" length="104700800" type="audio/mpeg"/>
			<guid isPermaLink="false">d3f911ed-3994-4bf1-b98c-2cc057ae109e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/facupfourthroundpreview</link>
			<acast:episodeId>d3f911ed-3994-4bf1-b98c-2cc057ae109e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>facupfourthroundpreview</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz94Mtx1CKZra+VrVHKPyzZfv8teQ6Fgp5TM5cGrH6gTuQIzSONnKpm3Fh/aJmhBAnqieorGQ4ka+OQHbzmjFsfnQVEZQfeg4HQrU6dpSxYVCJWwHAQpDxUCYYTtPIzOT8wARDwyStE1n62Dmb7RtreuAosYL4Dqs2LPE6Bn5TssuuWhurhMz4zaP8EZ738DzvJbqnZlBFP6rS7qzd+F01qlm9VbPZjfUqBi4ruYuTOINSQKgwPYtOs4562HqSeC1Ke]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Darren Lewis and Sarah Shephard assess the FA Cup fourth round ties, the battle for the Premier League top four and the potential January transfer deals.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Sarah Shephard assess the FA Cup fourth round ties, the battle for the Premier League top four and the potential January transfer deals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Sarah Shephard assess the FA Cup fourth round ties, the battle for the Premier League top four and the potential January transfer deals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Solskjaer capable of being a long-term success at Man United?</title>
			<itunes:title>Is Solskjaer capable of being a long-term success at Man United?</itunes:title>
			<pubDate>Mon, 14 Jan 2019 17:26:03 GMT</pubDate>
			<itunes:duration>45:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/issolskjaercapableofbeingalong-termsuccessatmanunited-/media.mp3" length="65207418" type="audio/mpeg"/>
			<guid isPermaLink="false">73d70f91-8221-4ce6-b7f3-727140b0f8d3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/issolskjaercapableofbeingalong-termsuccessatmanunited-</link>
			<acast:episodeId>73d70f91-8221-4ce6-b7f3-727140b0f8d3</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>issolskjaercapableofbeingalong-termsuccessatmanunited-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9sXc34FXQX/ULTUhF/uvi3WmSrVFrchSyNZhbwsuQOXKd+hNwMB3ILjy7c5vXSWBlcFdxaRE8XfGmZYKaNt94UaRJiEMh9MeD9XgMa5dKhsB13+bzpXD4IgP2tnsTowsATslakuxx3d4v5KBoDkudmvMKgv08NE0zZqDKPEn6GpA45CTWVwQujJEvYZ6NKXILRxXhW41CJeY+2XkBY38jM6ejsDUh7m6xj6J1Ai09aTagnYjfzR9UbrYP5ppFCcvx]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and Seb Stafford-Bloor debate whether Ole Gunnar Solskjaer is a viable long-term option for Manchester United, the promising future of Declan Rice and Newcastle’s relegation fears.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford-Bloor debate whether Ole Gunnar Solskjaer is a viable long-term option for Manchester United, the promising future of Declan Rice and Newcastle’s relegation fears.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford-Bloor debate whether Ole Gunnar Solskjaer is a viable long-term option for Manchester United, the promising future of Declan Rice and Newcastle’s relegation fears.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Man City crush Liverpool’s invincible dream to blow title race wide open</title>
			<itunes:title>Man City crush Liverpool’s invincible dream to blow title race wide open</itunes:title>
			<pubDate>Fri, 04 Jan 2019 15:11:51 GMT</pubDate>
			<itunes:duration>46:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mancitycrushliverpool-sinvincibledreamtoblowtitleracewideopen/media.mp3" length="67466026" type="audio/mpeg"/>
			<guid isPermaLink="false">b0bbdf3f-c5a4-43f3-8afc-9211e66c0243</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mancitycrushliverpool-sinvincibledreamtoblowtitleracewideopen</link>
			<acast:episodeId>b0bbdf3f-c5a4-43f3-8afc-9211e66c0243</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mancitycrushliverpool-sinvincibledreamtoblowtitleracewideopen</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9SGn026kGN6E3XpSsGHmmXZwUuVh8zFuvmtvSxniXKfUF9aCdD0u0abvuBzUqdkvioy7YYDtAoUxoz7D1lQAQsdbGVfCVbWAt0SW8quzT6VOXuulF9JsBlax+ILCH7Ytj1m3oMde9NqvQn/TtvaavBCGyUpgM9aKHld/BXvCbm/EPvb8Qf4QioUZdq4pOU2h26cVw+2Qms+THPKVHbk0UBWtpnUm+pZ3l9RcWZhlxz+2J5YEILwwfFrIV6VkoPUDk]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Dom Fifield and Daniel Storey dissect the Premier League title race in light of Man City’s essential victory over Liverpool, Ole Gunnar Solskjaer’s impact at Man United and the battle to avoid relegation.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dom Fifield and Daniel Storey dissect the Premier League title race in light of Man City’s essential victory over Liverpool, Ole Gunnar Solskjaer’s impact at Man United and the battle to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dom Fifield and Daniel Storey dissect the Premier League title race in light of Man City’s essential victory over Liverpool, Ole Gunnar Solskjaer’s impact at Man United and the battle to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>FA Cup third round preview</title>
			<itunes:title>FA Cup third round preview</itunes:title>
			<pubDate>Mon, 31 Dec 2018 06:00:00 GMT</pubDate>
			<itunes:duration>35:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/facupthirdroundpreview/media.mp3" length="50878904" type="audio/mpeg"/>
			<guid isPermaLink="false">9bd6f740-d022-4d27-b731-acf80e5acf33</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/facupthirdroundpreview</link>
			<acast:episodeId>9bd6f740-d022-4d27-b731-acf80e5acf33</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>facupthirdroundpreview</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9qLCBMOB8EJ+w/inYz6dL8kMSNlZBJ27CWifimu0muZPJhLG3YNhbE2DAAq9aROXHyvajJg1cHzGJdn9neRfOUlruqaNWU4WfxGZmtXH+Zl9amC/NQlG4HmHhk2v7ZbKgpgIbbd7KjCkLqCpV4dac5U+LD7ED9kZ0ufepn1s1WG1eUVfgmDqFuDdvCrlpHpEV/g94kWd2syG+GGxyQ7B1cBceiRvH5qRXS1XZ5sO8FVBprvFW/Tl0TAVHUfnctGYy]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and David Preece preview the FA Cup third round fixtures and predict where there could be potential upsets.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and David Preece preview the FA Cup third round fixtures and predict where there could be potential upsets.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and David Preece preview the FA Cup third round fixtures and predict where there could be potential upsets.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Mid-season awards: Manager, signing, flop and unsung hero of 2018</title>
			<itunes:title>Mid-season awards: Manager, signing, flop and unsung hero of 2018</itunes:title>
			<pubDate>Mon, 24 Dec 2018 06:00:00 GMT</pubDate>
			<itunes:duration>44:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mid-seasonawards-manager-signing-flopandunsungheroof2018/media.mp3" length="63833974" type="audio/mpeg"/>
			<guid isPermaLink="false">e306c5a0-be67-4387-8064-8933c2947784</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mid-seasonawards-manager-signing-flopandunsungheroof2018</link>
			<acast:episodeId>e306c5a0-be67-4387-8064-8933c2947784</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mid-seasonawards-manager-signing-flopandunsungheroof2018</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRHhYE4kGzjxbnGDoNI54Al0jZDZlqjEEWN+Hq0krB2xpvSr4Zverid7lBjfKDdyDa9ggzZHR5r22ag4oGvZRWkI3z3FxeppWUuSvohiprO3wo4SQhBaaMZmp2r3W0r/l9Aetr/HiVDSaLmy8zJeDXwpgwZMUjCXJIxU6kns7DYvfDFpoZ8MLmH6iz+IOZnizD/9vP44kRAYHUMIIaXIA9MYC05TzhZsE6m4dhFXkSta0JCs6muQLjOiDnj90sNPqLjs+M1XFpSZkt+sThk8LRCPz6XixhLtXMcFqiwNUcAUT]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and David Preece discuss their manager, unsung herp, young player, signing and flop of the year and give their verdict on Ole Gunnar Solskjaer’s appointment at Manchester United.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and David Preece discuss their manager, unsung herp, young player, signing and flop of the year and give their verdict on Ole Gunnar Solskjaer’s appointment at Manchester United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and David Preece discuss their manager, unsung herp, young player, signing and flop of the year and give their verdict on Ole Gunnar Solskjaer’s appointment at Manchester United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Women's Football Podcast: Can England win the World Cup?]]></title>
			<itunes:title><![CDATA[Women's Football Podcast: Can England win the World Cup?]]></itunes:title>
			<pubDate>Thu, 20 Dec 2018 06:00:00 GMT</pubDate>
			<itunes:duration>49:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/womensfootballpodcast-canenglandwintheworldcup-/media.mp3" length="71364128" type="audio/mpeg"/>
			<guid isPermaLink="false">adb2fca5-d8ec-424e-b4f0-1e0d0effaa01</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/womensfootballpodcast-canenglandwintheworldcup-</link>
			<acast:episodeId>adb2fca5-d8ec-424e-b4f0-1e0d0effaa01</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>womensfootballpodcast-canenglandwintheworldcup-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz95exr1sLomlfoORrzdqOs47Z1yzSAfoPJ+TcXttuAilZf+DXjzp2pKUt9wCwAxpPWJf6VVAyxSoNX6roiJY7thkQpW48SxWHow/igMYMwfNWyd+AgQkFQuRR2Qn3sxtWMsJLTneDKKvvraRmgG4CAXQlzMzvb+oX7QuqBczWFLob/BgVaqahpDR4hA67mp42dbUB0OXCuCgo+Oe3xIt4xP+VXw0Rdx1SBAocAn1xMbNxt2DtLAvEA+sD8d1/8Gsq/]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jacqui Oatley, Molly Hudson and Kieran Thievam dissect Phil Neville's impact as England Women's head coach and discuss the major challenges facing the international and domestic game.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jacqui Oatley, Molly Hudson and Kieran Thievam dissect Phil Neville's impact as England Women's head coach and discuss the major challenges facing the international and domestic game.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jacqui Oatley, Molly Hudson and Kieran Thievam dissect Phil Neville's impact as England Women's head coach and discuss the major challenges facing the international and domestic game.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>United face tricky PSG draw as Liverpool, City and Spurs await German opposition</title>
			<itunes:title>United face tricky PSG draw as Liverpool, City and Spurs await German opposition</itunes:title>
			<pubDate>Mon, 17 Dec 2018 15:06:32 GMT</pubDate>
			<itunes:duration>42:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/unitedfacetrickypsgdrawasliverpool-cityandspursawaitgermanopposition/media.mp3" length="61180360" type="audio/mpeg"/>
			<guid isPermaLink="false">5dd168d9-d05e-49e1-be83-c75073bd79dc</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/unitedfacetrickypsgdrawasliverpool-cityandspursawaitgermanopposition</link>
			<acast:episodeId>5dd168d9-d05e-49e1-be83-c75073bd79dc</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>unitedfacetrickypsgdrawasliverpool-cityandspursawaitgermanopposition</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9LJCzvER5FXcQoy5HWILL4Bmw6wtKL2FZ48TI/wbp292Q/jCPZEAkhbMXWmOjIH9ADES6OKOzfdUBa5lLrVzK7NkFGazst5MFXKieYNG+B5BVRlBZBNMRuCy1ag06dRy4enjHrVpU4VogZuBCqLH7hO/CDN87H2PSeagZtKh6cD7xR9s0lu76cPhEvhaCc3yv4s6KRbjVubZM3DNlxYZHVcY1HwZ5TxGfH0Ff6WRRFqeW/902xrMtFPXJk2lcaaSp]]></acast:settings>
			<itunes:subtitle>Mike Calvin, John Cross and Dom Fifield reflect on the UEFA Champions League round of 16 draw as Liverpool, Manchester City, Manchester United and Tottenham discover their European fate.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Dom Fifield reflect on the UEFA Champions League round of 16 draw as Liverpool, Manchester City, Manchester United and Tottenham discover their European fate.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Dom Fifield reflect on the UEFA Champions League round of 16 draw as Liverpool, Manchester City, Manchester United and Tottenham discover their European fate.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Liverpool go top as Chelsea crush City’s invincible dream</title>
			<itunes:title>Liverpool go top as Chelsea crush City’s invincible dream</itunes:title>
			<pubDate>Mon, 10 Dec 2018 18:16:54 GMT</pubDate>
			<itunes:duration>54:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/liverpoolgotopaschelseacrushcity-sinvincibledream/media.mp3" length="78221332" type="audio/mpeg"/>
			<guid isPermaLink="false">1043ad48-f02e-434e-ba47-32ef9afc7643</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/liverpoolgotopaschelseacrushcity-sinvincibledream</link>
			<acast:episodeId>1043ad48-f02e-434e-ba47-32ef9afc7643</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>liverpoolgotopaschelseacrushcity-sinvincibledream</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Ewrf8dyTjPBDA8F5S5FwLBbhyA7OH8Xcc8dzCnWgo3el6lOvEOBd9kDKIUqdlO5tZ0XeZWsfHni/VA8gCoc2kjdmf4ygTiHHpeYXM7IrRMBDIuDjqhaE1I38jnohsf2k9Zft6StZlTvGVTZoLBQiBmzhCCRjkKiMKMiRTU/IdKM3/9IgdVBrh5YIQXiUjN8Aket2GIFXepJkehADzxajAFPXz+KDQ6zQIUseWi8zkkvhteapFZmq4XvP0zJoTpyR]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Darren Lewis and Tony Evans reflect on a blockbuster Premier League weekend and look ahead to a crucial Champions League week for Liverpool and Tottenham.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Tony Evans reflect on a blockbuster Premier League weekend and look ahead to a crucial Champions League week for Liverpool and Tottenham.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Tony Evans reflect on a blockbuster Premier League weekend and look ahead to a crucial Champions League week for Liverpool and Tottenham.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Arsenal inflict body blow on Spurs in fiery derby</title>
			<itunes:title>Arsenal inflict body blow on Spurs in fiery derby</itunes:title>
			<pubDate>Mon, 03 Dec 2018 16:14:29 GMT</pubDate>
			<itunes:duration>42:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/arsenalinflictbodyblowonspursinfieryderby/media.mp3" length="61347502" type="audio/mpeg"/>
			<guid isPermaLink="false">8e6b017a-845f-442d-adfb-ae78c5a99c84</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/arsenalinflictbodyblowonspursinfieryderby</link>
			<acast:episodeId>8e6b017a-845f-442d-adfb-ae78c5a99c84</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>arsenalinflictbodyblowonspursinfieryderby</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9u+PtHJZj83qykQZOtQI3bUhqHFLg/Ynfulzd5gIywFdGzj8zALyS4phFpTnemt68xTFFYJTKvSGy1Bqa+F3cYkfkoGFfr8z03C653BbclHQH1BuSTtdJPh+SnOvPhFsa7FWNPis6BEb1HJ1V2S4Ffbi63b6zyhAZ9nxKdbTLA8PDqUT5afDSGzC37frqAQLah9pd7qQT7Ke4tnE3wCYXGDtCnDPFIsJQLThk1snmL3uoAls+u3IKG0r1W4zsroYK]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Jonathan Northcroft and David Preece as the panel look back at an eventful weekend of Premier League action and react to the news of Southampton boss Mark Hughes' sacking.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Jonathan Northcroft and David Preece as the panel look back at an eventful weekend of Premier League action and react to the news of Southampton boss Mark Hughes' sacking.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Jonathan Northcroft and David Preece as the panel look back at an eventful weekend of Premier League action and react to the news of Southampton boss Mark Hughes' sacking.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Spurs and Liverpool turn on the style ahead of crunch week</title>
			<itunes:title>Spurs and Liverpool turn on the style ahead of crunch week</itunes:title>
			<pubDate>Mon, 26 Nov 2018 17:28:27 GMT</pubDate>
			<itunes:duration>48:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/spursandliverpoolturnonthestyleaheadofcrunchweek/media.mp3" length="69141828" type="audio/mpeg"/>
			<guid isPermaLink="false">c08a583c-4dfd-4013-9463-f54b48f1ea2d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/spursandliverpoolturnonthestyleaheadofcrunchweek</link>
			<acast:episodeId>c08a583c-4dfd-4013-9463-f54b48f1ea2d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>spursandliverpoolturnonthestyleaheadofcrunchweek</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9MFwXNw26kg2s8WTH5MyRDwOnhr6JgSlaFg+p6eHt7s9HTqU1Z1ura7FHwEy4aDIpQ2YL8nVjlOTTM/90kFDARA4uDn9iSeAbV2XhfMitY5sVpwN59GAw7I3w8r9YtQx3wc6+GQxBSKaDUp4L9CNsd/QjFdOPukmWTNLbUNVs+dJ6jdPWu8RWyLymQSGyLtyLqHlQcA86PZYsmy3JWR4wK+tNTZyaayrMivD1b2RlJQfxou5VEoQ05i228fbzuZXZ]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and Seb Stafford-Bloor preview a huge week for both Tottenham and Liverpool in the Champions League and Premier League and round up the rest of the weekend action as Jose Mourinho’s Man United side fail to impress once again.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford-Bloor preview a huge week for both Tottenham and Liverpool in the Champions League and Premier League and round up the rest of the weekend action as Jose Mourinho’s Man United side fail to impress once again.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford-Bloor preview a huge week for both Tottenham and Liverpool in the Champions League and Premier League and round up the rest of the weekend action as Jose Mourinho’s Man United side fail to impress once again.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>England cap breakthrough year with sweet revenge over Croatia</title>
			<itunes:title>England cap breakthrough year with sweet revenge over Croatia</itunes:title>
			<pubDate>Mon, 19 Nov 2018 17:16:24 GMT</pubDate>
			<itunes:duration>50:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/englandcapbreakthroughyearwithsweetrevengeovercroatia/media.mp3" length="72631778" type="audio/mpeg"/>
			<guid isPermaLink="false">425de5d5-ccc1-42b8-bb56-b45f2f9d6901</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/englandcapbreakthroughyearwithsweetrevengeovercroatia</link>
			<acast:episodeId>425de5d5-ccc1-42b8-bb56-b45f2f9d6901</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>englandcapbreakthroughyearwithsweetrevengeovercroatia</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9s0002mlwgu41g0TIuHo3yCDHfMYQOtnuocd/h2oNm2SbkaPBJl8QVzKY6rVn2w3DnRHlDY4edtx5uwnwcEE9tm3Arzv3Yk+tUHlHceRVruNsCgR5jZj9wTwSKR8RNCQ+HqLGvN8gcgIb4Omky4L3vj/e5nb7lKjjO9gKxWAv0zaAdAZcER7uPcgJG2BSANgh+LPmDocQPLme8l4/zpvs08ac27WyP0XTkROCdRc4uffeQguybIH+AJRgdA+/YUPV]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Dave Kidd and Sarah Shephard discuss how far Gareth Southgate’s young England side can go after topping their UEFA Nations League group and look ahead to the weekend’s Premier League action.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dave Kidd and Sarah Shephard discuss how far Gareth Southgate’s young England side can go after topping their UEFA Nations League group and look ahead to the weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dave Kidd and Sarah Shephard discuss how far Gareth Southgate’s young England side can go after topping their UEFA Nations League group and look ahead to the weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Man City’s on-field brilliance tarnished by off-field allegations</title>
			<itunes:title>Man City’s on-field brilliance tarnished by off-field allegations</itunes:title>
			<pubDate>Mon, 12 Nov 2018 18:21:05 GMT</pubDate>
			<itunes:duration>49:25</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mancity-son-fieldbrilliancetarnishedbyoff-fieldallegations/media.mp3" length="71068030" type="audio/mpeg"/>
			<guid isPermaLink="false">953581dc-ffe4-4e5a-abbc-55907273c39f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mancity-son-fieldbrilliancetarnishedbyoff-fieldallegations</link>
			<acast:episodeId>953581dc-ffe4-4e5a-abbc-55907273c39f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mancity-son-fieldbrilliancetarnishedbyoff-fieldallegations</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9smb4ZUq1nN8o6xpmCGp2dzijJgChEwC/Fwy8N5nPKmhNrfj3LSgHmxc/UVqXFfYowQSujf8LatzKjTgBESn/FwF7GOQiuhL4JhlcBG1mSE5dgTL3/aCiyQkcJyCVbQFWU4SCmHjYFTpJeTbEB80F9yOVkWOsd/5zpUqlcT1EUFyp583yur3sjt9qRMhdD9V2y18Kms+EiO7YpwbGd3gIJkfqrA6lnrQMX32FSBWNO1YidEgWOPe07rDC4EntSNwm]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Darren Lewis and Tom Hopkinson look at the financial allegations against Manchester City following their dominant derby victory over Man United and break down the key talking points at both ends of the Premier League table.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Tom Hopkinson look at the financial allegations against Manchester City following their dominant derby victory over Man United and break down the key talking points at both ends of the Premier League table.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Tom Hopkinson look at the financial allegations against Manchester City following their dominant derby victory over Man United and break down the key talking points at both ends of the Premier League table.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>What are the challenges and opportunities facing the women’s game?</title>
			<itunes:title>What are the challenges and opportunities facing the women’s game?</itunes:title>
			<pubDate>Thu, 08 Nov 2018 06:00:00 GMT</pubDate>
			<itunes:duration>40:51</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatarethechallengesandopportunitiesfacingthewomen-sgame-/media.mp3" length="58739586" type="audio/mpeg"/>
			<guid isPermaLink="false">0183792b-04a7-4ac0-97b7-09e8e09c778e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatarethechallengesandopportunitiesfacingthewomen-sgame-</link>
			<acast:episodeId>0183792b-04a7-4ac0-97b7-09e8e09c778e</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatarethechallengesandopportunitiesfacingthewomen-sgame-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Dp698lV4PD7eeoQPgkgWLEU+g9rCFO1UgN4K55Jy8Nc6qaS44zCXFhb8XtQ/DxeGKTc/BFZ8JPPuhIhLdy2Bs7EvA/SmnwEHFy9KW6iCsg5JfVM9v+XrkrDzXsDTjIFpN40P23ODRPqMKIIC6klCJADCK5zZ5060UmVnrmpIJnF4PO/8/zCsegmeUF/YB6c9YPXw0trC9McEOLTYsDh83ND0kb2brMYko/Ms42/H8RRnp5+P7LiNA1gVPh3UAArZ]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Suzanne Wrack, Anna Kessel and England international footballer Claire Rafferty to discuss the state of women’s football in the UK.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Suzanne Wrack, Anna Kessel and England international footballer Claire Rafferty to discuss the state of women’s football in the UK.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Suzanne Wrack, Anna Kessel and England international footballer Claire Rafferty to discuss the state of women’s football in the UK.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Euro Super League story a sign of things to come?</title>
			<itunes:title>Is Euro Super League story a sign of things to come?</itunes:title>
			<pubDate>Mon, 05 Nov 2018 17:44:08 GMT</pubDate>
			<itunes:duration>49:32</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/footballisnothingwithoutthefans.dothebigclubscare-/media.mp3" length="71225782" type="audio/mpeg"/>
			<guid isPermaLink="false">16500c82-df31-482c-882e-2c003e6f1141</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/footballisnothingwithoutthefans.dothebigclubscare-</link>
			<acast:episodeId>16500c82-df31-482c-882e-2c003e6f1141</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>footballisnothingwithoutthefans.dothebigclubscare-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9agFqtxM8zSJj4TwqwgoI55Yz8EcxAyOiGMbwDBdmzQsSbjxrAuRfvpLDGJCrmvC0U3rsA4+xTxOB0sqhxbcFDgFj3GQwAgvib46ne/aDyf5AQOVnDrL7wEF0U6PqxxWIxS6sBUH0LBavpjvJg7mEtMIzoenOVPLp51SrP2Ps5f5Cxrn6roDqM++qhgNUTD+lrrP7zeMMyyyI6pnEF8+UoSdOh3GkUsl4Xd7w2Oflpx1tnOiRtslLK09aRZNj1Y1A]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Alyson Rudd and Daniel Storey debate the European Super League story and preview a big week of Champions League and Premier League.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Alyson Rudd and Daniel Storey debate the European Super League story and preview a big week of Champions League and Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Alyson Rudd and Daniel Storey debate the European Super League story and preview a big week of Champions League and Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Football mourns the man who made Leicester’s impossible dream a reality</title>
			<itunes:title>Football mourns the man who made Leicester’s impossible dream a reality</itunes:title>
			<pubDate>Mon, 29 Oct 2018 16:37:21 GMT</pubDate>
			<itunes:duration>50:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/footballmournsthemanwhomadeleicester-simpossibledreamareality/media.mp3" length="72871536" type="audio/mpeg"/>
			<guid isPermaLink="false">047a4879-ce27-4d5f-8280-e1ad6ab00784</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/footballmournsthemanwhomadeleicester-simpossibledreamareality</link>
			<acast:episodeId>047a4879-ce27-4d5f-8280-e1ad6ab00784</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>footballmournsthemanwhomadeleicester-simpossibledreamareality</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9O20D2ffz60dtVq+oOKPlxXQKA33Ec0O6XAG9qImtvioQEQJVTwBor0vX9FDVmFI5wpuJynFMiUyLmSdWWNH+Jpv7mWnBWeEvWgVljXCiUtcC9fp0WndySvoss/MstY1/ThdkZPrazRpOm/yHVvsn/wsUUaN7FGZcrId7Uy3aV8pHnh6r2GrEW6DLp3gdCr+rLMPKqEW0ElHBFnyLNCwiJYMauhuBvpTPHPyCwIMqCeFpM/bx0ImmICLBA3Phn9Nm]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and Dominic Fifield pay their respects to the victims of the Leicester City helicopter tragedy and reflect on the weekend’s Premier League action.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Dominic Fifield pay their respects to the victims of the Leicester City helicopter tragedy and reflect on the weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Dominic Fifield pay their respects to the victims of the Leicester City helicopter tragedy and reflect on the weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Juventus and Man Utd renew classic European rivalry</title>
			<itunes:title>Juventus and Man Utd renew classic European rivalry</itunes:title>
			<pubDate>Mon, 22 Oct 2018 14:48:58 GMT</pubDate>
			<itunes:duration>50:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/juventusandmanutdrenewclassiceuropeanrivalry/media.mp3" length="71956950" type="audio/mpeg"/>
			<guid isPermaLink="false">bb00a44e-46c0-4ff0-a19f-3dcc52bdb708</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/juventusandmanutdrenewclassiceuropeanrivalry</link>
			<acast:episodeId>bb00a44e-46c0-4ff0-a19f-3dcc52bdb708</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>juventusandmanutdrenewclassiceuropeanrivalry</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9gro4gGAG/vpi7uUSPxWJ526G6XMYAIYMm9F7+bKFCT9tRdOo0+nWXJXm0YdvIaJO8SnpB1cMnzMgtIRd5djbXp5W0UFAK/6BOWj05ubYWSE9lzhCwswFQnf53+rD0gX3qYpjSLwpTE6t6dwXmxshaln3GGg03181Z8smKiiKkcHXaw0RykgN10D2Z8wTxx9o18bvD/f/8zgR4QzbqTN6CGnpWGWpwqo7WT/kGywLOSd5dSPXkI140FlIjQLfBRbh]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by John Cross and Adrian Clarke to preview round three of the UEFA Champions League and look ahead to an exciting weekend of Premier League action.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by John Cross and Adrian Clarke to preview round three of the UEFA Champions League and look ahead to an exciting weekend of Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by John Cross and Adrian Clarke to preview round three of the UEFA Champions League and look ahead to an exciting weekend of Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Do Mourinho and Hazard’s futures lie away from the Premier League?</title>
			<itunes:title>Do Mourinho and Hazard’s futures lie away from the Premier League?</itunes:title>
			<pubDate>Mon, 15 Oct 2018 18:03:08 GMT</pubDate>
			<itunes:duration>50:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/domourinhoandhazard-sfutureslieawayfromthepremierleague-/media.mp3" length="72270576" type="audio/mpeg"/>
			<guid isPermaLink="false">f8414eb0-f664-4887-b159-82f937ede098</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/domourinhoandhazard-sfutureslieawayfromthepremierleague-</link>
			<acast:episodeId>f8414eb0-f664-4887-b159-82f937ede098</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>domourinhoandhazard-sfutureslieawayfromthepremierleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9co1CqnTwI9fyUZtSSlrmQwYuF81s7xtp9M3tJYUYi7/uYjftcnO/TJ9w38Fv/JBYbnrhJ77d0t+ZHKEBOMcwwzqLiMBrrm3lgfnPH97CZD+pCnhYYwKM0POXlaWt8gy3xW34IYrLFpkoBL5fojr6/GZ9PKoWimSJRMRCZWbNPeU/W3JtsqNXCcRl46sAuBpnbzk++Y1+Svk2/HyDD0V6vXkYFo3u/vbMk+xPTYn+K4d9GIXQo9NSVepYNjfb/3yF]]></acast:settings>
			<itunes:subtitle>Mike Calvin, David Preece and Seb Stafford-Bloor preview Jose Mourinho’s return to Stamford Bridge and discuss Chelsea’s squad revival under Maurizio Sarri and the contrasting ownership models in play at Wolves and Newcastle.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, David Preece and Seb Stafford-Bloor preview Jose Mourinho’s return to Stamford Bridge and discuss Chelsea’s squad revival under Maurizio Sarri and the contrasting ownership models in play at Wolves and Newcastle.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, David Preece and Seb Stafford-Bloor preview Jose Mourinho’s return to Stamford Bridge and discuss Chelsea’s squad revival under Maurizio Sarri and the contrasting ownership models in play at Wolves and Newcastle.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Which Premier League managers’ jobs are at risk?</title>
			<itunes:title>Which Premier League managers’ jobs are at risk?</itunes:title>
			<pubDate>Mon, 08 Oct 2018 14:53:58 GMT</pubDate>
			<itunes:duration>48:10</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whichpremierleaguemanagers-jobsareatrisk-/media.mp3" length="69258890" type="audio/mpeg"/>
			<guid isPermaLink="false">133a2759-533e-4c4f-bf70-037a0271d863</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whichpremierleaguemanagers-jobsareatrisk-</link>
			<acast:episodeId>133a2759-533e-4c4f-bf70-037a0271d863</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whichpremierleaguemanagers-jobsareatrisk-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz99IhbilyJTlsAPRiMxqL6z5ie9BAlCQBN0u8sg4gSSmx321h52pZZrLd1lENyKwJT5+cKRH1B/bCSYJ//whLPOmvKzHlbfNBmy/UHdz8NO+JNhsNDjP3ANm3XbJZ9Id4qcmCamYFNKX0BREyy1iYg1dVUCVvt1VaDzL22dkuFGyMZ4u01EiVLQuQoI4ObUDh6mnQripCniy4/JeTcECAF6m0WAO243Npx4EHHljnygFM6sOnwzHiy8rz1BZYnoq/H]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Darren Lewis and Tom Hopkinson to analyse the state of play in the Premier League as we enter the second international break of the season.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Darren Lewis and Tom Hopkinson to analyse the state of play in the Premier League as we enter the second international break of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Darren Lewis and Tom Hopkinson to analyse the state of play in the Premier League as we enter the second international break of the season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has Jose Mourinho passed the point of no return at Manchester United?</title>
			<itunes:title>Has Jose Mourinho passed the point of no return at Manchester United?</itunes:title>
			<pubDate>Mon, 01 Oct 2018 19:28:24 GMT</pubDate>
			<itunes:duration>49:18</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hasjosemourinhopassedthepointofnoreturnatmanchesterunited-/media.mp3" length="70901514" type="audio/mpeg"/>
			<guid isPermaLink="false">7ea4a414-88f2-44c5-afba-6744f242d749</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hasjosemourinhopassedthepointofnoreturnatmanchesterunited-</link>
			<acast:episodeId>7ea4a414-88f2-44c5-afba-6744f242d749</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hasjosemourinhopassedthepointofnoreturnatmanchesterunited-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9SxGel2/fafpykuZNMevPaZODD4JsW99tfkVpjv+NnrX7d1YqvT6tv1Xdi4QTGGPS7AzoTLpi+OWjqwv+eanyPJ8t76NP24aqAKHklxUu7I28LP0ZIhJ1nqgp775mUwKRcZt9217Q5ZsqxNdec1tmGc1HhCqP3n2h5NEYeOZgJbqbYYBKeCPeJ2AD1S+SY6q6760CUm7ansTKc46svbv4ZSKWPNtEquGR3KGDt9ZEW2N+s0lRLz0lbLaGLLPT8O7Z]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Daniel Storey and Tony Evans in this week’s football writers podcast.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Daniel Storey and Tony Evans in this week’s football writers podcast.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Daniel Storey and Tony Evans in this week’s football writers podcast.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Sarri’s resurgent Chelsea halt the Liverpool juggernaut?</title>
			<itunes:title>Can Sarri’s resurgent Chelsea halt the Liverpool juggernaut?</itunes:title>
			<pubDate>Mon, 24 Sep 2018 14:41:26 GMT</pubDate>
			<itunes:duration>50:32</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/cansarri-sresurgentchelseahalttheliverpooljuggernaut-/media.mp3" length="72681858" type="audio/mpeg"/>
			<guid isPermaLink="false">f3677f59-ecc7-42c2-b341-7780d05c9b81</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/cansarri-sresurgentchelseahalttheliverpooljuggernaut-</link>
			<acast:episodeId>f3677f59-ecc7-42c2-b341-7780d05c9b81</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>cansarri-sresurgentchelseahalttheliverpooljuggernaut-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9KSXr1hzsb0/jmXMjHqlK0rH8+gR2vG/1JpAL0aGA9dMQyhSpm+b4P5f/mPJMgrk489YCyzLQYw0LQ5HhEEx3dUmsims/m0xbLyU4w/4KJ7pLBwnK8QJY91y4eIDROeuz3Ums6nZt266F5q+FYaXTqi596iNqUak6+qf/YpNyyat4xtPEvMh8zzPWnD4UZ+WhA9/yo1YCi0VZhCjuYSb4Eo7v5yi4WAMRD3hkLQSqrJAOw1ZJnUUp/eatp3dAluhq]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and Sarah Shephard discuss Chelsea and Liverpool’s impressive starts to the season ahead of their eagerly-anticipated clash at Stamford Bridge, live on BT Sport on Saturday, plus a round-up of the rest of the weekend’s Premie...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Sarah Shephard discuss Chelsea and Liverpool’s impressive starts to the season ahead of their eagerly-anticipated clash at Stamford Bridge, live on BT Sport on Saturday, plus a round-up of the rest of the weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Sarah Shephard discuss Chelsea and Liverpool’s impressive starts to the season ahead of their eagerly-anticipated clash at Stamford Bridge, live on BT Sport on Saturday, plus a round-up of the rest of the weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Liverpool go one better in the Champions League?</title>
			<itunes:title>Can Liverpool go one better in the Champions League?</itunes:title>
			<pubDate>Mon, 17 Sep 2018 15:43:24 GMT</pubDate>
			<itunes:duration>51:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canliverpoolgoonebetterinthechampionsleague-/media.mp3" length="74069074" type="audio/mpeg"/>
			<guid isPermaLink="false">f0f3a408-18e3-4059-9e08-732bbcb5d9f9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canliverpoolgoonebetterinthechampionsleague-</link>
			<acast:episodeId>f0f3a408-18e3-4059-9e08-732bbcb5d9f9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canliverpoolgoonebetterinthechampionsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz97McKC+PUNy2hn3nJoprJAeMLXdY7YNt1a/N5lqd4LbQUkhlvhTnUHIryz3QP/UUZBGoBASPBpr0OS51AIRVK1yF4I2bD5mS+DPS+F3YZlVgJdmAXgb7wsyKdMyim8wOeoh3BNHUBAc+L/o3YR3bppxvGqK+WebUnStN6iKg0jrzQ81K+WckVDyDEXIscbDxDQT5yqwGD+xOcUDdcKdw3xeD0NaezcIpx52M9/qOe0O1kEF/qMtNAa2Gpw7FNJUeS]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by John Cross and Dom Fifield to analyse the Premier League sides’ chances in the UEFA Champions League this season.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by John Cross and Dom Fifield to analyse the Premier League sides’ chances in the UEFA Champions League this season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by John Cross and Dom Fifield to analyse the Premier League sides’ chances in the UEFA Champions League this season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[How much work needs to be done on Southgate's England?]]></title>
			<itunes:title><![CDATA[How much work needs to be done on Southgate's England?]]></itunes:title>
			<pubDate>Mon, 10 Sep 2018 17:13:58 GMT</pubDate>
			<itunes:duration>48:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/howmuchworkneedstobedoneonsouthgatesengland-/media.mp3" length="69879882" type="audio/mpeg"/>
			<guid isPermaLink="false">0d553b56-0836-486e-bc6f-86ccec478fa2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/howmuchworkneedstobedoneonsouthgatesengland-</link>
			<acast:episodeId>0d553b56-0836-486e-bc6f-86ccec478fa2</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>howmuchworkneedstobedoneonsouthgatesengland-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9wXY0R8iI0AB237XMJb4HLfHaiSMRhALfe1mOgtnUG8YBK5C50Nzgar+xQDWRxEPAG11IOyPT4yJF1HpGyjinNEtmNJZ1b4dlqMQQ3Uad/UJfAJ/0HVlQ9FQycf473L4yGmyPAwQTX6Hu5sjp3mh6X+0SvybMTaUR329ZCpdPiNTLhoIcPqWPK7UfnuDQBbmWPx/KAprdGOsQ5hnb3lDR823CJdZeN4qVGxZPeIBXsXGVCjLjHoFaz6tLDndLaTPp]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Tony Evans and David Preece to discuss England’s first set of games following their World Cup adventure and to look ahead to the return of the Premier League.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Mike Calvin is joined by Tony Evans and David Preece to discuss England’s first set of games following their World Cup adventure and to look ahead to the return of the Premier League.</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Mike Calvin is joined by Tony Evans and David Preece to discuss England’s first set of games following their World Cup adventure and to look ahead to the return of the Premier League.</p><p><br></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is the Man City project good for English football?</title>
			<itunes:title>Is the Man City project good for English football?</itunes:title>
			<pubDate>Mon, 03 Sep 2018 14:15:42 GMT</pubDate>
			<itunes:duration>50:10</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthemancityprojectgoodforenglishfootball-/media.mp3" length="72145376" type="audio/mpeg"/>
			<guid isPermaLink="false">7be038dd-c54e-4515-885e-593288f60fa1</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthemancityprojectgoodforenglishfootball-</link>
			<acast:episodeId>7be038dd-c54e-4515-885e-593288f60fa1</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthemancityprojectgoodforenglishfootball-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9stz9e+TqmNfFfIhogyiyL2A6YcLAALQ8rDRCbcnKnU6j4KY81mZ9c9jKhQkst7MPLLDC4CnJQwkjUVFNbu6kLC/OeEI7+NS+rK2tWf3DSJ0n/8hULvfZQoP67Hmd+a1mdCvpVabLY2bUXVaxs/9okIgdiqKj15KqAAmlLwT2hwqm3auD1fhbK+Y18RtTIGYPsfEyRDeQy4W2sLcwbukhUr/ZkIJum4lCRE3tp4NcxMc4b2ZwVp37XwTH5HMWUww/]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Dave Kidd and Seb Stafford-Bloor to debate Manchester City's place in English football, ten years since their takeover. The panel also look ahead to England’s opening UEFA Nations League fixture against Spain.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Dave Kidd and Seb Stafford-Bloor to debate Manchester City's place in English football, ten years since their takeover. The panel also look ahead to England’s opening UEFA Nations League fixture against Spain.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Dave Kidd and Seb Stafford-Bloor to debate Manchester City's place in English football, ten years since their takeover. The panel also look ahead to England’s opening UEFA Nations League fixture against Spain.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Should Man United sack Jose Mourinho?</title>
			<itunes:title>Should Man United sack Jose Mourinho?</itunes:title>
			<pubDate>Tue, 28 Aug 2018 17:05:12 GMT</pubDate>
			<itunes:duration>40:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/shouldmanunitedsackjosemourinho-/media.mp3" length="57892608" type="audio/mpeg"/>
			<guid isPermaLink="false">07194b9d-d397-46db-a382-6b6257727f47</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/shouldmanunitedsackjosemourinho-</link>
			<acast:episodeId>07194b9d-d397-46db-a382-6b6257727f47</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>shouldmanunitedsackjosemourinho-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRHlnFspgweyjJcPrBOF2OdcgFwFc+n99ufrkQGlgJLZat3v3L+QS5OyUZOmnk8YaJDS3ok7eoxIyQQgAhj2AfjTf/2wSbzvEZN5yWuCRpP/KAWIfoGsydKNbKgg376EUDFmrDpDBZ6kADXQK8OWL4ZXRoD85hUg3Gcjn/QrGbhT4oE2ztcaEDx8KqclM5VcAkWHJE7+zmllnobH1Mz9WG4+VUZggeyke12IKS+ea/Qqj9oE12c7/IfjPfYQ+JRXA74nd+Wmzi6/Vhfs2i/Iqze/eJrixFwciTRJvE3bhSWO3]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and Daniel Storey question Jose Mourinho’s future at Manchester United following the 3-0 home defeat to Tottenham and round up the rest of the Premier League action.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Daniel Storey question Jose Mourinho’s future at Manchester United following the 3-0 home defeat to Tottenham and round up the rest of the Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Daniel Storey question Jose Mourinho’s future at Manchester United following the 3-0 home defeat to Tottenham and round up the rest of the Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is it time to consider the post-Mourinho era at United?</title>
			<itunes:title>Is it time to consider the post-Mourinho era at United?</itunes:title>
			<pubDate>Mon, 20 Aug 2018 15:09:34 GMT</pubDate>
			<itunes:duration>48:31</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isittimetoconsiderthepost-mourinhoeraatunited-/media.mp3" length="93052528" type="audio/mpeg"/>
			<guid isPermaLink="false">7e82f6f6-d3b0-4209-8497-a83ccaba549c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isittimetoconsiderthepost-mourinhoeraatunited-</link>
			<acast:episodeId>7e82f6f6-d3b0-4209-8497-a83ccaba549c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isittimetoconsiderthepost-mourinhoeraatunited-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9wT4kcIkleXObW8p47DFhNHSHnfpcSywjTsp/Sjb4z2stXVPAF5xavMHC9ZnFCq3w+sC9AX73my3pXj8qaYvPAfXO1YhECCu4iJ0fhmKQiF/GR5qvHEJJ4FbvFtZm37JXEDRDrybDiQEpx25pBb96mvk4nHTq8zT36v63ApdSNVAf/RB7BVIuMV+eOl3sHHu0cVSWcvSxVH1wUjAEtZRTydXYSlw2p1RtLuxmbJAf1EkbM0zWv618vGyY7jd4v3XW]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Alyson Rudd and Dom Fifield to analyse the malaise at Jose Mourinho’s Manchester United, following their 3-2 loss at Brighton.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Alyson Rudd and Dom Fifield to analyse the malaise at Jose Mourinho’s Manchester United, following their 3-2 loss at Brighton.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Alyson Rudd and Dom Fifield to analyse the malaise at Jose Mourinho’s Manchester United, following their 3-2 loss at Brighton.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Pogba makes power play as Emery suffers debut defeat</title>
			<itunes:title>Pogba makes power play as Emery suffers debut defeat</itunes:title>
			<pubDate>Mon, 13 Aug 2018 16:37:20 GMT</pubDate>
			<itunes:duration>49:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/pogbamakespowerplayasemerysuffersdebutdefeat/media.mp3" length="70569734" type="audio/mpeg"/>
			<guid isPermaLink="false">663a51ce-c3e1-46ed-a826-93c2729a2a9c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/pogbamakespowerplayasemerysuffersdebutdefeat</link>
			<acast:episodeId>663a51ce-c3e1-46ed-a826-93c2729a2a9c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>pogbamakespowerplayasemerysuffersdebutdefeat</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz98QTVnJleQBk7yTpwNXs8uquePp9mVfWG7PNNnwjuVdmZWmnrr6arrWaiVXKe6Z2SdMV5FhIDNP+imUD1Lgw+lk63dqfsnqEVNgeiZI4DQO+KlRjZsp8C6VOLmOqwAF1eZpsZ2oVs3x6DCuMOqkScg4+ZasiyZYhcNRMLhiD+aDTLcRPU9z65u2jbVcJv1qNDMc5lAILXCmw14/i6rYfYLRGVwzzSMGmjf+VrwemsLl32uz7Qdox3C66wWljd/eRw]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, John Cross and Seb Stafford-Bloor discuss the power struggle at Manchester United, Arsenal and Chelsea's conflicting fortunes under new management and the rest of the Premier League opening weekend action.&nbsp;]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Seb Stafford-Bloor discuss the power struggle at Manchester United, Arsenal and Chelsea's conflicting fortunes under new management and the rest of the Premier League opening weekend action.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Seb Stafford-Bloor discuss the power struggle at Manchester United, Arsenal and Chelsea's conflicting fortunes under new management and the rest of the Premier League opening weekend action.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>2018-19 Premier League season preview</title>
			<itunes:title>2018-19 Premier League season preview</itunes:title>
			<pubDate>Wed, 08 Aug 2018 05:00:00 GMT</pubDate>
			<itunes:duration>40:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/2018-19premierleagueseasonpreview/media.mp3" length="57664118" type="audio/mpeg"/>
			<guid isPermaLink="false">e629cef2-cd3c-43d2-bd97-9140f54f3a4f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/2018-19premierleagueseasonpreview</link>
			<acast:episodeId>e629cef2-cd3c-43d2-bd97-9140f54f3a4f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>2018-19premierleagueseasonpreview</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9LnrE17MY0QslwMc3KSQJYINTR5X3O0dd9Quy4eunL83c19xvZq/t2U/Zby+kRcKX5YUOWEIH4BwmK3Z9KsYMkUQys+qXTSqSGosYzrSnqu+s8riAKL60olrNUX99bLtxFfeOZNQA6qZTHA0ibkjsamPY28i0tUNXWp5MpiUeQ4joL4/ReniLFmF9PoHyR+ZCp2as4RCX9lBm84PfcmLTsNKGP1Lami1BbrWecrga1GjpKT/+c3L2Uzj99FyIPNH+]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and David Preece preview the new Premier League season and give their predictions for the top four, likely relegation candidates and surprise package.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and David Preece preview the new Premier League season and give their predictions for the top four, likely relegation candidates and surprise package.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and David Preece preview the new Premier League season and give their predictions for the top four, likely relegation candidates and surprise package.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Transfer window countdown: Who needs to buy?</title>
			<itunes:title>Transfer window countdown: Who needs to buy?</itunes:title>
			<pubDate>Mon, 06 Aug 2018 16:47:09 GMT</pubDate>
			<itunes:duration>38:25</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/transferwindowcountdown-whoneedstobuy-/media.mp3" length="55239620" type="audio/mpeg"/>
			<guid isPermaLink="false">baf29c6c-2728-4dcc-86c4-83af2a022a7b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/transferwindowcountdown-whoneedstobuy-</link>
			<acast:episodeId>baf29c6c-2728-4dcc-86c4-83af2a022a7b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>transferwindowcountdown-whoneedstobuy-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz96V1m+HKrK3K130+TdCvZam5QCXoa+qgaFsQCnVgE+KdGtzRViUvH3fPzrd8KzoMG1Bh1TBoFCu5PucWSOTg1IqqNWkOPPf1iURVt+FFuv0wdBz8a0oqHV9OLg3cvJMFc2y5J4Ja5wo/mUckujkZO++Y+hAG1s9lwI0f4gOaK6CEs7bpZF9K51fWXIc40s9t64prB3tzedyX3fDTTkzOUuFsmqyahanZ9tlJW9yNAuvNbYEfyMwMg1Bn34RJvvbn9]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and David Preece round up the Premier League transfer window so far and assess which teams need to invest before Thursday’s deadline.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and David Preece round up the Premier League transfer window so far and assess which teams need to invest before Thursday’s deadline.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and David Preece round up the Premier League transfer window so far and assess which teams need to invest before Thursday’s deadline.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>What do England need to do to remain contenders for Euro 2020?</title>
			<itunes:title>What do England need to do to remain contenders for Euro 2020?</itunes:title>
			<pubDate>Mon, 16 Jul 2018 15:32:43 GMT</pubDate>
			<itunes:duration>49:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatdoenglandneedtodotoremaincontendersforeuro2020-/media.mp3" length="71427980" type="audio/mpeg"/>
			<guid isPermaLink="false">4cc8c5dc-9981-40a7-a695-b0cbe51c504d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatdoenglandneedtodotoremaincontendersforeuro2020-</link>
			<acast:episodeId>4cc8c5dc-9981-40a7-a695-b0cbe51c504d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatdoenglandneedtodotoremaincontendersforeuro2020-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9HHFWV/nLICXIPshoAAx9mP/X4nrgfehDMLm06uReFq4hTSSkQOLiDzN0gxDuPM9bVMPpAoPZRT2fCEcLIvgrj93GZ9JY+SMjBJx4RlwDBJJWnZ6a9oxxQLHJ7IClZBYfgU892ZvN37v9dFckhe/Fo1bSPXEcxo0oSlkah7IiOkLzGhbxyYQF8g9zmc8eo6mnb9GxIG0qTXAKa6P/tAH49gHl4cchcCyayilzotrtsEoNJBA+3/rBHUsOqFDUbwMY]]></acast:settings>
			<itunes:subtitle>Mike Calvin, David Preece and Seb Stafford-Bloor debate where England need to improve after finishing fourth at the 2018 World Cup and pick their team of the tournament as France are crowned world champions.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, David Preece and Seb Stafford-Bloor debate where England need to improve after finishing fourth at the 2018 World Cup and pick their team of the tournament as France are crowned world champions.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, David Preece and Seb Stafford-Bloor debate where England need to improve after finishing fourth at the 2018 World Cup and pick their team of the tournament as France are crowned world champions.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>For England this is not the end, but the end of the beginning</title>
			<itunes:title>For England this is not the end, but the end of the beginning</itunes:title>
			<pubDate>Thu, 12 Jul 2018 15:30:52 GMT</pubDate>
			<itunes:duration>46:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/forenglandthisisnottheend-buttheendofthebeginning/media.mp3" length="67486684" type="audio/mpeg"/>
			<guid isPermaLink="false">3ad3087f-291f-4c60-9141-8a5fc2a041be</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/forenglandthisisnottheend-buttheendofthebeginning</link>
			<acast:episodeId>3ad3087f-291f-4c60-9141-8a5fc2a041be</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>forenglandthisisnottheend-buttheendofthebeginning</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Lvbjj6RZneBPsBKBsBGJnmrIpmsUTPrEuXdGiaFs5SUmyv8h4S9807FzI/YaWnOZuxAy6hV7E+WiTn1wvBKUBA3OZpFAxLVzc8BBptn7tlEMaXA86sN8lHIcNtMJIlofem4vEe9f/qxFz2Dc3T8vpRtz/ivWLiOVM4RaSdESHU5C7W3nO0A35nejG4zwTqAmHaev/YRT0zHXiW658+VJmtPiW88Jz1wRuy6bOOfDyVrLnYr9st8VR/36LMJe0EWg]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by&nbsp;David Preece and Daniel Storey to analyse England’s World Cup semi-final defeat to Croatia and the future for Gareth Southgate’s team. The panel also preview England’s third-place play-off against Belgium and the final...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5029.png"/>
			<description><![CDATA[Mike Calvin is joined by&nbsp;David Preece and Daniel Storey to analyse England’s World Cup semi-final defeat to Croatia and the future for Gareth Southgate’s team. The panel also preview England’s third-place play-off against Belgium and the final between France and Croatia.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by&nbsp;David Preece and Daniel Storey to analyse England’s World Cup semi-final defeat to Croatia and the future for Gareth Southgate’s team. The panel also preview England’s third-place play-off against Belgium and the final between France and Croatia.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who will reach the World Cup final?</title>
			<itunes:title>Who will reach the World Cup final?</itunes:title>
			<pubDate>Mon, 09 Jul 2018 17:39:18 GMT</pubDate>
			<itunes:duration>50:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whowillreachtheworldcupfinal-/media.mp3" length="72425198" type="audio/mpeg"/>
			<guid isPermaLink="false">c939cca4-58c3-4b46-9dfb-dc9a74b76863</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whowillreachtheworldcupfinal-</link>
			<acast:episodeId>c939cca4-58c3-4b46-9dfb-dc9a74b76863</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whowillreachtheworldcupfinal-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz91UJEo0GcE0P8J2icbSS5e/9QHAd5CZLibbIch0sk2wRodLVjmALHGg/FHPE25qCuv85ARC59LAf+C1+gC1T7vjd6s3tOknurTx6lpwRpQJkP2+Js/PwTsQozaR9aFjUpmdkIkr6PxoXvcQ5aLlhAq1+08vTLuGVQHR5uB8OmjypxOkZkRxrh8sByxAeQYXGFcy4v6gRiB5o2ksb0Mb+SbVt15aXCaB6M1zJnnvWJFBdEWhh9jq7JjdjOuYOE4YSc]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and Daniel Storey discuss England’s chances in their World Cup semi-final clash with Croatia and the Thierry Henry derby between Belgium and France.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5030.png"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Daniel Storey discuss England’s chances in their World Cup semi-final clash with Croatia and the Thierry Henry derby between Belgium and France.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Daniel Storey discuss England’s chances in their World Cup semi-final clash with Croatia and the Thierry Henry derby between Belgium and France.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Sweden up next as England eye World Cup semi-finals</title>
			<itunes:title>Sweden up next as England eye World Cup semi-finals</itunes:title>
			<pubDate>Thu, 05 Jul 2018 15:55:24 GMT</pubDate>
			<itunes:duration>45:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/swedenupnextasenglandeyeworldcupsemi-finals/media.mp3" length="65300066" type="audio/mpeg"/>
			<guid isPermaLink="false">e6b59bd8-1ae5-4372-a216-17d5b7a587e0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/swedenupnextasenglandeyeworldcupsemi-finals</link>
			<acast:episodeId>e6b59bd8-1ae5-4372-a216-17d5b7a587e0</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>swedenupnextasenglandeyeworldcupsemi-finals</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9ntmNJvS0tPJlN7d/nVm6/MFaYovD5kBhf46b3U/5gT6TCs7Yzo5YcNk4DhBU3d5PGM+dHsOrKyZPzD+9FIsqhWfYsYxnP8ug5l4hrnklhVx+yuNQ0O5ggwugEgs+6tyoo09+SAxcUyBwAcUxr2/3oFLsrWGzTpaxSc45IJUj1X4hQP4ViMmoHq8QhcJEOeOldnZC3URxhD7WRD0EYP5jrUEQU4ckoZ+/3irVd6rEN1fUp9Qgm2TPCQHOArF8nslg]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Tony Evans and Tom Hopkinson reflect on England’s overdue penalty shootout victory over Colombia and preview the World Cup quarter-finals.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5037.png"/>
			<description><![CDATA[Mike Calvin, Tony Evans and Tom Hopkinson reflect on England’s overdue penalty shootout victory over Colombia and preview the World Cup quarter-finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tony Evans and Tom Hopkinson reflect on England’s overdue penalty shootout victory over Colombia and preview the World Cup quarter-finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Colombia await as Belgium pip England to top spot</title>
			<itunes:title>Colombia await as Belgium pip England to top spot</itunes:title>
			<pubDate>Fri, 29 Jun 2018 15:41:27 GMT</pubDate>
			<itunes:duration>48:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/colombiaawaitasbelgiumpipenglandtotopspot/media.mp3" length="70035130" type="audio/mpeg"/>
			<guid isPermaLink="false">591fc316-6e9a-414d-b56d-95f03c3eb14f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/colombiaawaitasbelgiumpipenglandtotopspot</link>
			<acast:episodeId>591fc316-6e9a-414d-b56d-95f03c3eb14f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>colombiaawaitasbelgiumpipenglandtotopspot</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9YrbUeeMDipU5E8QUCc1ldEU4nKlzq1jzHxtklz9zbRdHHuBw2GPkCfTvDFbe+Mg1p8Pa0I8/yJ3MNlId7J4TkEmQwSV2vDOeriJmFJuoLKo48pSwmTyuSy3LzLl6E7i87Pkvq9Jj4aRUtbx568bMO/WHDCZhvhd4LzLHkb/UZ62YiXLIMTnzZQHyMgS8HmCmuu4ELnuOzbTwwAsFMTEn8bZXvLtLeAwhcugobfhN79dp6H+OZAmMhxaWZr8t9BUK]]></acast:settings>
			<itunes:subtitle>Mike Calvin, David Preece and Seb Stafford-Bloor dissect England’s 1-0 defeat to Belgium and preview the World Cup round-of-16 ties.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e503e.png"/>
			<description><![CDATA[Mike Calvin, David Preece and Seb Stafford-Bloor dissect England’s 1-0 defeat to Belgium and preview the World Cup round-of-16 ties.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, David Preece and Seb Stafford-Bloor dissect England’s 1-0 defeat to Belgium and preview the World Cup round-of-16 ties.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>England 6-1 Panama: Is football coming home?</title>
			<itunes:title>England 6-1 Panama: Is football coming home?</itunes:title>
			<pubDate>Mon, 25 Jun 2018 14:52:22 GMT</pubDate>
			<itunes:duration>48:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/england6-1panama-isfootballcominghome-/media.mp3" length="69250126" type="audio/mpeg"/>
			<guid isPermaLink="false">891f0036-05b5-4127-9099-eb1014b31a45</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/england6-1panama-isfootballcominghome-</link>
			<acast:episodeId>891f0036-05b5-4127-9099-eb1014b31a45</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>england6-1panama-isfootballcominghome-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9Q5H/YlrKXz1lGmphKO5Us2tWoxjw3wsG3JB8drU5uNc05b1rMLod31QeA+D2QqpSY6TgGkrhBLILxLH9N/CYsHubBPsAJXucf6G886KrDPq9mOQTNLX2wZRCMK1sS473Urg9Xi5tFlcEP7ALxbf5dBunzNW6O/uxy/ZSOjoPB/RA3+Dm1OuobkvnEKuo5/I3BE4JlyMncnqeBftYZIH2HNQviO2NH2aA63bKlBf11Qqm4Bo1RuxG0LThOBzOJbk4]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and Tony Evans reflect on England’s 6-1 demolition of Panama and analyse the rest of the World Cup action.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5045.png"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Tony Evans reflect on England’s 6-1 demolition of Panama and analyse the rest of the World Cup action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Tony Evans reflect on England’s 6-1 demolition of Panama and analyse the rest of the World Cup action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>This week at the World Cup</title>
			<itunes:title>This week at the World Cup</itunes:title>
			<pubDate>Tue, 19 Jun 2018 15:20:47 GMT</pubDate>
			<itunes:duration>49:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/tunisia1-2englandreview/media.mp3" length="71443630" type="audio/mpeg"/>
			<guid isPermaLink="false">54c72766-5009-4e1f-9125-2ff0fde44cc8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/tunisia1-2englandreview</link>
			<acast:episodeId>54c72766-5009-4e1f-9125-2ff0fde44cc8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>tunisia1-2englandreview</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9EM9tC/TQzX99jVlnngl52WKP0DUFz6wgJvkUcyKT/J80pvfmjXpQ13O9ngNL59XYVZMb1k0Gusw72neBo0sX7LtnIYmLfwRYnwp+TTN93Sv3wN5/chCW36/KUiE5WUM/fsdRiqCZSz7HYrgApqXCBhETH982gnHYV7Gd5ZcDHwaOdIJR4jj4uuQLx8tvGAbp/aNW8URY7q1xLFqi6x2TvSuYZhOLKbIn+e6WVAQF/yirN2DKyfsPELyeq/LIw6fO]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Daniel Storey and Tom Hopkinson to analyse England’s 2-1 victory over Tunisia in their World Cup opener.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e504c.png"/>
			<description><![CDATA[Mike Calvin is joined by Daniel Storey and Tom Hopkinson to analyse England’s 2-1 victory over Tunisia in their World Cup opener.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Daniel Storey and Tom Hopkinson to analyse England’s 2-1 victory over Tunisia in their World Cup opener.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>World Cup group-by-group preview</title>
			<itunes:title>World Cup group-by-group preview</itunes:title>
			<pubDate>Mon, 11 Jun 2018 05:00:00 GMT</pubDate>
			<itunes:duration>34:48</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/worldcupgroup-by-grouppreview/media.mp3" length="50058844" type="audio/mpeg"/>
			<guid isPermaLink="false">7c7137c0-c623-475a-95bd-be1bf90c6d99</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/worldcupgroup-by-grouppreview</link>
			<acast:episodeId>7c7137c0-c623-475a-95bd-be1bf90c6d99</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>worldcupgroup-by-grouppreview</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9yFVO3ySK/yIP6GweOrb64bDj9ZXgWU0AP1698H/76lpgR3RxyAqlIUavGLcRxRmDp+mU58QxIPu9W68IdJTxaEjNlb5GyvQo5jqRJCSvXU6vxyh8nQ/VzF4tDIGEFIGcYcezW9ewBOuwlR52cWremTzZElRxVhQy9wIaTuPxXuT3Q8vefuiWypo2c2uHFQYxAgIarhtaPN4Dbk9iXtr+xprVVv4RmdNntWoaIYe3iFjgjRIpMuoJpkG0ORHkI+ZH]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Jonathan Northcroft and David Preece break down every single World Cup group, picking out their favourites, underdogs and over-rated nations ahead of the big kick-off in Russia.&nbsp;&nbsp;]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5053.png"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and David Preece break down every single World Cup group, picking out their favourites, underdogs and over-rated nations ahead of the big kick-off in Russia.&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and David Preece break down every single World Cup group, picking out their favourites, underdogs and over-rated nations ahead of the big kick-off in Russia.&nbsp;&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>What should we expect from England at the World Cup?</title>
			<itunes:title>What should we expect from England at the World Cup?</itunes:title>
			<pubDate>Mon, 04 Jun 2018 18:19:03 GMT</pubDate>
			<itunes:duration>32:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatshouldweexpectfromenglandattheworldcup-/media.mp3" length="46240870" type="audio/mpeg"/>
			<guid isPermaLink="false">aac81bf2-c850-4da3-905f-8e1238b0766a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatshouldweexpectfromenglandattheworldcup-</link>
			<acast:episodeId>aac81bf2-c850-4da3-905f-8e1238b0766a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatshouldweexpectfromenglandattheworldcup-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9m91juTN1Gc8kHEWcbyBrbXYsaCAcCcuej4g/LCnW8hyIRZ1GAEOquqUmJmWAKS6x+JVbnA7QjluNlg2wBQrMlbm2fsTmdt/+uwAzmdxNctHNFS/Z0w0daGlFRtG7EDaEKrAByUhiEGs7wQNfHphXYPSfcC+QXke6/1Iad4Jy21iLS2TSyl28NGn6UDSV0nFDs+dwZJL3pyRG4V82zZdGzOihxe4KfhsrYR8aXJCXNokMOpownb9mf5jw0jBM/aI0]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and David Preece give their thoughts on Gareth Southgate and his 23-man England squad ahead of the 2018 World Cup in Russia.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e505a.png"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and David Preece give their thoughts on Gareth Southgate and his 23-man England squad ahead of the 2018 World Cup in Russia.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and David Preece give their thoughts on Gareth Southgate and his 23-man England squad ahead of the 2018 World Cup in Russia.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Kiev catastrophe for Karius as Bale brilliance downs Liverpool</title>
			<itunes:title>Kiev catastrophe for Karius as Bale brilliance downs Liverpool</itunes:title>
			<pubDate>Tue, 29 May 2018 15:49:33 GMT</pubDate>
			<itunes:duration>57:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/kievcatastropheforkariusasbalebrilliancedownsliverpool/media.mp3" length="82155742" type="audio/mpeg"/>
			<guid isPermaLink="false">05f2276b-542a-4764-9670-dde6664f2e61</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/kievcatastropheforkariusasbalebrilliancedownsliverpool</link>
			<acast:episodeId>05f2276b-542a-4764-9670-dde6664f2e61</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>kievcatastropheforkariusasbalebrilliancedownsliverpool</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREvNF9VAeZnWV/6vle0ljw5N9ry7jUN09HmCTCe3hahkTiDff5JRgAmh5SeNol/dHBBRHvPu9QWiLa5QFpOEmIMs3aurkPA1pbO+h7xqUUvmnvULi3WyY3i0fU58/DsQ2TJWLwbB0JJ6xUeugdJvCsYGOvExd0D2M3djJry+WDRChdxkexGBHAvfWV0MLJ43w/dTub5o3pIkAsIq/xuCjWcMDGj6h5na4MypPyp6I+sCF1mcvcKlkZaLfjXv9s3E4KCWYHXrGhb7RPMZg8W9HK9RYILtFBDbLzBxYIMAB9c1]]></acast:settings>
			<itunes:subtitle>Mike Calvin, John Cross and Alyson Rudd review the Champions League final between Liverpool and Real Madrid, give their thoughts on the Raheem Sterling tattoo story and answer your questions.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Alyson Rudd review the Champions League final between Liverpool and Real Madrid, give their thoughts on the Raheem Sterling tattoo story and answer your questions.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Alyson Rudd review the Champions League final between Liverpool and Real Madrid, give their thoughts on the Raheem Sterling tattoo story and answer your questions.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Champions League final special</title>
			<itunes:title>Champions League final special</itunes:title>
			<pubDate>Mon, 21 May 2018 16:00:00 GMT</pubDate>
			<itunes:duration>46:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/championsleaguefinalspecial/media.mp3" length="67121100" type="audio/mpeg"/>
			<guid isPermaLink="false">aa73e91e-c4b8-4714-b0e5-1e8924f58f2c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/championsleaguefinalspecial</link>
			<acast:episodeId>aa73e91e-c4b8-4714-b0e5-1e8924f58f2c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>championsleaguefinalspecial</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRMaloe/fYy1BNnt1383HPARwBUn43CUrPfMLSOGV2yW3AK1hRQXRQ/dflql+mNCIulsTEn4y1ESn+EuMnkcGcsLi/WKg8hmQktzYRHcHNKzrvsnRZ/mjI65aZJCPyOjVkpXFDd74tVKeP+3ZrXO0VtbLCMh5/eYJ9OQEdjNgHR7roT/wP7DG5dWbIvD3+X8zhIWN2K2MWU2yFwz74mRgQsXRmVlK1tQFMok8VcWQxFJJoyB9jbT66y1Vb/DR0ZjMaALRpYah7KI9Zi2THDQljYg+o1/LdFqUgLVHrn9Lm3E0]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Jonathan Northcroft and Tony Evans to preview this Saturday’s UEFA Champions League final between Real Madrid and Liverpool. BT Sport is the only place to watch the game, with coverage starting from 6pm on BT Sport 2 and 4K UHD...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[<p>Mike Calvin is joined by Jonathan Northcroft and Tony Evans to preview this Saturday’s UEFA Champions League final between Real Madrid and Liverpool. BT Sport is the only place to watch the game, with coverage starting from 6pm on BT Sport 2 and 4K UHD.</p><p>&nbsp;</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Mike Calvin is joined by Jonathan Northcroft and Tony Evans to preview this Saturday’s UEFA Champions League final between Real Madrid and Liverpool. BT Sport is the only place to watch the game, with coverage starting from 6pm on BT Sport 2 and 4K UHD.</p><p>&nbsp;</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Mourinho vs. Conte: Who will salvage their season with FA Cup glory?</title>
			<itunes:title>Mourinho vs. Conte: Who will salvage their season with FA Cup glory?</itunes:title>
			<pubDate>Mon, 14 May 2018 16:03:10 GMT</pubDate>
			<itunes:duration>48:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mourinhovs.conte-whowillsalvagetheirseasonwithfacupglory-/media.mp3" length="70336236" type="audio/mpeg"/>
			<guid isPermaLink="false">1b49db4a-1cb7-4ecb-b4ce-03f5742dfb88</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mourinhovs.conte-whowillsalvagetheirseasonwithfacupglory-</link>
			<acast:episodeId>1b49db4a-1cb7-4ecb-b4ce-03f5742dfb88</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mourinhovs.conte-whowillsalvagetheirseasonwithfacupglory-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9wFcVgUKT19ZIiERLz0VkIDx74SSTVO/A51U8+OxEpnf+5LQecv0Y3QY2vvE9aQ2DIFQPC18gsqFGbK0/AGggZSRUz1nuTrRZeGdqzMSn39QeAWI5V3igz28nBw4HRhQllkY/R2PZW3vMSuz3xvsIOzhBOiuSRKr1F6OQrnSaPycAr9U6ImlNLGhKZzH9JGTIHVQGVknVGccYorc8EP2Vb53wB36n0o106aNSw0zDkhnxc3oodgDrHmtUqkuCAm/k]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Darren Lewis and Adrian Clarke discuss Manchester United and Chelsea’s seasons ahead of the FA Cup final, Gareth Southgate’s England squad selection for the World Cup and the upcoming Premier League managerial merry-go-round.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Adrian Clarke discuss Manchester United and Chelsea’s seasons ahead of the FA Cup final, Gareth Southgate’s England squad selection for the World Cup and the upcoming Premier League managerial merry-go-round.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Adrian Clarke discuss Manchester United and Chelsea’s seasons ahead of the FA Cup final, Gareth Southgate’s England squad selection for the World Cup and the upcoming Premier League managerial merry-go-round.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who should be named Manager of the Season?</title>
			<itunes:title>Who should be named Manager of the Season?</itunes:title>
			<pubDate>Tue, 08 May 2018 14:25:45 GMT</pubDate>
			<itunes:duration>43:18</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whoshouldbenamedmanageroftheseason-/media.mp3" length="72404540" type="audio/mpeg"/>
			<guid isPermaLink="false">52f93424-e840-413f-8b17-c3dc1478c747</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whoshouldbenamedmanageroftheseason-</link>
			<acast:episodeId>52f93424-e840-413f-8b17-c3dc1478c747</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whoshouldbenamedmanageroftheseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRO2Dn4X29xM7K4qr4mZAV8NtaQNFyODCOx7KjJ7ZxB/ToH+/0RYv1uFRuKYQrsDSxzqqsWq0NdFUCiLnIdSKqsDnLhKcs7WWOVlPYTwNaKYj5QV19isurvg4zyu/Su2xutUv28TIBm/S+NeQiG5UX6dxOQv5ZCZQoZfEGdWf19TAtHfVGcnnNIAO2sa0ypUHTOklULAAeVwh3toBdQ1UelMEvBJ+fdWbgyCdmdk3W0aB/5aUH0CVV1LJj9qdEra6J+vWI5KbPIoq1rO7ALxOC1gGL85wsLt49+HCPScxhUt7]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Tom Hopkinson and Dom Fifield debate which managers have most impressed this season and discuss the evolution of Premier League management.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Tom Hopkinson and Dom Fifield debate which managers have most impressed this season and discuss the evolution of Premier League management.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tom Hopkinson and Dom Fifield debate which managers have most impressed this season and discuss the evolution of Premier League management.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Liverpool target the Italian job as Saints step up survival bid</title>
			<itunes:title>Liverpool target the Italian job as Saints step up survival bid</itunes:title>
			<pubDate>Mon, 30 Apr 2018 16:06:36 GMT</pubDate>
			<itunes:duration>47:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/liverpooltargettheitalianjobassaintsstepupsurvivalbid/media.mp3" length="68615988" type="audio/mpeg"/>
			<guid isPermaLink="false">c0b7e2d1-9c24-4093-93f2-a5d3a8fc9e95</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/liverpooltargettheitalianjobassaintsstepupsurvivalbid</link>
			<acast:episodeId>c0b7e2d1-9c24-4093-93f2-a5d3a8fc9e95</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>liverpooltargettheitalianjobassaintsstepupsurvivalbid</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRAzLcPiFMS+C52TL3EWIQMN1uBPkkQ4yBjIG9N7vgk3E3/GFrAYu7IfP8B8iNrPkzlmK8xXEIdd89AlUqHVwOZx1YbJ9ZNZlLg06w8VxhhOveTH0/x677G+ZXyknPvpgbLXppo2wqyP+LB/zlj3nw8Nv0I42NgnRBIcRUzTldPlarH/X1swaqltTly9qRxT5SEzMCYdiSSNX5qWv8B9C3/ttwMmTRF1G9/QPflD60HWN503QuRIsy1+QjOSVR1Iz9gHUlYCmogErH8Z7f5mJ3bZRlGUTj8w4GZ2qPlzUJNx8]]></acast:settings>
			<itunes:subtitle>Mike Calvin, David Preece and Daniel Storey preview Liverpool’s Champions League semi-final second leg with Roma, exclusively live on BT Sport and review the weekend’s Premier League action as the relegation battle intensifies.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, David Preece and Daniel Storey preview Liverpool’s Champions League semi-final second leg with Roma, exclusively live on BT Sport and review the weekend’s Premier League action as the relegation battle intensifies.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, David Preece and Daniel Storey preview Liverpool’s Champions League semi-final second leg with Roma, exclusively live on BT Sport and review the weekend’s Premier League action as the relegation battle intensifies.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who should replace Arsene Wenger as Arsenal manager?</title>
			<itunes:title>Who should replace Arsene Wenger as Arsenal manager?</itunes:title>
			<pubDate>Mon, 23 Apr 2018 14:57:54 GMT</pubDate>
			<itunes:duration>49:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whoshouldreplacearsenewengerasarsenalmanager-/media.mp3" length="71843018" type="audio/mpeg"/>
			<guid isPermaLink="false">3fb11aeb-7dfe-4f21-a5b2-7baeb9a37fcf</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whoshouldreplacearsenewengerasarsenalmanager-</link>
			<acast:episodeId>3fb11aeb-7dfe-4f21-a5b2-7baeb9a37fcf</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whoshouldreplacearsenewengerasarsenalmanager-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRCCyP+dFtmMzbQo4v5qHxpulQLGabA+HD1wg/I18un6ZqzpUIeekcG7RZYBCBaqP4kt178x5VNX2fXyGwkJu1H6Vn0zXKeHLAMkUr1yDRB/j6F5+x04hjmUwfO5wxu7q/rJq4WqDilLyLODTkjWiwwEWLk7Z08dsj7ouCsYvId3KPPQ7yoJfgtYSKVRmXmn/nToE24iGSCDB0RMrkWjEl5tTImYfusOeH0iRqNgD+PjZnYMomnw//EP8GNdIi16jkf4hJ3H2gqzdx8IjwDd5z/iELlx2OkGJTdQuRs5kV3cb]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Darren Lewis and Dave Kidd reflect on the PFA awards, debate who should replace Arsene Wenger at Arsenal and look ahead to the Champions League semi-finals, exclusively live on BT Sport.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Dave Kidd reflect on the PFA awards, debate who should replace Arsene Wenger at Arsenal and look ahead to the Champions League semi-finals, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Dave Kidd reflect on the PFA awards, debate who should replace Arsene Wenger at Arsenal and look ahead to the Champions League semi-finals, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Man City worthy champions as Burnley close the gap on Arsenal</title>
			<itunes:title>Man City worthy champions as Burnley close the gap on Arsenal</itunes:title>
			<pubDate>Mon, 16 Apr 2018 16:35:08 GMT</pubDate>
			<itunes:duration>46:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mancityworthychampionsasburnleyclosethegaponarsenal/media.mp3" length="66516384" type="audio/mpeg"/>
			<guid isPermaLink="false">577f488c-8732-472e-9c50-102da86bd421</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mancityworthychampionsasburnleyclosethegaponarsenal</link>
			<acast:episodeId>577f488c-8732-472e-9c50-102da86bd421</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mancityworthychampionsasburnleyclosethegaponarsenal</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRDUTQ4DAExKilBYefvTypTXjSV9mJXJG/IEEP6+mwOOPcN6cJzhpRBYhNl7S+paTO6YQVkoOc0drZ/35n/wDSAPIYq6DOkiNaJCn+Zo0Oy71RHeCjXb0kFN/gtQRs6l8Dz2+1jVec8B/OFInLpwLnmEYa2MojKpybgl1lUVJza0PsgwcQkw+BUJuXR3XbFXACbFX1gLP0HRdEANMPC/ov4Sd1MQp8Z3oMS4kP5F4zvN3t8ouHwzzQ1tryLof1xrXL4O2Ut26Ln9sP+9AmLJZVMh5HpCPpNfzVz4jkfxuqKBl]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and Tony Evans hail Pep Guardiola’s magnificent Man City side and debate whether anyone can catch them next year. Plus the pod give their thoughts on the manager of the season and preview the FA Cup semi-finals.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Tony Evans hail Pep Guardiola’s magnificent Man City side and debate whether anyone can catch them next year. Plus the pod give their thoughts on the manager of the season and preview the FA Cup semi-finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Tony Evans hail Pep Guardiola’s magnificent Man City side and debate whether anyone can catch them next year. Plus the pod give their thoughts on the manager of the season and preview the FA Cup semi-finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are City set for another nightmare week?</title>
			<itunes:title>Are City set for another nightmare week?</itunes:title>
			<pubDate>Mon, 09 Apr 2018 14:37:08 GMT</pubDate>
			<itunes:duration>49:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/arecitysetforanothernightmareweek-/media.mp3" length="70462062" type="audio/mpeg"/>
			<guid isPermaLink="false">15590c7b-2eec-467d-acc8-2f678ca78b6b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/arecitysetforanothernightmareweek-</link>
			<acast:episodeId>15590c7b-2eec-467d-acc8-2f678ca78b6b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>arecitysetforanothernightmareweek-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9mTZL60yHASSXfDdMcMsbIkYQSHqUY6Zz2EGBj9mjguuVSAEQtq5c2No5aQKfWN2EPoEeEuJnHSZYmPrlWYhCuNlXLE92ycMz3+YAvZyf50bMoIyreA6nMwA4y7G8sgCq2RUnxTrPWAcBsDDIlssVJSBASCoErKeWQxo4HBwXfhAROIBRZCeg2UHaPo502SUnxQbAHHnJIgjFuNP7Lv+xom6wvhx5dMu4l9NPlj6TzrIv2zHDteuP+2XYuommfEWl]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by John Cross and Adrian Clarke to analyse another crucial week for Manchester City as they look to complete an improbable comeback against Liverpool to qualify for the UEFA Champions League semi-finals. The panel also debate the ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by John Cross and Adrian Clarke to analyse another crucial week for Manchester City as they look to complete an improbable comeback against Liverpool to qualify for the UEFA Champions League semi-finals. The panel also debate the display of Manchester United in denying their city rivals an early Premier League title party and look at Arsenal’s European chances.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by John Cross and Adrian Clarke to analyse another crucial week for Manchester City as they look to complete an improbable comeback against Liverpool to qualify for the UEFA Champions League semi-finals. The panel also debate the display of Manchester United in denying their city rivals an early Premier League title party and look at Arsenal’s European chances.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Liverpool and Man United stop treble-chasing City?</title>
			<itunes:title>Can Liverpool and Man United stop treble-chasing City?</itunes:title>
			<pubDate>Tue, 03 Apr 2018 15:20:56 GMT</pubDate>
			<itunes:duration>48:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canliverpoolandmanunitedstoptreble-chasingcity-/media.mp3" length="70070812" type="audio/mpeg"/>
			<guid isPermaLink="false">89577897-f05c-4d7e-bee3-599b51e1f15b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canliverpoolandmanunitedstoptreble-chasingcity-</link>
			<acast:episodeId>89577897-f05c-4d7e-bee3-599b51e1f15b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canliverpoolandmanunitedstoptreble-chasingcity-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRKh1LfLUf350kAabyHJRNuCVyfW3rP4Me92+eUBpZUjd79H3zep9o9HOw662TZsn9JQ53FFNnM5F1LRhZu9W3IX6KS/2V3qcK85kEBh4XvHtZWRo16XGhn64Oow/6S0NtxBLj0IAIQCWWUh+M8bFTGdsZtB1sZL0oqiKebxDz3xR5AnnFL7GkLW4g8HtLDoshmIPSMZWo7wmH2u/faLjDFYR4WQ8WQwV9Rx6e74tYa/OJt7fuuwT0UDkZZbsx8MSxFurEc6D8qdVLFaPSYX6wmDO6Gb4epP47fY9LqyDVqDl]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Dom Fifield and Seb Stafford-Bloor preview the mouth-watering Champions League clash between Liverpool and Man City which is live on BT Sport, plus a look at Arsenal’s Europa League clash, Tottenham’s win over Chelsea and the battle at the...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dom Fifield and Seb Stafford-Bloor preview the mouth-watering Champions League clash between Liverpool and Man City which is live on BT Sport, plus a look at Arsenal’s Europa League clash, Tottenham’s win over Chelsea and the battle at the bottom of the Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dom Fifield and Seb Stafford-Bloor preview the mouth-watering Champions League clash between Liverpool and Man City which is live on BT Sport, plus a look at Arsenal’s Europa League clash, Tottenham’s win over Chelsea and the battle at the bottom of the Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who will be relegated from the Premier League?</title>
			<itunes:title>Who will be relegated from the Premier League?</itunes:title>
			<pubDate>Mon, 26 Mar 2018 15:40:40 GMT</pubDate>
			<itunes:duration>47:46</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whowillberelegatedfromthepremierleague-/media.mp3" length="68704254" type="audio/mpeg"/>
			<guid isPermaLink="false">2ea978fe-197b-4a26-8d51-5458ca7c5da5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whowillberelegatedfromthepremierleague-</link>
			<acast:episodeId>2ea978fe-197b-4a26-8d51-5458ca7c5da5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whowillberelegatedfromthepremierleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROy6QwelDxkkuNhMMslABTpRBT/G/97KCJ/Gi1IxkaC3jNM2RkTHSkONC1JwicxTiHvUznpw4cQ6i2j076M7Iq9mMXbGK66NnFLIAscejGiVwzA9IpU15qQ/ZPCHLvTLkYFiwTng08kowReBHnhXUuHsMuThbfN5vSRZkzswRRH3bsq229lIjBRE+vpzGnU/SDJYrOoHG1veM7JGnzuzDIhDSvBwrtqv+gkQ/GpT0KOTOxuV1zqPWXCRVGnOw+8Jx/lZIA9nT5fBtfrPyRuTEx8Y1nuuo78MFgxqsf0x9vcO]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Dave Kidd and David Preece assess the survival chances of the Premier League’s bottom half clubs, discuss Jose Mourinho’s future at Man United and give their verdict on Gareth Southgate’s England tenure to date.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dave Kidd and David Preece assess the survival chances of the Premier League’s bottom half clubs, discuss Jose Mourinho’s future at Man United and give their verdict on Gareth Southgate’s England tenure to date.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dave Kidd and David Preece assess the survival chances of the Premier League’s bottom half clubs, discuss Jose Mourinho’s future at Man United and give their verdict on Gareth Southgate’s England tenure to date.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has Jose Mourinho lost his mojo?</title>
			<itunes:title>Has Jose Mourinho lost his mojo?</itunes:title>
			<pubDate>Mon, 19 Mar 2018 18:08:57 GMT</pubDate>
			<itunes:duration>44:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hasjosemourinholosthismojo-/media.mp3" length="85077443" type="audio/mpeg"/>
			<guid isPermaLink="false">707caffb-a889-411d-a3bb-4e82c4fb5390</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hasjosemourinholosthismojo-</link>
			<acast:episodeId>707caffb-a889-411d-a3bb-4e82c4fb5390</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hasjosemourinholosthismojo-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPteK8huyoQLlgSAZSkLQnv6TjlKahswhLUTf6aAEIYBuPtHRCfWX4ouDgkTj4FbVmmQz7X2n2fJIc4VGDGOeQpFjLUPXGBalYu/Qil2a7vebvxuaXl7pcj5FthldZgpc2aUlHypld9CydZpW2CFOWG0sXsk8zrRi+7mH/BFMk0XQNfkPGZJxEh23JB/9t92tEuFa9eBxvhvfucMlbiDK/srkrzZ3et+13DRksdXHRBDjFZODXd29QdFT0XovFClEaZzRIjJNuFBUrkl1Xfjn+sidpBglfU9/K+jL4Im7l7X]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Tony Evans and Alyson Rudd dissect Jose Mourinho’s recent behaviour, debate whether Mo Salah should be named the PFA Player of the Year and give their thoughts on Gareth Southgate’s England squad for the upcoming friendlies with Italy and ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e50a7.jpg"/>
			<description><![CDATA[Mike Calvin, Tony Evans and Alyson Rudd dissect Jose Mourinho’s recent behaviour, debate whether Mo Salah should be named the PFA Player of the Year and give their thoughts on Gareth Southgate’s England squad for the upcoming friendlies with Italy and the Netherlands.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tony Evans and Alyson Rudd dissect Jose Mourinho’s recent behaviour, debate whether Mo Salah should be named the PFA Player of the Year and give their thoughts on Gareth Southgate’s England squad for the upcoming friendlies with Italy and the Netherlands.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Pogba isn’t a footballer, he’s a content creator for social media</title>
			<itunes:title>Pogba isn’t a footballer, he’s a content creator for social media</itunes:title>
			<pubDate>Mon, 12 Mar 2018 16:36:51 GMT</pubDate>
			<itunes:duration>50:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/pogbaisn-tafootballer-he-sacontentcreatorforsocialmedia/media.mp3" length="84964989" type="audio/mpeg"/>
			<guid isPermaLink="false">cf267fee-b063-4692-a94e-4e19648fe38a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/pogbaisn-tafootballer-he-sacontentcreatorforsocialmedia</link>
			<acast:episodeId>cf267fee-b063-4692-a94e-4e19648fe38a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>pogbaisn-tafootballer-he-sacontentcreatorforsocialmedia</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9TICTekemYLqO2ifLq3qZYtrf+XASplaohRKZwn8QUQRI/rWjOhuHK0f5skrFqr8kOBSqXCm46rOyudH4jED7TlZ9rTk9P9QxmMbCDyvRy1S0Je6P7q4eyiT3AnvLfzRbfJs+WN3X5rFXYPHLH7iPCr/otGrrR4Sfj4gpGlluBXIBRHKLPWqH+O78Kvq0f9uZpbeodZoYi1pRYD0i9Qb/GdMDY1Hete8WzKJEbDI/Y7CfjIzx0lbmhAAyYcuhmmNq]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Jonathan Northcroft and Darren Lewis to preview Manchester United and Chelsea’s Champions League round of 16 games and the weekend’s FA Cup quarter-final action.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e50ae.jpg"/>
			<description><![CDATA[Mike Calvin is joined by Jonathan Northcroft and Darren Lewis to preview Manchester United and Chelsea’s Champions League round of 16 games and the weekend’s FA Cup quarter-final action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Jonathan Northcroft and Darren Lewis to preview Manchester United and Chelsea’s Champions League round of 16 games and the weekend’s FA Cup quarter-final action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Should Wenger take the blame for Arsenal’s failures?</title>
			<itunes:title>Should Wenger take the blame for Arsenal’s failures?</itunes:title>
			<pubDate>Mon, 05 Mar 2018 15:49:16 GMT</pubDate>
			<itunes:duration>48:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/shouldwengertaketheblameforarsenal-sfailures-/media.mp3" length="70380056" type="audio/mpeg"/>
			<guid isPermaLink="false">77caa5ca-faa7-4235-be3a-ffbede9a26e7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/shouldwengertaketheblameforarsenal-sfailures-</link>
			<acast:episodeId>77caa5ca-faa7-4235-be3a-ffbede9a26e7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>shouldwengertaketheblameforarsenal-sfailures-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROVq0pnx/P6iblLEeeoMSzdhup5Dvwj4am2oc9fHE9NLFMgpTnuAo2k7dONfrKnB0ohiRzrSzW4AXJAIcd+kPtxikAus3flBV7DGseeH3uO5h+FAELynmC8pA8XLhm8Ha930kF/iqnPeWNKn9wofrUwltZMwFxSrwCaOir4SL0l8UNP1scpdm7UtW27IMCpjCMFCXQG/e/MK4yGeGkrD63oKCLODJYNqH6yqkklqZfLMjPE01FAk3/Ye2tCfLzwIH9hCuM1l8k8XGoGPr43Zkj4EigrmDH/gku7vOSJUPlbE]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Tom Hopkinson and Daniel Storey to debate the dire situation at Arsenal and the future of their beleaguered manager, Arsene Wenger.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Tom Hopkinson and Daniel Storey to debate the dire situation at Arsenal and the future of their beleaguered manager, Arsene Wenger.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Tom Hopkinson and Daniel Storey to debate the dire situation at Arsenal and the future of their beleaguered manager, Arsene Wenger.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>No way back for Wenger as Man City humiliate Arsenal at Wembley</title>
			<itunes:title>No way back for Wenger as Man City humiliate Arsenal at Wembley</itunes:title>
			<pubDate>Mon, 26 Feb 2018 17:08:30 GMT</pubDate>
			<itunes:duration>48:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/nowaybackforwengerasmancityhumiliatearsenalatwembley/media.mp3" length="70390072" type="audio/mpeg"/>
			<guid isPermaLink="false">5aaacc50-772f-4b81-a4d6-0909e247835f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/nowaybackforwengerasmancityhumiliatearsenalatwembley</link>
			<acast:episodeId>5aaacc50-772f-4b81-a4d6-0909e247835f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>nowaybackforwengerasmancityhumiliatearsenalatwembley</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRN+0QjsHFsCM6IA3mv8J3fjXnk6yC4dCTdOGHh9flTcSKBkV1a6NvV3NGq6MDOUfeJJpM76B5MunheMqOZm9eGm/2CW9vj0qQa3gsrcAR+IUVEF/JlQrJnxMSI+TkxQo4LqAfYMc++XwskGUNxxWm5tSWw+WZYKTY7pLWzSFVLbNamYOREpse9eyCMmrB/aI4Ec8U8Xs/g7c8bDQYfWBOVVrOnGh2Os4In9oHMEbqHYXJrN4DdqwlOehl66f7IPBaKYP3yGwhlDB0sR9L6PktgKSx2ycoOUNdqADGSffHHfm]]></acast:settings>
			<itunes:subtitle>Mike Calvin, John Cross and Dom Fifield debate Arsene Wenger’s future after Arsenal’s embarrassing League Cup final defeat to Man City and look at the key stories at both ends of the Premier League table as Man United beat Chelsea while West Brom slip ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Dom Fifield debate Arsene Wenger’s future after Arsenal’s embarrassing League Cup final defeat to Man City and look at the key stories at both ends of the Premier League table as Man United beat Chelsea while West Brom slip seven points from safety.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Dom Fifield debate Arsene Wenger’s future after Arsenal’s embarrassing League Cup final defeat to Man City and look at the key stories at both ends of the Premier League table as Man United beat Chelsea while West Brom slip seven points from safety.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Chelsea and Man Utd maintain English standards in Europe?</title>
			<itunes:title>Can Chelsea and Man Utd maintain English standards in Europe?</itunes:title>
			<pubDate>Mon, 19 Feb 2018 16:50:03 GMT</pubDate>
			<itunes:duration>48:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canchelseaandmanutdmaintainenglishstandardsineurope-/media.mp3" length="69361554" type="audio/mpeg"/>
			<guid isPermaLink="false">3845c734-3e81-4f73-acbf-4a889892fef4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canchelseaandmanutdmaintainenglishstandardsineurope-</link>
			<acast:episodeId>3845c734-3e81-4f73-acbf-4a889892fef4</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canchelseaandmanutdmaintainenglishstandardsineurope-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRIVyeZeNbrL3w5/Vu7JcvMWyl8weU0v3CFzbyQlglNGltcgjV7S+BnO3ziUZZfa80Ilaym1CbaHnN6eAIOTT8X+9TqCtEgb7BGR1948ZIIvk5SBnTm8NYN0sDDFEVQyTLeCl+F36ABGtBEIGvZes6Q6iTi/IOYa5yVibL5zn8Qe0diPkFGQE2tOsVZKysUAoGgwnlM0qwpqa3fY2CUPz66ZMD+esMqdgA3hh/OYG6yg8GtmLtm+TmV7QLR1x1CmiJEl9XhO0BuvcdXAgjw7rpv9M2asMse2w0e77Z2VOeKFU]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and Seb Stafford-Bloor round up the FA Cup fifth round action, debate West Brom’s survival hopes and look ahead to the Chelsea v Barcelona and Sevilla v Manchester United ties, exclusively live on BT Sport.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford-Bloor round up the FA Cup fifth round action, debate West Brom’s survival hopes and look ahead to the Chelsea v Barcelona and Sevilla v Manchester United ties, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Seb Stafford-Bloor round up the FA Cup fifth round action, debate West Brom’s survival hopes and look ahead to the Chelsea v Barcelona and Sevilla v Manchester United ties, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Champions League special</title>
			<itunes:title>Champions League special</itunes:title>
			<pubDate>Mon, 12 Feb 2018 15:45:54 GMT</pubDate>
			<itunes:duration>47:31</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/championsleaguespecial-/media.mp3" length="68335540" type="audio/mpeg"/>
			<guid isPermaLink="false">b65497b3-8d19-4dc1-984c-b56f5c42fa34</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/championsleaguespecial-</link>
			<acast:episodeId>b65497b3-8d19-4dc1-984c-b56f5c42fa34</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>championsleaguespecial-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRKpMMkmktjW8Lq7oE7mcGIfQTCmMFBRFaY43Mz6PwSmgjNDEmoYVx11Ecujh8zOTiW3uRr74y1H5ueX66RgQVE/Mvr/Kqof3XRf+6aom34Bcg7G6iZaONmnkixoIyaZHRfLCEXba3xgA6InibpxUq0tOTFSq7/tN8ORRsPm3H+ineR5Y2yNZxucBkxfd6EATLsnpoJqCG3PXYZksYz8p3aye+16gMvUle/5p4VyN21xc+MUYXAxG6BGeBL24EZYHfCz/M0D4b2S8iwUM/d4mI4BKEsRi6GAMxq/UETWq0bjb]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Tony Evans and David Preece to preview the UEFA Champions League Round of 16, which returns exclusively on BT Sport this week.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Tony Evans and David Preece to preview the UEFA Champions League Round of 16, which returns exclusively on BT Sport this week.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Tony Evans and David Preece to preview the UEFA Champions League Round of 16, which returns exclusively on BT Sport this week.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>What is the key to Premier League success in the modern game?</title>
			<itunes:title>What is the key to Premier League success in the modern game?</itunes:title>
			<pubDate>Mon, 05 Feb 2018 16:06:11 GMT</pubDate>
			<itunes:duration>50:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatisthekeytopremierleaguesuccessinthemoderngame-/media.mp3" length="72783896" type="audio/mpeg"/>
			<guid isPermaLink="false">b74e61e5-6187-4f41-b78b-e829a3ce3cb2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatisthekeytopremierleaguesuccessinthemoderngame-</link>
			<acast:episodeId>b74e61e5-6187-4f41-b78b-e829a3ce3cb2</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatisthekeytopremierleaguesuccessinthemoderngame-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRP+B+sIbsp9PaxIXXcv7ej6l+0tPAgAU/drkmC9Ptkcxo7dUusfqmcPgD1TTQzbwFnbA5bOw9iaJZV3xqhwX3euh1fA6vUMD9FpK6FLdDJAmDgEwW5ehaUFSsZRc0Wc5MgieTbqgxXo/4GuJ5n2Dmxl0QcVwyUiVc39X1CGF5Vc9EVqVTaEj0U51h5uuh4Nnb3yz8fisXMnFaR9OIbUr4zONuwF45aBdRLtKCavL4Urqg9WRQ7bBIKF9b2T3FSNzfNPpxrqWdwgJ3FHMaFPJuKX53nmLamYxjIWbZTGxAcLY]]></acast:settings>
			<itunes:subtitle>Joey Barton joins Mike Calvin and Jonathan Northcroft on the 100th edition of the Football Writers Podcast to offer a philosophical insight into what it takes to be a strong leader and successful manager within the intense climate of Premier League foo...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Joey Barton joins Mike Calvin and Jonathan Northcroft on the 100th edition of the Football Writers Podcast to offer a philosophical insight into what it takes to be a strong leader and successful manager within the intense climate of Premier League football.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Joey Barton joins Mike Calvin and Jonathan Northcroft on the 100th edition of the Football Writers Podcast to offer a philosophical insight into what it takes to be a strong leader and successful manager within the intense climate of Premier League football.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Flawed Klopp has no plan B</title>
			<itunes:title>Flawed Klopp has no plan B</itunes:title>
			<pubDate>Mon, 29 Jan 2018 18:00:26 GMT</pubDate>
			<itunes:duration>48:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/flawedklopphasnoplanb/media.mp3" length="93029983" type="audio/mpeg"/>
			<guid isPermaLink="false">39a33472-61b7-4471-9b0a-ee31024a7081</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/flawedklopphasnoplanb</link>
			<acast:episodeId>39a33472-61b7-4471-9b0a-ee31024a7081</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>flawedklopphasnoplanb</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9y+AhS4tibyGU/ORfxYlYh624q6uFSgjocwlvtXGBL3jP0uGvmLdZkPPtvecdV5oVVnen0G/XNPgkOiJE3hYQPu6UpCZFGFq6WCPifW3f3q8WqPhVH3mOkwJPXV8Ubfz4FTo2hIzCtuJrBQBA/9ZPnCOpzWtUvkYMV4TA3H34dcixRAXW+wksof89NQk4XKo2GduGmVfLvU31EQqFroVGi2zw67Qvx3PDDDpDwLWXxcw=]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, David Walker and Adrian Clarke discuss Klopp's&nbsp;tinkering, whether the&nbsp;Spurs board are ambitious enough, Man Utd's signing of Alexis Sanchez and why Ross Barkley will be gutted at Antonio Conte's comments....]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e50d8.jpg"/>
			<description><![CDATA[Mike Calvin, David Walker and Adrian Clarke discuss Klopp's&nbsp;tinkering, whether the&nbsp;Spurs board are ambitious enough, Man Utd's signing of Alexis Sanchez and why Ross Barkley will be gutted at Antonio Conte's comments.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, David Walker and Adrian Clarke discuss Klopp's&nbsp;tinkering, whether the&nbsp;Spurs board are ambitious enough, Man Utd's signing of Alexis Sanchez and why Ross Barkley will be gutted at Antonio Conte's comments.&nbsp;<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Silva sacked by Watford as Everton fans turn on Allardyce</title>
			<itunes:title>Silva sacked by Watford as Everton fans turn on Allardyce</itunes:title>
			<pubDate>Mon, 22 Jan 2018 18:48:19 GMT</pubDate>
			<itunes:duration>47:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/silvasackedbywatfordasevertonfansturnonallardyce/media.mp3" length="68245396" type="audio/mpeg"/>
			<guid isPermaLink="false">183a3da4-3b21-408d-833e-91fa703bee5a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/silvasackedbywatfordasevertonfansturnonallardyce</link>
			<acast:episodeId>183a3da4-3b21-408d-833e-91fa703bee5a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>silvasackedbywatfordasevertonfansturnonallardyce</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9hfbnB3mcArmXz1ITnnBX91QtVKlEyUzOLKeuK9Vcyt5XW3efD/6MJh1sXTkAAGL0o1T2rxjAdIAbHriOlIXcOvCYVq+poX9L1TaTQLJ6uLoxBpoUXOka63CvuCiZM7/YZPwvi0w1IJ8k8pp0L+mQ1vFlYtjssqPd0HI4eMRIDebzYCF4+Vo8jyNuvwzLtglCnU7sRBfXnnr4fBqsPHgNc4PkWZA2cFa0ySMZYvKy4HQfzqMPCxoS1bAV6kJjm48V]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Darren Lewis and Alyson Rudd reflect on the latest Premier League sacking, dissect the biggest transfer rumours dominating the back pages and look ahead to the FA Cup fourth round ties this weekend.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Alyson Rudd reflect on the latest Premier League sacking, dissect the biggest transfer rumours dominating the back pages and look ahead to the FA Cup fourth round ties this weekend.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Alyson Rudd reflect on the latest Premier League sacking, dissect the biggest transfer rumours dominating the back pages and look ahead to the FA Cup fourth round ties this weekend.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Liverpool smash City’s unbeaten run as Arsenal reach crisis mode again</title>
			<itunes:title>Liverpool smash City’s unbeaten run as Arsenal reach crisis mode again</itunes:title>
			<pubDate>Mon, 15 Jan 2018 16:37:51 GMT</pubDate>
			<itunes:duration>45:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/liverpoolsmashcity-sunbeatenrunasarsenalreachcrisismodeagain/media.mp3" length="65760176" type="audio/mpeg"/>
			<guid isPermaLink="false">7e0cb2f7-0c60-45c5-9e8e-dbf5fd0368c3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/liverpoolsmashcity-sunbeatenrunasarsenalreachcrisismodeagain</link>
			<acast:episodeId>7e0cb2f7-0c60-45c5-9e8e-dbf5fd0368c3</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>liverpoolsmashcity-sunbeatenrunasarsenalreachcrisismodeagain</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRH6GGWc/7/Aush0JHa4luYRgs6dboaTykMUIuBKKTePZygC0wP7lvG7XN3M68PQmU1FVx6/a5HOqiy5lX7EQCbTf3v/nqeYfbXocYzsm8kpWEu7wTsls/P+SzFvXZIREVkET/FHUE59HJA7pvfJMigszz9vDz1YsSvTH2sifS+wPuGgiehMTPYb6DqTqjGrAg0RScU12g0yDZ/Veb40zMw8+9c6eZVZq0gqLAcjWYJRHoVcjKKloGzHylGGg7AdlColn0Qf0mISfT06lawnp5MG+TEGGRza+YFQNea209XC9]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Dom Fifield and Daniel Storey reflect on another blockbuster Premier League weekend as Liverpool prove Man City are far from invincible, Arsenal self-implode at Bournemouth and Chelsea blank again.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Dom Fifield and Daniel Storey reflect on another blockbuster Premier League weekend as Liverpool prove Man City are far from invincible, Arsenal self-implode at Bournemouth and Chelsea blank again.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dom Fifield and Daniel Storey reflect on another blockbuster Premier League weekend as Liverpool prove Man City are far from invincible, Arsenal self-implode at Bournemouth and Chelsea blank again.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>FA Cup magic for Forest as Coutinho heads to Barcelona</title>
			<itunes:title>FA Cup magic for Forest as Coutinho heads to Barcelona</itunes:title>
			<pubDate>Mon, 08 Jan 2018 18:47:34 GMT</pubDate>
			<itunes:duration>47:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/facupmagicforforestascoutinhoheadstobarcelona/media.mp3" length="79484682" type="audio/mpeg"/>
			<guid isPermaLink="false">12d3a982-512a-4fb8-bd87-cb989b9d3b62</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/facupmagicforforestascoutinhoheadstobarcelona</link>
			<acast:episodeId>12d3a982-512a-4fb8-bd87-cb989b9d3b62</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>facupmagicforforestascoutinhoheadstobarcelona</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFAKsxRwi0VktO6PToc7qNLipfZsL44x+oozj0ntxiEdUHI4l+QK6p5GxVYtVZcX8A34MzGzBiy53QwHSyQxsbAQ0rsDRqg1+drxoq+xcWIfMkN3AtETejgiNjOVekvmuHqzUOiWKkSVeL0FvBNiDLzDI+tv24tVDRjzaDrhnMr6tIOF8JARQZy7ExlTlpM61pb3Aofa9ScR4eWuFesPTIT+B7IL8NY04zbZ6kv4bq6F8qRfloI993Lec1GWPZKDe9Vw/m+iiamIr9S/jGsTz/hr0YtNldvHF4TYveOR5hJj]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Dave Kidd and Tom Hopkinson reflect on Philippe Coutinho’s record-breaking transfer to Barcelona, Arsenal’s shock FA Cup exit to Nottingham Forest and Stoke’s sacking of Mark Hughes. Plus your questions about BT Sport’s ‘No Hunger In Parad...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e50ed.jpg"/>
			<description><![CDATA[Mike Calvin, Dave Kidd and Tom Hopkinson reflect on Philippe Coutinho’s record-breaking transfer to Barcelona, Arsenal’s shock FA Cup exit to Nottingham Forest and Stoke’s sacking of Mark Hughes. Plus your questions about BT Sport’s ‘No Hunger In Paradise’ documentary.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Dave Kidd and Tom Hopkinson reflect on Philippe Coutinho’s record-breaking transfer to Barcelona, Arsenal’s shock FA Cup exit to Nottingham Forest and Stoke’s sacking of Mark Hughes. Plus your questions about BT Sport’s ‘No Hunger In Paradise’ documentary.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Jose Mourinho is not finished yet</title>
			<itunes:title>Jose Mourinho is not finished yet</itunes:title>
			<pubDate>Tue, 02 Jan 2018 15:14:19 GMT</pubDate>
			<itunes:duration>47:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/josemourinhoisnotfinishedyet/media.mp3" length="68216600" type="audio/mpeg"/>
			<guid isPermaLink="false">d6dbefa7-6682-4cd2-aab6-f953b08965b1</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/josemourinhoisnotfinishedyet</link>
			<acast:episodeId>d6dbefa7-6682-4cd2-aab6-f953b08965b1</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>josemourinhoisnotfinishedyet</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRAbuUvoCr1CZYrQCszhJVUgdzXkQCZqeAQrAaOycvVD3G4z1kkiWWySY2BOmy0h64pmqgxyRCyN14g8tTPBk0JWzXEGFJ8uxm+Zz3cqfuLA1UdYz4AsdLw8CrO+/5NI+zRcZCHoO3bzksJgPdYlaSL4e5XS7opD/Ag/W5JJiz8V2DEWxQ+YwFydV+OFvQEOBoEOj/oCRR5T7iQbjqSnXNxAX0bwslslMAMR5D2R0nLfECiReEFfzDfp8oUjyGuFsCXFBAVPdJnRBp/FjVqWgKqDbuWPk5m7imyfbYWRmieTV]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Darren Lewis and Tony Evans to analyse Manchester United under Jose Mourinho and the other big headlines from the Premier League and FA Cup.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Darren Lewis and Tony Evans to analyse Manchester United under Jose Mourinho and the other big headlines from the Premier League and FA Cup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Darren Lewis and Tony Evans to analyse Manchester United under Jose Mourinho and the other big headlines from the Premier League and FA Cup.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Mid-season review: The stars and flops of the season so far</title>
			<itunes:title>Mid-season review: The stars and flops of the season so far</itunes:title>
			<pubDate>Wed, 27 Dec 2017 06:30:00 GMT</pubDate>
			<itunes:duration>31:25</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mid-seasonreview-thestarsandflopsoftheseasonsofar/media.mp3" length="75345608" type="audio/mpeg"/>
			<guid isPermaLink="false">a5b5d159-a93e-4361-8da8-89ded71e9ebb</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mid-seasonreview-thestarsandflopsoftheseasonsofar</link>
			<acast:episodeId>a5b5d159-a93e-4361-8da8-89ded71e9ebb</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mid-seasonreview-thestarsandflopsoftheseasonsofar</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPGeCXSQn73F6oIm05yGucqAU7Sv/QPpDEa863sltfkBzmua4ALnFL6aHXMEFQj4G30rvzKkTEUu/uYHifIVN4ps4B59DGdiKR9LcJSV2qE7lxleSh07KlskI4Jx3sjMuKh8HN1VD4r0MQxfWX8QL+HXEiLLOObMfLH0vERcSOTfcFq58LUPlguQUHyF32ocRjlGwlFWhQsKQwmPGTdSrOEEjEj86dDOEXZVaFrQUjXOufGPD57iMZlqr3DPCQ9joL2iMuVDECWhnWiQxHWREzGpUesuSE+1TU5j6XTiOX4j]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and Adrian Clarke reflect on the Premier League season so far, picking out their star players, managers, performances and biggest flops, plus their predictions for the top four and the bottom three.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e50fb.jpg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Adrian Clarke reflect on the Premier League season so far, picking out their star players, managers, performances and biggest flops, plus their predictions for the top four and the bottom three.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Adrian Clarke reflect on the Premier League season so far, picking out their star players, managers, performances and biggest flops, plus their predictions for the top four and the bottom three.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>No Hunger in Paradise</title>
			<itunes:title>No Hunger in Paradise</itunes:title>
			<pubDate>Fri, 22 Dec 2017 06:30:00 GMT</pubDate>
			<itunes:duration>32:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/nohungerinparadise/media.mp3" length="77040020" type="audio/mpeg"/>
			<guid isPermaLink="false">39220152-0194-4754-8bc0-129b347e328a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/nohungerinparadise</link>
			<acast:episodeId>39220152-0194-4754-8bc0-129b347e328a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>nohungerinparadise</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROJNBNxeatms/eoh45Opkhis0GkqGguBtHkw2lYJsTw1TwtB10JSMKasO83U6NVgrHMi/peUjWGcvIZCK/uot7538LrPBPLL7/KKb3DpypVOnk8XWGKU1fCxDpgCpzvkehDhKSJ5WxWc9XJhFckvhRIrYnOJCpuRCYa/jkhVRgaT7H/NF/CF1aTbFIwKEkK9QvuXtGCudIKdyK48RV3aa0ciALf8KcFHDmIWGHcUC1js+LC9oUwlDa5XPoddoU5WLx9rYKFHz5N1nJ+s9LvMPA5mTGuOAQn7ugnPft0U2bSW]]></acast:settings>
			<itunes:subtitle>Award-winning writer Mike Calvin is joined by John Cross, David Preece, Adrian Clarke and Jonathan Northcroft to discuss his upcoming BT Sport film ‘No Hunger In Paradise’ which explores what it takes to make it as a professional footballer and the pit...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5102.jpg"/>
			<description><![CDATA[Award-winning writer Mike Calvin is joined by John Cross, David Preece, Adrian Clarke and Jonathan Northcroft to discuss his upcoming BT Sport film ‘No Hunger In Paradise’ which explores what it takes to make it as a professional footballer and the pitfalls, pressures and casualties along the way. Watch ‘No Hunger in Paradise’ on BT Sport 2, Sunday January 7th at 6.30pm.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Award-winning writer Mike Calvin is joined by John Cross, David Preece, Adrian Clarke and Jonathan Northcroft to discuss his upcoming BT Sport film ‘No Hunger In Paradise’ which explores what it takes to make it as a professional footballer and the pitfalls, pressures and casualties along the way. Watch ‘No Hunger in Paradise’ on BT Sport 2, Sunday January 7th at 6.30pm.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Man City emulate the Arsenal Invincibles?</title>
			<itunes:title>Can Man City emulate the Arsenal Invincibles?</itunes:title>
			<pubDate>Mon, 18 Dec 2017 16:49:18 GMT</pubDate>
			<itunes:duration>29:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canmancityemulatethearsenalinvincibles-/media.mp3" length="56838578" type="audio/mpeg"/>
			<guid isPermaLink="false">87241ad7-2f1b-48ef-a3bb-b020725cd2d6</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canmancityemulatethearsenalinvincibles-</link>
			<acast:episodeId>87241ad7-2f1b-48ef-a3bb-b020725cd2d6</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canmancityemulatethearsenalinvincibles-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9w+m6ubDCmgios0kA8Zo5I0ej5kb/ftJ2fyZlvR3yip7WZ/hKIpFdLuGks1dtHOAFEvnm6Aw2AM+9dduKUOe8dyUTIqVrATtWD+kyJyaXIVDLvmqsG8jCv+FAKUUmnFMYDU+BltObB1hisWxirTkczZSR058g1uu1yNUCv2HZV36m8V382/NVQBW+4UqKFL+I2itjpVeTm0AQOEMnnhnPVmzWJeKif84eBvIL7kxxxNGr4XO6bxgm6ZuhqNGdmY8V]]></acast:settings>
			<itunes:subtitle>Mike Calvin, John Cross and David Preece dissect another Manchester City masterclass, praise Burnley’s fairytale season under Sean Dyche and speculate which players could be on the move in January.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5109.jpg"/>
			<description><![CDATA[Mike Calvin, John Cross and David Preece dissect another Manchester City masterclass, praise Burnley’s fairytale season under Sean Dyche and speculate which players could be on the move in January.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and David Preece dissect another Manchester City masterclass, praise Burnley’s fairytale season under Sean Dyche and speculate which players could be on the move in January.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Mourinho ‘embarrassed’ as Man City march 11 points clear</title>
			<itunes:title>Mourinho ‘embarrassed’ as Man City march 11 points clear</itunes:title>
			<pubDate>Mon, 11 Dec 2017 15:53:45 GMT</pubDate>
			<itunes:duration>48:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mourinho-embarrassed-asmancitymarch11pointsclear/media.mp3" length="69504908" type="audio/mpeg"/>
			<guid isPermaLink="false">dedd8b9d-b0ec-4e80-add7-bddb491c0fc9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mourinho-embarrassed-asmancitymarch11pointsclear</link>
			<acast:episodeId>dedd8b9d-b0ec-4e80-add7-bddb491c0fc9</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mourinho-embarrassed-asmancitymarch11pointsclear</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRKDbqj7ZbTNXj5ex/6Y2GuvVaRxdhr4nqkKY58iQZYxUJzy0b9ehKfsTj6ut8aetaNglCkrbk5U+YbMFJvrJFsuriHbRua8SYA6NRmdDA2DmJF3nemn1C72nQdoKqbidQ3CLSWnav+BbwEqFfPQTN1nOWb4hNdD3A/VTTddhW5abscGzyDR0Sp8DbPJ43crQgllQcmcZlqfpruYM30SBWu7whbNdQdiaiCBJK1/vUhcu9lT8OSS1jymA9B7OVkQM0sy6lAZqmqf8wBlJgO07xBMAKN+HzMevSKWu3kV10TVT]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Darren Lewis and Dom Fifield dissect Man City’s record-breaking derby victory and give their thoughts on the Champions League round-of-16 draw.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Dom Fifield dissect Man City’s record-breaking derby victory and give their thoughts on the Champions League round-of-16 draw.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Dom Fifield dissect Man City’s record-breaking derby victory and give their thoughts on the Champions League round-of-16 draw.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Jose v Pep: Can United halt the Manchester City juggernaut?</title>
			<itunes:title>Jose v Pep: Can United halt the Manchester City juggernaut?</itunes:title>
			<pubDate>Mon, 04 Dec 2017 16:31:47 GMT</pubDate>
			<itunes:duration>45:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/josevpep-canunitedhaltthemanchestercityjuggernaut-/media.mp3" length="65037146" type="audio/mpeg"/>
			<guid isPermaLink="false">2cb0beb5-abf3-40c4-86f9-79a4ef614706</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/josevpep-canunitedhaltthemanchestercityjuggernaut-</link>
			<acast:episodeId>2cb0beb5-abf3-40c4-86f9-79a4ef614706</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>josevpep-canunitedhaltthemanchestercityjuggernaut-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9maZvg5IH29m1PUAmaynnVavC9DrQanr72mkVzInrHeC9bbFUdCU9xP/DNye0QxTFLcqL5Tl/BVaz+oIYwbTTbbpiZjM0Cn5rWvOt9YrM4Lqsg04hJlZiBF0A7YW2EzvXqmpJOYJJoZOmuPPAZH4nl3P1/ovHddbAwSZE3z2Jk/I3erQ33nYpcI4kanWf8yewogr45uDy9zd3KsKkbzftf24JT2GrL8H7TU6DtlFgMtsWaUFwKKX300UOVlsqlQfl]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and Alyson Rudd round up another blockbuster Premier League weekend and look ahead to the Manchester and Merseyside derbies.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Alyson Rudd round up another blockbuster Premier League weekend and look ahead to the Manchester and Merseyside derbies.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Alyson Rudd round up another blockbuster Premier League weekend and look ahead to the Manchester and Merseyside derbies.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>All eyes on Emirates as Arsenal and United gear up for key match</title>
			<itunes:title>All eyes on Emirates as Arsenal and United gear up for key match</itunes:title>
			<pubDate>Tue, 28 Nov 2017 16:38:03 GMT</pubDate>
			<itunes:duration>47:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/alleyesonemiratesasarsenalandunitedgearupforkeymatch/media.mp3" length="68056344" type="audio/mpeg"/>
			<guid isPermaLink="false">e82d2932-fa36-47ef-913b-261d5e95782d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/alleyesonemiratesasarsenalandunitedgearupforkeymatch</link>
			<acast:episodeId>e82d2932-fa36-47ef-913b-261d5e95782d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>alleyesonemiratesasarsenalandunitedgearupforkeymatch</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRIhtH3nX/K/RbdfagoSFdRItP+4sxmZMHDQRx3eNLIhiSMCoYfm8NRR/ITtUZyY1qGh/KZS1Io4meftQnfZ2AlzdKdhXQLLR5kpsk2lBIx2PHjbnuJqHIuQSaQtwNpX4zfjJ/5oivNg9np++LG/n/QShU7ENySwjWeAiE8CckiVuAtZ5BED3RQYsWOR9m4blz1whgTatjwVeXY2Nd6iMHLzc8Bj8Jq8OS6MPV8cFgR5gIWgu4EOsEgWCCzzdHW3JxrVLgpqDeu0z2owoTQOJ5/RkeAZVauWGM5G5ifDiqfl7]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Tony Evans and David Preece to preview Arsenal’s huge Premier League clash with Manchester United, exclusively live on BT Sport 1 and 4K UHD form 5pm.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Tony Evans and David Preece to preview Arsenal’s huge Premier League clash with Manchester United, exclusively live on BT Sport 1 and 4K UHD form 5pm.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Tony Evans and David Preece to preview Arsenal’s huge Premier League clash with Manchester United, exclusively live on BT Sport 1 and 4K UHD form 5pm.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Liverpool and Chelsea prepare for 'pivotal' Anfield clash]]></title>
			<itunes:title><![CDATA[Liverpool and Chelsea prepare for 'pivotal' Anfield clash]]></itunes:title>
			<pubDate>Mon, 20 Nov 2017 12:22:26 GMT</pubDate>
			<itunes:duration>45:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/liverpoolandchelseaprepareforpivotalanfieldclash/media.mp3" length="65984910" type="audio/mpeg"/>
			<guid isPermaLink="false">01eab9c9-bd13-4cf2-85c8-7627b0486b02</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/liverpoolandchelseaprepareforpivotalanfieldclash</link>
			<acast:episodeId>01eab9c9-bd13-4cf2-85c8-7627b0486b02</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>liverpoolandchelseaprepareforpivotalanfieldclash</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRGDlzoxQV/XXrza83pjMgNZVUDjN9lPkI6Uuppt8rkw3M5nxp0BfeQY565crcLjXeXjGmr8fadZjcD9jFdVwYqA4iYupr4hrWuvI+0DPcs93VSFTFkHa/1oG89hB4wbaFDdHKqdOVHRIqgGV4/MDsj+njLWbotGnhb6rdvQwg4ANaOPPqATUqP5uWVu9uMqQJW8KabcQumCSJdmA7rjIiTX1JvEPCNikrwxnqdhyvpGmO9/Pcw9LUYCVYNkf/ams00flBEK4OXQ52pGES3nLUwf7YMZyMrKyZtOLd7JHPIfQ]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by John Cross and Tom Hopkinson to preview Saturday’s huge Premier League game between Liverpool and Chelsea, exclusively live on BT Sport 1 and 4K UHD from 5pm.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by John Cross and Tom Hopkinson to preview Saturday’s huge Premier League game between Liverpool and Chelsea, exclusively live on BT Sport 1 and 4K UHD from 5pm.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by John Cross and Tom Hopkinson to preview Saturday’s huge Premier League game between Liverpool and Chelsea, exclusively live on BT Sport 1 and 4K UHD from 5pm.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Pochettino's Spurs have to deliver in North London derby]]></title>
			<itunes:title><![CDATA[Pochettino's Spurs have to deliver in North London derby]]></itunes:title>
			<pubDate>Mon, 13 Nov 2017 16:42:07 GMT</pubDate>
			<itunes:duration>49:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/pochettinosspurshavetodeliverinnorthlondonderby/media.mp3" length="70632960" type="audio/mpeg"/>
			<guid isPermaLink="false">2922fd33-942a-4ce2-bcec-11645866089d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/pochettinosspurshavetodeliverinnorthlondonderby</link>
			<acast:episodeId>2922fd33-942a-4ce2-bcec-11645866089d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>pochettinosspurshavetodeliverinnorthlondonderby</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRLMYo8ofkWrJbsT8QjaA5zugBwK1Ofj8MbrRIZvk8zqbPkAdXn+xn6ftB1I3HNLjZ5P6wtmQwWqUbcm8n0uuF6B0LUq7+ZK9dYbC5prtfR48u6BvwA/B8/MWn+weUfWEQYDxKK4ZyX1VaYjPMbDTObxJ3rWpBmVhD6R4VlibJ4ksnb8AvsM/9ocn5Fp8UKNK4I2jUikVdoSyJqYsm8WXIL5mdy8yRrczqs8kkfJFl6xSm6NlmYVje3fgmhGYzpN9sW9oXVLX7yECuKWwYV5A840ucvnsuoFdgfjm6ou8slkA]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by David Walker and Adrian Clarke to preview the return of the Premier League including Arsenal’s derby game against Tottenham and Manchester United v Newcastle, which is exclusively live on BT Sport</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by David Walker and Adrian Clarke to preview the return of the Premier League including Arsenal’s derby game against Tottenham and Manchester United v Newcastle, which is exclusively live on BT Sport<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by David Walker and Adrian Clarke to preview the return of the Premier League including Arsenal’s derby game against Tottenham and Manchester United v Newcastle, which is exclusively live on BT Sport<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Moyes and Allardyce prepare to get back on the managerial roundabout</title>
			<itunes:title>Moyes and Allardyce prepare to get back on the managerial roundabout</itunes:title>
			<pubDate>Mon, 06 Nov 2017 16:42:02 GMT</pubDate>
			<itunes:duration>46:46</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/moyesandallardycepreparetogetbackonthemanagerialroundabout/media.mp3" length="67251934" type="audio/mpeg"/>
			<guid isPermaLink="false">dcc6b59d-ccd8-4934-a5c5-00b17056afe3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/moyesandallardycepreparetogetbackonthemanagerialroundabout</link>
			<acast:episodeId>dcc6b59d-ccd8-4934-a5c5-00b17056afe3</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>moyesandallardycepreparetogetbackonthemanagerialroundabout</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9diDp8dZRzhbGTKdwteb9vV1wZAXrLg9xSnvXwOzWH/yHHYKZ9906G2d6pta5oOIqu0Hsq+e49MpFYy9m5WLgFe2lVgTIBlgd8eYzVGm6oi8tatqRBmfm3KN73mDL7gJhdVuABRK2BU+rFQWWaQllUl2YiE0qPooCwHZGeUvaqndZWk8laITq0Al8zC21bfF47/jzoXML7vj7cePahNSZSuVotxrxhpcRt8OFn7sE4dNNiYTo5Cr5BBgZ4GbJxK5m]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Tony Evans and David Preece to analyse the managerial comings and goings at West Ham United and Everton.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin is joined by Tony Evans and David Preece to analyse the managerial comings and goings at West Ham United and Everton.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Tony Evans and David Preece to analyse the managerial comings and goings at West Ham United and Everton.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>‘Dull’ United have lost their mojo</title>
			<itunes:title>‘Dull’ United have lost their mojo</itunes:title>
			<pubDate>Mon, 30 Oct 2017 17:19:53 GMT</pubDate>
			<itunes:duration>47:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/-dull-unitedhavelosttheirmojo/media.mp3" length="68760594" type="audio/mpeg"/>
			<guid isPermaLink="false">d1e6409d-a89f-4924-bcab-47403d849d57</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/-dull-unitedhavelosttheirmojo</link>
			<acast:episodeId>d1e6409d-a89f-4924-bcab-47403d849d57</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>-dull-unitedhavelosttheirmojo</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9DXil5n8ITKyy+NeTIG8CkvrFLbDyP7gusof6dh3b4WHmJOfjaosFB2e6jlG7vKNJ/lEzCfRnJ2PgVMuyD8W3Byqvz5mjWLEvu0LC29JSd0tEQGgU1qfVBW2WEwNHvBm1WbwLfwFNJPMsg72bBsKCaoYLjO91YfvgzN6id+YnqdZWN0+CV4JGq+Bs8U51YGr9wlzktGArWr5jvuSs8anzsY8aDbPXBSGkJ32yIJ7J4Lm2ytjpARf2aIKlT+hik8BN]]></acast:settings>
			<itunes:subtitle>Mike Calvin, John Cross and Dave Kidd discuss the biggest talking points from the Premier League weekend and look ahead to the midweek Champions League fixtures, exclusively live on BT Sport.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, John Cross and Dave Kidd discuss the biggest talking points from the Premier League weekend and look ahead to the midweek Champions League fixtures, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Dave Kidd discuss the biggest talking points from the Premier League weekend and look ahead to the midweek Champions League fixtures, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who should replace sacked Ronald Koeman at Everton?</title>
			<itunes:title>Who should replace sacked Ronald Koeman at Everton?</itunes:title>
			<pubDate>Mon, 23 Oct 2017 15:38:54 GMT</pubDate>
			<itunes:duration>46:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whoshouldreplacesackedronaldkoemanateverton-/media.mp3" length="88495098" type="audio/mpeg"/>
			<guid isPermaLink="false">d63dafce-1599-4642-9920-0081e7fc3ac1</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whoshouldreplacesackedronaldkoemanateverton-</link>
			<acast:episodeId>d63dafce-1599-4642-9920-0081e7fc3ac1</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whoshouldreplacesackedronaldkoemanateverton-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRGOkAORA82SGeWrrsD9YrceGkCUCn1yW/l+pFS+Jh3WG1XnrkrQmjFQFaxFcfEwvAvxE6BasQ3AZOcMJmTks341P7QPdDQa+yFmG9LWg3EsRwB0IzOURp05Ooto5DFJI6ZY7jtdZsqhbF8kju0uvvZLC5yxzQsqkv+Hv/W7i0qL1jOpdV7pAM6d6g49X40mfdkksC8XYiRHF+fKvUNky+Z44CjbSfDk3yFveAfaUlhM8xiXGWSUXXmLA7ScgwCv34YrWNrEFRRt4ojX853WSnWjohlh5DSL5m6+8DMkWDs4g]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Jonathan Northcroft and David Preece to analyse the end of Ronald Koeman’s reign at Everton and the runners and riders for the fresh vacancy at Goodison Park.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5141.jpg"/>
			<description><![CDATA[Mike Calvin is joined by Jonathan Northcroft and David Preece to analyse the end of Ronald Koeman’s reign at Everton and the runners and riders for the fresh vacancy at Goodison Park.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Jonathan Northcroft and David Preece to analyse the end of Ronald Koeman’s reign at Everton and the runners and riders for the fresh vacancy at Goodison Park.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can anyone stop the Man City juggernaut?</title>
			<itunes:title>Can anyone stop the Man City juggernaut?</itunes:title>
			<pubDate>Mon, 16 Oct 2017 16:49:27 GMT</pubDate>
			<itunes:duration>48:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/cananyonestopthemancityjuggernaut-/media.mp3" length="69432292" type="audio/mpeg"/>
			<guid isPermaLink="false">d7af8602-404a-4f9a-afd2-f1636a26a251</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/cananyonestopthemancityjuggernaut-</link>
			<acast:episodeId>d7af8602-404a-4f9a-afd2-f1636a26a251</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>cananyonestopthemancityjuggernaut-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRDvZ0JDgj7AHV1rPIdNIYba/AiYG3IMZdJCzJGq53COC0YW5iNyHG/akbSWWbJcHdTB0ieqTH7Tv4pNvaYnx58nxqG6yWbfaejk0QZk9LlS1VE5VmwdtnPe672E/oWvsBP3D7FMsLPisciNZZtQwFvwoTfKDoJjZhU0G6Jj5hkrmvSC0+XVufY2J54Jp7mWBoywFDItSTRhE/Spopi7p8brorAeoqLrpfNQ4ZZ+HVuzQwOM4rmyRVBF9GuvsQkkbEPkWDtJojX+A2Xsqrq8PcomLNdhnon8bFyhLBKjQzdUg]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Darren Lewis and Alyson Rudd review Man City’s free-scoring, Jose Mourinho’s bus-parking and Crystal Palace’s sensational win over the champions and look ahead to another mouth-watering Champions League schedule, exclusively live on BT Sport.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/1659434813479-c0febccaaa1a7955e30d45c356852772.jpeg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Alyson Rudd review Man City’s free-scoring, Jose Mourinho’s bus-parking and Crystal Palace’s sensational win over the champions and look ahead to another mouth-watering Champions League schedule, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Alyson Rudd review Man City’s free-scoring, Jose Mourinho’s bus-parking and Crystal Palace’s sensational win over the champions and look ahead to another mouth-watering Champions League schedule, exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Liverpool v United the biggest game in English football?</title>
			<itunes:title>Is Liverpool v United the biggest game in English football?</itunes:title>
			<pubDate>Mon, 09 Oct 2017 15:45:42 GMT</pubDate>
			<itunes:duration>46:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isliverpoolvunitedthebiggestgameinenglishfootball-/media.mp3" length="66446272" type="audio/mpeg"/>
			<guid isPermaLink="false">32c25129-5b40-40f3-859e-ae57002f0b73</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isliverpoolvunitedthebiggestgameinenglishfootball-</link>
			<acast:episodeId>32c25129-5b40-40f3-859e-ae57002f0b73</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isliverpoolvunitedthebiggestgameinenglishfootball-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9sagCMkXSGJpkGgFGkvub6GeKE6FR47EKJ+1cRaAyceKi8l2N4LSlXi40KO9yqEQos/eoTuXr8LcWNSYCa2UC2+v23vr+SvRVcyT064WnpLqTqN6EySO6oHFZNZsARnP+e1py0v3UERorXWWjfwi4zLOkcKxTkMnj+fTa0RQ60VZfaIOiOSnu/dHrsJLBIvOhSxvIha/VZrUI/K/TVf4j/b1/w71/rqvVc1CyfTWiqLAr8MQuPEIjx79HD0j5LqDQ]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Tony Evans and Tom Collomosse to preview the weekend’s Premier League action including Liverpool v Manchester United.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e514f.jpg"/>
			<description><![CDATA[Mike Calvin is joined by Tony Evans and Tom Collomosse to preview the weekend’s Premier League action including Liverpool v Manchester United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Tony Evans and Tom Collomosse to preview the weekend’s Premier League action including Liverpool v Manchester United.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is it time for Ronald Koeman to leave Everton?</title>
			<itunes:title>Is it time for Ronald Koeman to leave Everton?</itunes:title>
			<pubDate>Mon, 02 Oct 2017 14:03:09 GMT</pubDate>
			<itunes:duration>48:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isittimeforronaldkoemantoleaveeverton-/media.mp3" length="70353764" type="audio/mpeg"/>
			<guid isPermaLink="false">0748c088-8e10-419c-949b-b1f38ba49b02</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isittimeforronaldkoemantoleaveeverton-</link>
			<acast:episodeId>0748c088-8e10-419c-949b-b1f38ba49b02</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isittimeforronaldkoemantoleaveeverton-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9G1Dg1VSkUx78lMi6BrPO0y/J8dN1YNWqxlQDhm9aYm9dtLndXirLEM8nl/d73iS8xcIGHuCeefRNliGtkYTXSkigQcuXu9Ay5ejjkVBu1Y1NlDIDk5Tjo1HlRI7ZaDpF9tpmTZ/H35Ei5fcmYRCUdL0U/wt7lkpXi6C/qvdaCfVUbjsSxkbAnHaktgSHqlSOY3lOEG4QOXY5CkjZBe55aranUqE3sQRAncGFZeQrgLCVp01jbJqAHfGpNmM+U1on]]></acast:settings>
			<itunes:subtitle>Mike Calvin, David Walker and Adrian Clarke review another blockbuster Premier League weekend and speculate whether Ronald Koeman and Slaven Bilic will survive the international break.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5156.jpg"/>
			<description><![CDATA[Mike Calvin, David Walker and Adrian Clarke review another blockbuster Premier League weekend and speculate whether Ronald Koeman and Slaven Bilic will survive the international break.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, David Walker and Adrian Clarke review another blockbuster Premier League weekend and speculate whether Ronald Koeman and Slaven Bilic will survive the international break.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Defining week ahead for Chelsea as Atletico and Man City await</title>
			<itunes:title>Defining week ahead for Chelsea as Atletico and Man City await</itunes:title>
			<pubDate>Mon, 25 Sep 2017 15:23:52 GMT</pubDate>
			<itunes:duration>48:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/definingweekaheadforchelseaasatleticoandmancityawait/media.mp3" length="69752178" type="audio/mpeg"/>
			<guid isPermaLink="false">dee7628a-94f2-47c4-b195-83f5d5e5e69c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/definingweekaheadforchelseaasatleticoandmancityawait</link>
			<acast:episodeId>dee7628a-94f2-47c4-b195-83f5d5e5e69c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>definingweekaheadforchelseaasatleticoandmancityawait</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRKo+vOoEKh1FzjrmEuflCK886yI5/OG5nP4iCAF5QSyJbQSltcjv78JpJFirRvQj308wDON7Sby9teFyasVmBgEl2012gl9DcpBJGZPhhqGqL8lvjIAaDbxTCyv5mhGDUB5yFcbTz6ROASjdOvkdjkScWkQKZOGcTlG7bC6q/SJTy40l8crezd8Z+ZRqk9bPfUK2KqzsfEsUttJrp3+e3ve9O8sbT1DMFOnM6p7Y/D9RLhYBugVRPngNKM57/BjRFKXfKfceLbM8evdAhBXj0sNxkIkgH6QcA9C7idIaW50f]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Tom Hopkinson and Dom Fifield preview this week’s Champions League fixtures and the mouthwatering weekend clash between Chelsea and Manchester City, all exclusively live on BT Sport.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e515d.jpg"/>
			<description><![CDATA[Mike Calvin, Tom Hopkinson and Dom Fifield preview this week’s Champions League fixtures and the mouthwatering weekend clash between Chelsea and Manchester City, all exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tom Hopkinson and Dom Fifield preview this week’s Champions League fixtures and the mouthwatering weekend clash between Chelsea and Manchester City, all exclusively live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is the Premier League title destined for Manchester?</title>
			<itunes:title>Is the Premier League title destined for Manchester?</itunes:title>
			<pubDate>Mon, 18 Sep 2017 15:34:22 GMT</pubDate>
			<itunes:duration>49:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthepremierleaguetitledestinedformanchester-/media.mp3" length="70780070" type="audio/mpeg"/>
			<guid isPermaLink="false">aacad924-0fcd-49fc-9f99-396d89e7c573</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthepremierleaguetitledestinedformanchester-</link>
			<acast:episodeId>aacad924-0fcd-49fc-9f99-396d89e7c573</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthepremierleaguetitledestinedformanchester-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9EC1I49ArYcFntkRsgPpgvZzHsgn0Gq04fOqS3m64mkMwYVtI3T9Khbdy7lBRLcXyNTqvF9HTHaojwvJvkh9ROnaPrqtuA7wSZQ0weXUj3EMimn9sYpWxJmEq17mDbuJ9wIeoCq59DSUsuCR00FNR/q23XvPDsTVHzQmLsxC2vXJdGNKAeHL+0PMx9dwZkA6+4uwfroaIQW+Cb6JrWnWZmuwlrJrONZelQ/kbF67EguocAsKdpQLyfd/O5oReoG2j]]></acast:settings>
			<itunes:subtitle>Mike Calvin, John Cross and David Preece dissect a significant Premier League weekend as the Manchester duo continue their relentless pursuit of the title and debate whether Arsenal are genuine top four contenders following a disciplined display at...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5164.jpg"/>
			<description><![CDATA[Mike Calvin, John Cross and David Preece dissect a significant Premier League weekend as the Manchester duo continue their relentless pursuit of the title and debate whether Arsenal are genuine top four contenders following a disciplined display at Chelsea and whether Liverpool fans are right to criticise Jurgen Klopp.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and David Preece dissect a significant Premier League weekend as the Manchester duo continue their relentless pursuit of the title and debate whether Arsenal are genuine top four contenders following a disciplined display at Chelsea and whether Liverpool fans are right to criticise Jurgen Klopp.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Spurs advance from Champions League group of death?</title>
			<itunes:title>Can Spurs advance from Champions League group of death?</itunes:title>
			<pubDate>Mon, 11 Sep 2017 15:34:46 GMT</pubDate>
			<itunes:duration>46:35</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canspursadvancefromchampionsleaguegroupofdeath-/media.mp3" length="66982128" type="audio/mpeg"/>
			<guid isPermaLink="false">8f6f15ea-514c-4f54-8d38-5bb961f8cdc8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canspursadvancefromchampionsleaguegroupofdeath-</link>
			<acast:episodeId>8f6f15ea-514c-4f54-8d38-5bb961f8cdc8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canspursadvancefromchampionsleaguegroupofdeath-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRN+OLrIIkBL07eEtRFUXnmbeca7NadUTgjqj1NxzyyzG0vEuGNr5VaB2fOyUhQN/LEYvH0+Dm55ofhTe9uU+lr/rZmXKruf9HMLUcWL7Hm1p4b26bzsZBgX+xe5RJCBcA1RBV7Hh+ry64HSfxg4gRH1/x4jCZoPU6mBpcj9aHJLiAt69Z5cYvOfo0lQDIDm7+oAVgRntMlrr/9IqFMFhEHSl4lyYvdhVYyMVkiNaX5vI0h/+aKCY+DW5jetoAFbj0SojjO5EW1khe45e5UVcpdIq2T4+foWtm5mBsBoN5Ww1]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Jonathan Norcroft of The Sunday Times and Tony Evans of the London Evening Standard to preview the group stages of the Champions League.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e516b.jpg"/>
			<description><![CDATA[Mike Calvin is joined by Jonathan Northcroft of The Sunday Times and Tony Evans of the London Evening Standard to preview the group stages of the Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Jonathan Northcroft of The Sunday Times and Tony Evans of the London Evening Standard to preview the group stages of the Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Arsenal players have lost faith in Wenger</title>
			<itunes:title>Arsenal players have lost faith in Wenger</itunes:title>
			<pubDate>Mon, 04 Sep 2017 14:35:11 GMT</pubDate>
			<itunes:duration>46:51</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/arsenalplayershavelostfaithinwenger/media.mp3" length="112358540" type="audio/mpeg"/>
			<guid isPermaLink="false">ac0e0aa2-caaf-4826-a1c2-f36c7e8a3c54</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/arsenalplayershavelostfaithinwenger</link>
			<acast:episodeId>ac0e0aa2-caaf-4826-a1c2-f36c7e8a3c54</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>arsenalplayershavelostfaithinwenger</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9eG1TcEf0UkjpI/9nlHD91H3XePL+iLNLwretFinUjEFBV2RE4dTO6kuUhfU5YjGXVZHEaHnUozB6HAOjC5GZ9yvgPioB1nbZatfmpeFMzSCHXK4aA+cl46DPt6vls8TPzwjrwHG/LvZUIJi2DUgYFSEEma28M76cfltgfpoD4P2FyaL/iSxr5tSDSLMVnDhL5pb3zMpno5KcsV9Zq1k5jKe+IIy1o/2m1bVJ6RohPcXzC6FX06rozTEHS6f/dLso]]></acast:settings>
			<itunes:subtitle><![CDATA[Arsene Wenger 'past his sell-by date' and Sanchez a 'big problem' for the Gunners. Darren Lewis of the Daily Mirror and The Independent's Miguel Delaney join host Mike Calvin to discuss the week's big talking points.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5172.jpg"/>
			<description><![CDATA[Arsene Wenger 'past his sell-by date' and Sanchez a 'big problem' for the Gunners. Darren Lewis of the Daily Mirror and The Independent's Miguel Delaney join host Mike Calvin to discuss the week's big talking points.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Arsene Wenger 'past his sell-by date' and Sanchez a 'big problem' for the Gunners. Darren Lewis of the Daily Mirror and The Independent's Miguel Delaney join host Mike Calvin to discuss the week's big talking points.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Groundhog day at Arsenal as the transfer deadline looms</title>
			<itunes:title>Groundhog day at Arsenal as the transfer deadline looms</itunes:title>
			<pubDate>Tue, 29 Aug 2017 15:52:58 GMT</pubDate>
			<itunes:duration>45:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/groundhogdayatarsenalasthetransferdeadlinelooms/media.mp3" length="65844031" type="audio/mpeg"/>
			<guid isPermaLink="false">a74a001f-5905-453c-9e6b-28e2d2c6e419</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/groundhogdayatarsenalasthetransferdeadlinelooms</link>
			<acast:episodeId>a74a001f-5905-453c-9e6b-28e2d2c6e419</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>groundhogdayatarsenalasthetransferdeadlinelooms</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRJinGMdojZg9G8GQCf0NEQBLHRYsPXhxPffz45cPoughvQPcxM6a/APPw4N3+Eqx+E6wc6Jee9I55BKny4UYBbBbPJyp1Yf5u23dHa87O7kuO4VKH6dZ1/f9pUNcjzBN3RuSb2GiEYV+xZH3sZRUAYs/62q6fgIVx9JgdpeaEx+y+Wnwt4TYw0lGeBbBUzBcJWR5kLpIn2Sh8XIX7a7BnzOWuKG9yiseSbc2zSOZkmiWcfvbv3zc1X2FwoB7LFzHFISi4hs5Kba3M135Xe1jti3ZOC/zEYbot3uFI4lsHa3Z]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Adrian Clarke and David Walker dissect Arsenal’s humiliation at Anfield, the futures of Slaven Bilic and Frank De Boer, and speculate what the final days of the transfer window will bring.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5179.jpg"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and David Walker dissect Arsenal’s humiliation at Anfield, the futures of Slaven Bilic and Frank De Boer, and speculate what the final days of the transfer window will bring.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and David Walker dissect Arsenal’s humiliation at Anfield, the futures of Slaven Bilic and Frank De Boer, and speculate what the final days of the transfer window will bring.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Will Wembley ruin Spurs' season?]]></title>
			<itunes:title><![CDATA[Will Wembley ruin Spurs' season?]]></itunes:title>
			<pubDate>Mon, 21 Aug 2017 15:32:58 GMT</pubDate>
			<itunes:duration>44:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willwembleyruinspursseason-/media.mp3" length="64510025" type="audio/mpeg"/>
			<guid isPermaLink="false">69e7e08b-54be-44f1-894a-b342ce67585f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willwembleyruinspursseason-</link>
			<acast:episodeId>69e7e08b-54be-44f1-894a-b342ce67585f</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willwembleyruinspursseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRLnu/Rk1eur9m4E6q/yp4TJVK1wju/jK3j+N1vPNsgOmqu16jvUKRTSNBEYY79bHzpkc09UHfC5HMP0ajUB4drHZD1m/d2PZH5NiUBMpaRSbwHKVfLHXBuWcX8cc+FAirEOgmN9x/L8oT4sO5AXTTeZ62sQf5DY7vnGHNIiD3IaTB+bj9R8si5MvIlSExuNzgk/elGqfJfNJQIK32LMIG3S7tjIgnhrfxoNWTo4LEW/nWwPJeFmvVxa2E9QmkrIHU03Vdqhc9Q8qME7WKHyn4c41XYfAA055TjabiWzh4AKv]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by The Guardian's Dominic Fifield and The Sunday Times'  Jonathan Northcroft to review the latest Premier League action including Tottenham's continuing Wembley Stadium woes, Manchester United's impressive star...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5180.jpg"/>
			<description><![CDATA[Mike Calvin is joined by The Guardian's Dominic Fifield and The Sunday Times'  Jonathan Northcroft to review the latest Premier League action including Tottenham's continuing Wembley Stadium woes, Manchester United's impressive start to the season and Mesut Ozil's reluctance to take centre stage at Arsenal. The panel also discuss whether England manager Gareth Southgate should pick Wayne Rooney and Joe Hart before pondering what deals will be done before the transfer deadline.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by The Guardian's Dominic Fifield and The Sunday Times'  Jonathan Northcroft to review the latest Premier League action including Tottenham's continuing Wembley Stadium woes, Manchester United's impressive start to the season and Mesut Ozil's reluctance to take centre stage at Arsenal. The panel also discuss whether England manager Gareth Southgate should pick Wayne Rooney and Joe Hart before pondering what deals will be done before the transfer deadline.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Huddersfield enjoy dream debut as champions Chelsea crumble to Burnley</title>
			<itunes:title>Huddersfield enjoy dream debut as champions Chelsea crumble to Burnley</itunes:title>
			<pubDate>Mon, 14 Aug 2017 14:49:05 GMT</pubDate>
			<itunes:duration>47:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/huddersfieldenjoydreamdebutaschampionschelseacrumbletoburnley/media.mp3" length="69108434" type="audio/mpeg"/>
			<guid isPermaLink="false">73f6eb5d-6857-4740-ae24-356b923870ee</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/huddersfieldenjoydreamdebutaschampionschelseacrumbletoburnley</link>
			<acast:episodeId>73f6eb5d-6857-4740-ae24-356b923870ee</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>huddersfieldenjoydreamdebutaschampionschelseacrumbletoburnley</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRO9cJL1L184OZHywp68TQjxsFvoin/58EKSawCN6VlAww3M2e2hGTmYNt7YGjU4TF5R3VLtHWZKUJzyqU7vBRJQ9fhPeliVFs05KtCJb9pBgsWx28YptXIMkNGKNkYzt08sCmBxAeUl06KH3Iht92imEfQOuDHjUZngXNak3M/Qia6IxYPIfhzoM/1SnVycyU4MpAMu3Yya+k+papiNuMBF5wOw47+XMvSXcrxTY0/D241fynv1MvFPM7Oy+yhCiZapvclcJnkm+stfl6DCz3It4841kv4UreemUUCOlBA5i]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, John Cross and Tom Hopkinson dissect a blockbuster start to the new Premier League season, as well as the future of Liverpool midfielder Philippe Coutinho, Tottenham's unsustainable wage structure and the upcoming Champions League pla...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5187.jpg"/>
			<description><![CDATA[Mike Calvin, John Cross and Tom Hopkinson dissect a blockbuster start to the new Premier League season, as well as the future of Liverpool midfielder Philippe Coutinho, Tottenham's unsustainable wage structure and the upcoming Champions League playoff first legs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Tom Hopkinson dissect a blockbuster start to the new Premier League season, as well as the future of Liverpool midfielder Philippe Coutinho, Tottenham's unsustainable wage structure and the upcoming Champions League playoff first legs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Who is going to win the Premier League?</title>
			<itunes:title>Who is going to win the Premier League?</itunes:title>
			<pubDate>Mon, 07 Aug 2017 17:56:16 GMT</pubDate>
			<itunes:duration>54:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whoisgoingtowinthepremierleague-/media.mp3" length="92071040" type="audio/mpeg"/>
			<guid isPermaLink="false">a799c338-592f-4e21-93ae-2602cf9c8b75</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whoisgoingtowinthepremierleague-</link>
			<acast:episodeId>a799c338-592f-4e21-93ae-2602cf9c8b75</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whoisgoingtowinthepremierleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9skFMltQb4paIBaAx2fxYaWQNB38Tftayr9Fjyt92XCgqrHJnqZJ5jOExJSB+srll1/sQw0UmYQ54IypW49G20dHqn4DAH8EnpNvFqdmedAH0rEazM8KmRXzjc8e5/7YFX2lBmrmGTk8KMXAc0+pgSMxEPEoQ1GJCtMg80G2SjMrjrQO2Et8WSiwf0vlh3X2E/n30SlSl4KR0emrsTtqE29y2mOowfHAA+shvsyAwfMjUpmQpCQZIzEYHDzLsPzgB]]></acast:settings>
			<itunes:subtitle><![CDATA[Host Mike Calvin is joined by the Daily Mirror's Darren Lewis and The Sun's Dave Kidd to preview the new Premier League season. Who will win the title? Who will make the top four? Who is going to be relegated? The panel cast their eye over ev...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e518e.jpg"/>
			<description><![CDATA[Host Mike Calvin is joined by the Daily Mirror's Darren Lewis and The Sun's Dave Kidd to preview the new Premier League season. Who will win the title? Who will make the top four? Who is going to be relegated? The panel cast their eye over every team in the league and put on their tin helmets before making their predictions for the battle ahead.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Host Mike Calvin is joined by the Daily Mirror's Darren Lewis and The Sun's Dave Kidd to preview the new Premier League season. Who will win the title? Who will make the top four? Who is going to be relegated? The panel cast their eye over every team in the league and put on their tin helmets before making their predictions for the battle ahead.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Which manager is under the most pressure?</title>
			<itunes:title>Which manager is under the most pressure?</itunes:title>
			<pubDate>Mon, 31 Jul 2017 16:09:57 GMT</pubDate>
			<itunes:duration>45:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whichmanagerisunderthemostpressure-/media.mp3" length="66106325" type="audio/mpeg"/>
			<guid isPermaLink="false">ccd3b472-732f-4683-96b1-95550a7713a5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whichmanagerisunderthemostpressure-</link>
			<acast:episodeId>ccd3b472-732f-4683-96b1-95550a7713a5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whichmanagerisunderthemostpressure-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFN3zQNmZ00Gt0ZX+HmaQwS8M+e0lnkNJd5dFgx8jIo677Apqw7DqyfKMieN6pc/SSm9JrDnNiQM/k+v8FPismyqKjjDwAB9jqJ9QIFjA7UZzzyKtGmZE0OO6qRBFZ3t1ZwnED11unEKRRoXakW6RlSAfEkvzXIT0Zv9MhQcybjJKTnyHKzGRE4MC6uZ2JGaRdd/54Z3BSE+mhrpVQGCe6PWc87BnG4XWxpLfxN0Q5K1186nLwfE7qs8qB342xJmox0uEpBXrGTuf3sGKC0GlqTk0uDGIOMBO8rcjaBz7Jpm]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by the Daily Mirror's David Walker and PremierLeague.com's Adrian Clarke to discuss the latest football stories and ponder the incredible pressure on the country's leading managers as the new season approaches.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5195.jpg"/>
			<description><![CDATA[Mike Calvin is joined by the Daily Mirror's David Walker and PremierLeague.com's Adrian Clarke to discuss the latest football stories and ponder the incredible pressure on the country's leading managers as the new season approaches.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by the Daily Mirror's David Walker and PremierLeague.com's Adrian Clarke to discuss the latest football stories and ponder the incredible pressure on the country's leading managers as the new season approaches.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Neymar about to join PSG and become the first £200m footballer?</title>
			<itunes:title>Is Neymar about to join PSG and become the first £200m footballer?</itunes:title>
			<pubDate>Mon, 24 Jul 2017 16:01:09 GMT</pubDate>
			<itunes:duration>44:46</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isneymarabouttojoinpsgandbecomethefirst-200mfootballer-/media.mp3" length="85883218" type="audio/mpeg"/>
			<guid isPermaLink="false">fb69ce05-9730-4b73-9d35-62161cd5cabd</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isneymarabouttojoinpsgandbecomethefirst-200mfootballer-</link>
			<acast:episodeId>fb69ce05-9730-4b73-9d35-62161cd5cabd</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isneymarabouttojoinpsgandbecomethefirst-200mfootballer-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRG6m1sDScN+821d/9LA8ZrqrlMTWROHyCmGvdr/oXlf4xaPq2kDqYdQGoHyRXixYDoypBSQAQFVPo4qxxUEGJu9N9+rDaJ58EseaA4j7CSUKj6swQp+rzEZMdEG9O/eRvEP6KJSYZOgW9abv5I65BdXB6Ca7+z6650krcaTZAtNOaevfQEtCZHb7P/m20GSG9UzxETWGwUgvteCC09/LjGkCA8SIh+502ItuJoouBsvOV50oT3lPHC2W1zLIXtt/FH+1nVoUQo9o9Zy7TDmsMCgkRFRb1a8X6VTPE0Loatu8]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Tony Evans and Tom Hopkinson dissect the biggest transfer story of the summer as PSG ramp up their pursuit of Neymar and assess all the rumours circulating the Premier League transfer mill.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e519c.jpg"/>
			<description><![CDATA[Mike Calvin, Tony Evans and Tom Hopkinson dissect the biggest transfer story of the summer as PSG ramp up their pursuit of Neymar and assess all the rumours circulating the Premier League transfer mill.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tony Evans and Tom Hopkinson dissect the biggest transfer story of the summer as PSG ramp up their pursuit of Neymar and assess all the rumours circulating the Premier League transfer mill.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Premier League clubs are being held to ransom in the transfer market</title>
			<itunes:title>Premier League clubs are being held to ransom in the transfer market</itunes:title>
			<pubDate>Mon, 17 Jul 2017 16:18:56 GMT</pubDate>
			<itunes:duration>45:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/premierleagueclubsarebeingheldtoransominthetransfermarket/media.mp3" length="65890355" type="audio/mpeg"/>
			<guid isPermaLink="false">1042deb3-370e-476e-9329-fd72c467a330</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/premierleagueclubsarebeingheldtoransominthetransfermarket</link>
			<acast:episodeId>1042deb3-370e-476e-9329-fd72c467a330</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>premierleagueclubsarebeingheldtoransominthetransfermarket</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz962VfJ5YRzwv0ogxdmpfY1teAQyAx4KL8f/iox1UCKGRRBtNhhNh0+lDqmCpjsYhw126AYRx13vf3anaLeeotCtXVsTTfM5uyc4fRo69ejKE5EhGL1VFbugGPlx0GUoU6KCsUiu/JzljnKl1fNYO5HL6VUfKBY1OfmNO6yhAzOJYb2b+bAebBtsrkLS+y2cYA42PZNaR4mgFT1j+Bb4CW6YjFSH0Hvz9pb4ox17XBVYfLAPSR76WZfg4rsdLItVfd]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Miguel Delaney and Dom Fifield dissect the biggest transfer stories from around Europe and discuss the lack of faith in club’s academies and the emergence of feeder clubs.</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51a3.jpg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Dom Fifield dissect the biggest transfer stories from around Europe and discuss the lack of faith in club’s academies and the emergence of feeder clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Dom Fifield dissect the biggest transfer stories from around Europe and discuss the lack of faith in club’s academies and the emergence of feeder clubs.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Rooney returns home as Man Utd win Lukaku race</title>
			<itunes:title>Rooney returns home as Man Utd win Lukaku race</itunes:title>
			<pubDate>Mon, 10 Jul 2017 15:42:19 GMT</pubDate>
			<itunes:duration>46:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/rooneyreturnshomeasmanutdwinlukakurace/media.mp3" length="67350813" type="audio/mpeg"/>
			<guid isPermaLink="false">ae943d18-5566-4b71-8714-fca64d5db416</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/rooneyreturnshomeasmanutdwinlukakurace</link>
			<acast:episodeId>ae943d18-5566-4b71-8714-fca64d5db416</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>rooneyreturnshomeasmanutdwinlukakurace</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRJB0ZowVMxN1Z6ngAxuBBwDTN7oYpLAvBEw30KIqvvH1mYEshL6vWj2bQ/6HDRjDpyUA7uNswq/yL4X4qBpqReudaVwPWGi/Pyg9C/NKZn7yBIFRKCU/fXFv4wFRgct/7f7YtUC7nNEea2yyX0P36oOvp3pgqZxB5VwbqRakk52O6iUEedRvherRgivkf4uRmo+i5rZiYQBkchWr4jyMEWdv8N+SOzm5TPUqbOUHLIxfEfQWYwrvkPAEu/Gd2bT7PeRvt8BFr0PUIV0bIktr5eTqNSEPfq3fDWOF0Knb5432]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and David Walker discuss the rise of the super-agent in light of Romelu Lukaku’s big money move to Manchester United, Wayne Rooney’s return to Goodison Park and all of the other big transfer stories in the Premier Leagu...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51aa.jpg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and David Walker discuss the rise of the super-agent in light of Romelu Lukaku’s big money move to Manchester United, Wayne Rooney’s return to Goodison Park and all of the other big transfer stories in the Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and David Walker discuss the rise of the super-agent in light of Romelu Lukaku’s big money move to Manchester United, Wayne Rooney’s return to Goodison Park and all of the other big transfer stories in the Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Transfer Special – Part Two</title>
			<itunes:title>Transfer Special – Part Two</itunes:title>
			<pubDate>Tue, 27 Jun 2017 16:27:04 GMT</pubDate>
			<itunes:duration>43:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/transferspecial-parttwo/media.mp3" length="105127796" type="audio/mpeg"/>
			<guid isPermaLink="false">dd4fc26d-07d5-42a9-92d8-7336183e5d03</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/transferspecial-parttwo</link>
			<acast:episodeId>dd4fc26d-07d5-42a9-92d8-7336183e5d03</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>transferspecial-parttwo</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz975lQjCQ/2PH6mBzemYDtPp5U4WrlCq0Rh1lBg7U/PRt3QWvs/OFRhbgbGKfYwwFMu7Rv0nPYwAYLeGZ/cSrNeJ3giBC3up6O0UeKt10FSDsPDz/vaBVBp+tPDKw6GaeY4Wep22d8mMSYx/VOseOqtAsPAqHiLqwbY6AnxU4+xyXLPKPytPBudtZX3yKvODt59WEuVPjnPNrz6bCYvUgz+dYdNs5uIdkHq/QdPsy0D4Np8PgO8BJkh73r3FuNJSLP]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, John Cross and Adrian Clarke dissect the biggest transfer stories dominating the back pages and discuss the appointments of Frank de Boer and Mauricio Pellegrino at Crystal Palace and Southampton respectively. &nbsp;See acast.com/...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51b1.jpg"/>
			<description><![CDATA[Mike Calvin, John Cross and Adrian Clarke dissect the biggest transfer stories dominating the back pages and discuss the appointments of Frank de Boer and Mauricio Pellegrino at Crystal Palace and Southampton respectively.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Adrian Clarke dissect the biggest transfer stories dominating the back pages and discuss the appointments of Frank de Boer and Mauricio Pellegrino at Crystal Palace and Southampton respectively.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Transfer Special – Part One</title>
			<itunes:title>Transfer Special – Part One</itunes:title>
			<pubDate>Tue, 13 Jun 2017 18:23:35 GMT</pubDate>
			<itunes:duration>45:45</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/transferspecial-partone/media.mp3" length="66001157" type="audio/mpeg"/>
			<guid isPermaLink="false">6c7fd9a5-01f9-444e-8a39-63529ca3d4cf</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/transferspecial-partone</link>
			<acast:episodeId>6c7fd9a5-01f9-444e-8a39-63529ca3d4cf</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>transferspecial-partone</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9jiqkadCW9Y3W6y/JkPtTpusM8c2L7qncW70vs9T0hB08OLRIeWoWZwq2nFFXikLYtV/oRc/odEDJdEX3+mwEycV4oJ9lRFXHHM+HiV56dVGCVm3hEW6N71pL6TfbLuTXTl/i3lMpeR30cd86Ji+zC+4NzAgINqvtPoykGK5EQ6SQZKU4pY087/dArsGPlbJzl8j66BaCCYnEAh4Fy3a9iaJn969mwJK+g8YtnbIE8aJMif2KDTOTXuQD8XX5r59H]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Tony Evans and Tom Hopkinson to look at the biggest transfer gossip of the summer as the Premier League’s giants prepare to flex their financial muscle. &nbsp;See acast.com/privacy for privacy and opt-out information.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51b8.jpg"/>
			<description><![CDATA[Mike Calvin is joined by Tony Evans and Tom Hopkinson to look at the biggest transfer gossip of the summer as the Premier League’s giants prepare to flex their financial muscle.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Tony Evans and Tom Hopkinson to look at the biggest transfer gossip of the summer as the Premier League’s giants prepare to flex their financial muscle.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has Southgate grown into the England job?</title>
			<itunes:title>Has Southgate grown into the England job?</itunes:title>
			<pubDate>Mon, 05 Jun 2017 15:10:52 GMT</pubDate>
			<itunes:duration>45:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hassouthgategrownintotheenglandjob-/media.mp3" length="108180452" type="audio/mpeg"/>
			<guid isPermaLink="false">84101bee-eb01-4428-b402-585b03c192e7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hassouthgategrownintotheenglandjob-</link>
			<acast:episodeId>84101bee-eb01-4428-b402-585b03c192e7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hassouthgategrownintotheenglandjob-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz95aExNiH8Hz2lz+0PLp6Pu2H4gRBUEDNISO3HlPolgDA8mGTF0zuyDdqK0YQNcZTd04vZqlPYVZwPThUw5dYybkLPkQ/OauwY6axxOwWR55HH5R5lvnbocRHlTEXn4HrrahBBKvYh28cvwv0g699wiiNHs9JTExTZUFk0CsiBWkA59N9cPW26CIL2ZhIXV9dVbi7ytfj7pGXyO0Kllfv7TyKafrJxBqXihFBbfbnA/AZjkEYZLntKM2KBbNw8d5Kq]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by John Cross (Mirror) and Dom Fifield (Guardian) to look at Gareth Southgate's tenure as England manager ahead of the Three Lions' return to action against Scotland in World Cup qualifying. &nbsp;See acast.com/...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51bf.jpg"/>
			<description><![CDATA[Mike Calvin is joined by John Cross (Mirror) and Dom Fifield (Guardian) to look at Gareth Southgate's tenure as England manager ahead of the Three Lions' return to action against Scotland in World Cup qualifying.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by John Cross (Mirror) and Dom Fifield (Guardian) to look at Gareth Southgate's tenure as England manager ahead of the Three Lions' return to action against Scotland in World Cup qualifying.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Real Madrid retain the Champions League?</title>
			<itunes:title>Will Real Madrid retain the Champions League?</itunes:title>
			<pubDate>Tue, 30 May 2017 17:21:14 GMT</pubDate>
			<itunes:duration>46:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willrealmadridretainthechampionsleague-/media.mp3" length="66869419" type="audio/mpeg"/>
			<guid isPermaLink="false">d4fc9dda-abe1-42e8-a7e9-9df8cc04eff7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willrealmadridretainthechampionsleague-</link>
			<acast:episodeId>d4fc9dda-abe1-42e8-a7e9-9df8cc04eff7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willrealmadridretainthechampionsleague-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9691Y91mecEpWa8Es68Z7ApiOVVuzFVhoWOC2VKgy/ixxRdUnARkn87n5y4JzJN+N5mcvo8nFK84JJOCvwxEm5GoJpX/GBxsOpoVcbhFCOljmA0/3XKmyYV8HLLMRjr5nkJCOFde3l2S9xoxDuq/IpChRBjdiA29eANgF32USqooSGo/fNo7Q4NhUUYAw62aq0NCcS1I5JdDyb3ovxUDouOodqlV3wjIUGuvojn399Hzo1eLfAg5zUdeTdooLFNY1]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Miguel Delaney and Adrian Clarke preview the Champions League final between Juventus and Real Madrid and reflect on Arsenal’s FA Cup win over Chelsea and Man United’s Europa League triumph. &nbsp;See acast.com/privacy for privacy ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51c6.jpg"/>
			<description><![CDATA[Mike Calvin, Miguel Delaney and Adrian Clarke preview the Champions League final between Juventus and Real Madrid and reflect on Arsenal’s FA Cup win over Chelsea and Man United’s Europa League triumph.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Miguel Delaney and Adrian Clarke preview the Champions League final between Juventus and Real Madrid and reflect on Arsenal’s FA Cup win over Chelsea and Man United’s Europa League triumph.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Arsenal bid farewell to Champions League football as Terry bows out at the Bridge</title>
			<itunes:title>Arsenal bid farewell to Champions League football as Terry bows out at the Bridge</itunes:title>
			<pubDate>Mon, 22 May 2017 17:11:09 GMT</pubDate>
			<itunes:duration>45:48</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/arsenalbidfarewelltochampionsleaguefootballasterrybowsoutatthebridge/media.mp3" length="87969199" type="audio/mpeg"/>
			<guid isPermaLink="false">922bcae4-6e42-44f2-8c1b-b52b5994b853</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/arsenalbidfarewelltochampionsleaguefootballasterrybowsoutatthebridge</link>
			<acast:episodeId>922bcae4-6e42-44f2-8c1b-b52b5994b853</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>arsenalbidfarewelltochampionsleaguefootballasterrybowsoutatthebridge</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9WZDv3up/GroFhAGFxEo0nJ2654EXUYCNGd6IgsMJFLW9glffNFKK8SGgUyub0ba4K1TJbod4d/AMIHaw8De8JFwvlA+xfygkhPPlhnlNBEH1YGomiYi/H5aTSer1LO8Gp4Of4yByyeP/xq0T6P2wITI7tSojMhAmy0W8GVrsZhBPYJhxrIrXRJw13NgKIJeaZnTtyJnRwFKTxa9st3YxkCO2StC06Yk/EbwZEcyCHrHjNRhcSRd0vNdN1+TXTKkw]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Darren Lewis and Tony Evans reflect on another blockbuster Premier League season and look ahead to the Europa League and FA Cup finals. &nbsp;See acast.com/privacy for privacy and opt-out information.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51cd.jpg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Tony Evans reflect on another blockbuster Premier League season and look ahead to the Europa League and FA Cup finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Tony Evans reflect on another blockbuster Premier League season and look ahead to the Europa League and FA Cup finals.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Chelsea clinch title as Man City and Liverpool close in on top four</title>
			<itunes:title>Chelsea clinch title as Man City and Liverpool close in on top four</itunes:title>
			<pubDate>Mon, 15 May 2017 16:11:07 GMT</pubDate>
			<itunes:duration>45:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/chelseaclinchtitleasmancityandliverpoolcloseinontopfour/media.mp3" length="65875957" type="audio/mpeg"/>
			<guid isPermaLink="false">096be457-a9a6-406c-98c3-4976270f5a3c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/chelseaclinchtitleasmancityandliverpoolcloseinontopfour</link>
			<acast:episodeId>096be457-a9a6-406c-98c3-4976270f5a3c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>chelseaclinchtitleasmancityandliverpoolcloseinontopfour</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRJuoD16rpNAg5/b/nGOvFkKEUEIdoC3sX6c26lDWMm+ppLLb2OFN5dNu7bKo9hwnFrYZC+QM7xvR4x4V6K/w7oQMhV6+7yTlP0oSnyNxBxUzVPm0vs2nDkwW9/GelNI7UjttzsINjbhSjh9s87Q88YVO5C2sBSbX3AEJP098uZFrNcoEldL+44E7IS/xepNI1AVl3uxdOKrhNQFApCi+IvZMf3//bwlPfv0fE4mJVY13osCADNUo84EDzAHJU3MpE3jT9DrkID8T1pq50LmgAp8quge/i7Zt7Mah/0FT1bJL]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and Dave Kidd dissect the penultimate Premier League weekend of the season as Chelsea wrap up the title, Tottenham wave goodbye to White Hart Lane, Hull City suffer relegation and Arsenal finally look to miss out on the...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51d4.jpg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Dave Kidd dissect the penultimate Premier League weekend of the season as Chelsea wrap up the title, Tottenham wave goodbye to White Hart Lane, Hull City suffer relegation and Arsenal finally look to miss out on the top four.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Dave Kidd dissect the penultimate Premier League weekend of the season as Chelsea wrap up the title, Tottenham wave goodbye to White Hart Lane, Hull City suffer relegation and Arsenal finally look to miss out on the top four.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Spurs ‘bottle it’ at West Ham as Wenger finally beats Mourinho</title>
			<itunes:title>Spurs ‘bottle it’ at West Ham as Wenger finally beats Mourinho</itunes:title>
			<pubDate>Mon, 08 May 2017 16:18:03 GMT</pubDate>
			<itunes:duration>48:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/spurs-bottleit-atwesthamaswengerfinallybeatsmourinho/media.mp3" length="69245089" type="audio/mpeg"/>
			<guid isPermaLink="false">04949aa5-c6ad-497d-9a15-bdaa4b827166</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/spurs-bottleit-atwesthamaswengerfinallybeatsmourinho</link>
			<acast:episodeId>04949aa5-c6ad-497d-9a15-bdaa4b827166</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>spurs-bottleit-atwesthamaswengerfinallybeatsmourinho</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz91sCybtmtMAgUizbpIQRh8tFB5AuQ67Zukpan4nsEs7zQNLv7sonF7GdzOH7CnnN1DiYIhYgGjs+WqKU5MiGcxWRYLO8EmqlCIGIpXBVQ5UQijrVHrjB/sCZozow+YFCt3WSFfNOvJ91EZ/iKHPLhyczzGTGqmkNp+3WixjRN/mKSpNX1AB+Vx1faJV3NLGfmTNYwxRN4MIFYrTZCFkdF4xPUEd9c1foR59ypcAjPA1ikoIghzJiOva53jOPt3wl2]]></acast:settings>
			<itunes:subtitle>Mike Calvin, John Cross and Alyson Rudd reflect on Spurs’ shock defeat as West Ham, Arsene Wenger’s first league win over Jose Mourinho and debate why English clubs are struggling to compete in the Champions League ahead of the semi-final second legs, ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51db.jpg"/>
			<description><![CDATA[Mike Calvin, John Cross and Alyson Rudd reflect on Spurs’ shock defeat as West Ham, Arsene Wenger’s first league win over Jose Mourinho and debate why English clubs are struggling to compete in the Champions League ahead of the semi-final second legs, live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, John Cross and Alyson Rudd reflect on Spurs’ shock defeat as West Ham, Arsene Wenger’s first league win over Jose Mourinho and debate why English clubs are struggling to compete in the Champions League ahead of the semi-final second legs, live on BT Sport.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has Mourinho gone too far with Luke Shaw?</title>
			<itunes:title>Has Mourinho gone too far with Luke Shaw?</itunes:title>
			<pubDate>Tue, 02 May 2017 15:34:24 GMT</pubDate>
			<itunes:duration>43:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hasmourinhogonetoofarwithlukeshaw-/media.mp3" length="63406387" type="audio/mpeg"/>
			<guid isPermaLink="false">ec42abcf-79fc-462f-869f-b67221820fe8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hasmourinhogonetoofarwithlukeshaw-</link>
			<acast:episodeId>ec42abcf-79fc-462f-869f-b67221820fe8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hasmourinhogonetoofarwithlukeshaw-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz98FThsPlAW4EMNaqEVk0VQTKtRvqkq2h60k7OqvGeBiBBWOhtsxmRVAdmWiS5XZdr/PohknDu3iFYcejSck3tyox2lZsaOzSMnBes4SwLH9pXbT6tWzIIjMYoNxGWXBs54FpPPswT6So1uVxoXyQ+hM+Ic2xDq9nSpFiPdT2YCemyt/OkkXagLsWfA5yLuiMv72ecYtoELbTuqz2mV7fovdRknGnAdaX4t9fCfGYN116bGlcPUCBsDe1rg4+fDiO9]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin talks to journalists Dominic Fifield and David Walker about Jose Mourinho’s latest gripes, the use of video refs for diving and Tottenham’s defeat of Arsenal. ​ &nbsp;See acast.com/privacy for privacy and opt-out information.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51e2.jpg"/>
			<description><![CDATA[Mike Calvin talks to journalists Dominic Fifield and David Walker about Jose Mourinho’s latest gripes, the use of video refs for diving and Tottenham’s defeat of Arsenal. ​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin talks to journalists Dominic Fifield and David Walker about Jose Mourinho’s latest gripes, the use of video refs for diving and Tottenham’s defeat of Arsenal. ​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Missed opportunities for Spurs and City as Chelsea and Arsenal book FA Cup final spot</title>
			<itunes:title>Missed opportunities for Spurs and City as Chelsea and Arsenal book FA Cup final spot</itunes:title>
			<pubDate>Mon, 24 Apr 2017 16:26:30 GMT</pubDate>
			<itunes:duration>44:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/missedopportunitiesforspursandcityaschelseaandarsenalbookfacupfinalspot/media.mp3" length="64047411" type="audio/mpeg"/>
			<guid isPermaLink="false">27abdbc9-d86e-4e4e-8a73-1ea8a18d3ac5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/missedopportunitiesforspursandcityaschelseaandarsenalbookfacupfinalspot</link>
			<acast:episodeId>27abdbc9-d86e-4e4e-8a73-1ea8a18d3ac5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>missedopportunitiesforspursandcityaschelseaandarsenalbookfacupfinalspot</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9yh6KPrrG4laTyp8KGyHQlSePlrY+hafObTuQ3H6JlP/D8KwfIAwD1iu80FqydJacLzhSI+pQgaeSSH+/X0pLkcYan9sqsdiZnRROLGE8T7HiCEdNeE+ADuRWNYBqgzljwCaqhH23qlniirClEzC5oCyeW6q5g+MHbidr7+xRMuXU+KrQ/hPuya347Ip0pHdV59Mt+UyH44nW5529Fn3NYmVFiHZ8KgJOqX1GA0Khs+U7N+XrHVWZN2QZ1+n39Zyz]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Tom Hopkinson and Tony Evans dissect Arsenal and Chelsea’s FA Cup semi-final triumphs, the race for the Premier League top four and the relegation dogfight as Middlesbrough and Sunderland slip closer to relegation. &nbsp;See acast...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51e9.jpg"/>
			<description><![CDATA[Mike Calvin, Tom Hopkinson and Tony Evans dissect Arsenal and Chelsea’s FA Cup semi-final triumphs, the race for the Premier League top four and the relegation dogfight as Middlesbrough and Sunderland slip closer to relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tom Hopkinson and Tony Evans dissect Arsenal and Chelsea’s FA Cup semi-final triumphs, the race for the Premier League top four and the relegation dogfight as Middlesbrough and Sunderland slip closer to relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[It's game on in the title race]]></title>
			<itunes:title><![CDATA[It's game on in the title race]]></itunes:title>
			<pubDate>Tue, 18 Apr 2017 18:52:43 GMT</pubDate>
			<itunes:duration>44:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/itsgameoninthetitlerace/media.mp3" length="64296559" type="audio/mpeg"/>
			<guid isPermaLink="false">05b59c58-53d0-4d0e-a888-32aad2293662</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/itsgameoninthetitlerace</link>
			<acast:episodeId>05b59c58-53d0-4d0e-a888-32aad2293662</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>itsgameoninthetitlerace</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRGgYKF4lFYLw19EDu2NRqIcYN8oYpF80kCCfn6U0j4dwyK3dA52a/uq/8yOmsxkVFzf5Ci2c2ICESo1tDGR+kNUD05MZP0A79p8WkMIa0KyMmE1jQC+z3fDWsLOVGvz3/1AGzGLIZL1wXJD2OzEE61fwBvgT0XE3fIfFLS3357r9Mg9kkdFw3LeYnq4LP9b9ZYR09+mGWhJlvfRP/aPicGatJhY1C4FVXNHluH3R/r7DPrMb5MnKx3Fxl2WqiobosGw/U6ekG+ThUXAk+/koNjHCuHT8WLemzBPwOwfJ38xS]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by journalists John Cross and Jonathan Norcroft, who say Saturday's FA Cup semi-final between Chelsea and Tottenham could be pivotal. &nbsp;See acast.com/privacy for privacy and opt-out information.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51f0.jpg"/>
			<description><![CDATA[Mike Calvin is joined by journalists John Cross and Jonathan Norcroft, who say Saturday's FA Cup semi-final between Chelsea and Tottenham could be pivotal.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by journalists John Cross and Jonathan Norcroft, who say Saturday's FA Cup semi-final between Chelsea and Tottenham could be pivotal.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>United should give Zlatan a two-year contract</title>
			<itunes:title>United should give Zlatan a two-year contract</itunes:title>
			<pubDate>Mon, 10 Apr 2017 17:32:56 GMT</pubDate>
			<itunes:duration>44:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/unitedshouldgivezlatanatwo-yearcontract/media.mp3" length="85237412" type="audio/mpeg"/>
			<guid isPermaLink="false">ab8f6a91-4b14-4e11-b4af-50c860405749</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/unitedshouldgivezlatanatwo-yearcontract</link>
			<acast:episodeId>ab8f6a91-4b14-4e11-b4af-50c860405749</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>unitedshouldgivezlatanatwo-yearcontract</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz94Q6c5SVf2QgaIxK7Tahq11Qsm7QmDLL/1anThAuD69ZnKjTnuTo0zlMFdEfJof/pYr0CZEhXcgifvHyhBEsVTRXDOVYazpYj4HGW5VQjmKmKi2Ye5JIK6dJpKOjpb+SHiBhGqjB+9SrQzp0SHfiCn4ONUj3TpBY9TUzw6pPc2LzoMpaNGwINzIWGzG0f3yQgQ1PfOJYKqL5uZ7kHImuJFNYsncSKwdrCT2jUE00eWonwn1tWEv4vPudzhOU4qde6]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by the Daily Mirror's Darren Lewis and Miguel Delaney of The Independent, who discuss the importance of Ibrahimovic to Man Utd and whether Leicester can pull off another miracle in the Champions League. &nbsp;See aca...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51f7.jpg"/>
			<description><![CDATA[Mike Calvin is joined by the Daily Mirror's Darren Lewis and Miguel Delaney of The Independent, who discuss the importance of Ibrahimovic to Man Utd and whether Leicester can pull off another miracle in the Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by the Daily Mirror's Darren Lewis and Miguel Delaney of The Independent, who discuss the importance of Ibrahimovic to Man Utd and whether Leicester can pull off another miracle in the Champions League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Chelsea 'can't lose title from here']]></title>
			<itunes:title><![CDATA[Chelsea 'can't lose title from here']]></itunes:title>
			<pubDate>Tue, 04 Apr 2017 15:46:59 GMT</pubDate>
			<itunes:duration>44:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/chelseacantlosetitlefromhere/media.mp3" length="64155083" type="audio/mpeg"/>
			<guid isPermaLink="false">245600fe-fa78-4de0-bb53-2766a61f6d8a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/chelseacantlosetitlefromhere</link>
			<acast:episodeId>245600fe-fa78-4de0-bb53-2766a61f6d8a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>chelseacantlosetitlefromhere</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9OMD3OaLcciiqgxbFpqV3tkcld05Xamtwl8ifF+wx3DEgsdWPHBcsO+69rf5BEyWW3KAZwoRdSNoOUMvSx39qy6tMHeyg+GDirqj9lSBUUGH0U6kEDlxYScglQr/mMCuzRiB/5nyYgBdWaUJkeaj8zJ4eHYfsmfwEinPeS73rgzbAu2i0jDGP7iDRwfotCKUJ3m6e6JKVvai1d6Eo815/1FWVuXOgvC/peFMs7Vb9uoulEeRpY1ZLxRpM82+4xmv8]]></acast:settings>
			<itunes:subtitle><![CDATA[Journalists Adrian Clarke and Tom Hopkinson join Mike Calvin to discuss whether Blues fans should be worried, and if Alexis Sanchez is damaging team spirit at Arsenal. &nbsp;See acast.com/privacy for privacy and opt-out information.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e51fe.jpg"/>
			<description><![CDATA[Journalists Adrian Clarke and Tom Hopkinson join Mike Calvin to discuss whether Blues fans should be worried, and if Alexis Sanchez is damaging team spirit at Arsenal.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Journalists Adrian Clarke and Tom Hopkinson join Mike Calvin to discuss whether Blues fans should be worried, and if Alexis Sanchez is damaging team spirit at Arsenal.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Man City primed for top-four battle as Arsenal and Chelsea await</title>
			<itunes:title>Man City primed for top-four battle as Arsenal and Chelsea await</itunes:title>
			<pubDate>Mon, 27 Mar 2017 15:23:47 GMT</pubDate>
			<itunes:duration>44:01</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mancityprimedfortop-fourbattleasarsenalandchelseaawait/media.mp3" length="84420298" type="audio/mpeg"/>
			<guid isPermaLink="false">4bd09bf8-e9ae-46fe-b6de-1f2d91359222</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mancityprimedfortop-fourbattleasarsenalandchelseaawait</link>
			<acast:episodeId>4bd09bf8-e9ae-46fe-b6de-1f2d91359222</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mancityprimedfortop-fourbattleasarsenalandchelseaawait</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRAn/Pa2959BkQw192Mfqi5dtZTXm+Jhp/UD/hDXtRZTIsnO3BNVs5C4EJoYXcP/zsV5umO4R5rOyy4nZO4MHEZrYVbMTGpFCjG4Oq3X4F5zQfoiPusRFJfvFSDAk+ugBi28k0kpMJUXoTwwBL191L4kmB3KAC0Zbb65RGxSx/RUwXOdIMwBBoXqLED9UhwM281UGWtTHN7COteu7uFJSkxbJEEXt6djbBdU8YiXmT+pTGZ1qt5NL3sPDkZ+/KofXdOkdhwaudLxTaOdLY1yiHT+rf7ogl5Yhtq7OEUm1pDlM]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Jonathan Northcroft and Dom Fifield assess Man City’s progress under Pep Guardiola ahead of two huge Premier League fixtures at Arsenal and Chelsea, Liverpool’s Merseyside derby date with in-form Everton and how England are adapting to lif...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5205.jpg"/>
			<description><![CDATA[Mike Calvin, Jonathan Northcroft and Dom Fifield assess Man City’s progress under Pep Guardiola ahead of two huge Premier League fixtures at Arsenal and Chelsea, Liverpool’s Merseyside derby date with in-form Everton and how England are adapting to life under Gareth Southgate.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Jonathan Northcroft and Dom Fifield assess Man City’s progress under Pep Guardiola ahead of two huge Premier League fixtures at Arsenal and Chelsea, Liverpool’s Merseyside derby date with in-form Everton and how England are adapting to life under Gareth Southgate.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Arsenal in crisis as Chelsea march on towards the title</title>
			<itunes:title>Arsenal in crisis as Chelsea march on towards the title</itunes:title>
			<pubDate>Mon, 20 Mar 2017 16:22:21 GMT</pubDate>
			<itunes:duration>45:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/arsenalincrisisaschelseamarchontowardsthetitle/media.mp3" length="66201477" type="audio/mpeg"/>
			<guid isPermaLink="false">2169149e-05ac-43eb-b57d-c1ffec4118e5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/arsenalincrisisaschelseamarchontowardsthetitle</link>
			<acast:episodeId>2169149e-05ac-43eb-b57d-c1ffec4118e5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>arsenalincrisisaschelseamarchontowardsthetitle</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPbGF22hCnSufZngHFPERUKBcQnWJ+woHSmL8fcba0BwwfwEnOQJQLCrorGmK1SJEVKb3e6h2bfsmlGSdupBnig7FP8yBwzj9T0ggDjCqMzksZvmaiGCcQzQBDLBGm45Zx9VlNmMMkJy2jH5eCxAUeQCMg9xRoSS4ZctI0s42EasCPlNmqqpxE5MxzbSWWOPeka/EZJEw0n7j+g7Bi2mePD9wG/xfPOerYc0zgwQt6b9WxSda6WTzkOd15XDzaSq51HL7krkLILyX81jgmqL5W9iKc7XR9RiDE4PIG//nbm7]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Tony Evans and David Walker dissect Arsene Wenger’s lowest point as Arsenal manager, the Premier League title and relegation races, and Gareth Southgate’s latest England squad selection ahead of the international break. &nbsp;See ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e520c.jpg"/>
			<description><![CDATA[Mike Calvin, Tony Evans and David Walker dissect Arsene Wenger’s lowest point as Arsenal manager, the Premier League title and relegation races, and Gareth Southgate’s latest England squad selection ahead of the international break.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tony Evans and David Walker dissect Arsene Wenger’s lowest point as Arsenal manager, the Premier League title and relegation races, and Gareth Southgate’s latest England squad selection ahead of the international break.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can City win the Champions League this season?</title>
			<itunes:title>Can City win the Champions League this season?</itunes:title>
			<pubDate>Mon, 13 Mar 2017 17:25:11 GMT</pubDate>
			<itunes:duration>45:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/cancitywinthechampionsleaguethisseason-/media.mp3" length="66041221" type="audio/mpeg"/>
			<guid isPermaLink="false">f5eaee48-e9ea-4b81-814a-0cabb8a6e7cd</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/cancitywinthechampionsleaguethisseason-</link>
			<acast:episodeId>f5eaee48-e9ea-4b81-814a-0cabb8a6e7cd</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>cancitywinthechampionsleaguethisseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz925eWi4PrFejNrZ44btUJ4YH2Auds9VaYHt61gkl28n3GF4X8wZ1BGydzNEW/HnbS3feUGVo4MMBwVkIxozzUU88NwhujPVdjN9/taBb1vAy//dL9kUmoIRvV1+TKxiy0Uhd7BQY2Tlac5GoAaH8f/FI/HRbHwpg7EplS2lz3J8ecZ+gUreFl8qjj1HBVuIyg8ONN6XxDnLG6OtxBLSrGcEC9cQ0P0/tZ6KyWe0cwRA9ug+MokeEWESc56RrL9qki]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by John Cross (Mirror) and Miguel Delaney (Independent) to discuss all the goings on in this year’s Champions League, including Barca’s incredible comeback last week and whether City can hold on to their 2 goal lead in Monaco, as ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5213.jpg"/>
			<description><![CDATA[Mike Calvin is joined by John Cross (Mirror) and Miguel Delaney (Independent) to discuss all the goings on in this year’s Champions League, including Barca’s incredible comeback last week and whether City can hold on to their 2 goal lead in Monaco, as well as looking ahead to all this weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by John Cross (Mirror) and Miguel Delaney (Independent) to discuss all the goings on in this year’s Champions League, including Barca’s incredible comeback last week and whether City can hold on to their 2 goal lead in Monaco, as well as looking ahead to all this weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Sanchez on the way out of Arsenal?</title>
			<itunes:title>Is Sanchez on the way out of Arsenal?</itunes:title>
			<pubDate>Mon, 06 Mar 2017 18:35:55 GMT</pubDate>
			<itunes:duration>45:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/issanchezonthewayoutofarsenal-/media.mp3" length="64973265" type="audio/mpeg"/>
			<guid isPermaLink="false">91ed122f-be36-45ae-9635-4ca9f67f03b5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/issanchezonthewayoutofarsenal-</link>
			<acast:episodeId>91ed122f-be36-45ae-9635-4ca9f67f03b5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>issanchezonthewayoutofarsenal-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPPYuXG06fpO7hC4J+TEfvlbFPqRiEiFSSypkIH6sU5evjFUu31Uqory++B0blkF0KiT7CLVjCSH6h8U/01S2aUWSUDBJObWGXENsZBNQ9QF2YK1tzjBXzYGcOCmXfyhjymn23cNYg1KP6lR6o4QJwvsy9lqipb2kUpuHjci8ckJfp3zqTegcuVQo440B9FQtAKOQ3+8ChELdwHbjgAlfNwUS1AhoNJHS5xZbgigZF6MvEstfqO5EhPsoHLClx9E/ZLTgbGfYVCPlEhXprlMeJrAhDzZ541Zuu6l4ginWCfB]]></acast:settings>
			<itunes:subtitle>Mike Calvin, Darren Lewis and Adrian Clarke assess the latest setback at Arsenal as they drop Alexis Sanchez and drop out of the top four, while the pod also dissect the other big stories from the Premier League and look ahead to the next round of Cham...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e521a.jpg"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Adrian Clarke assess the latest setback at Arsenal as they drop Alexis Sanchez and drop out of the top four, while the pod also dissect the other big stories from the Premier League and look ahead to the next round of Champions League and Europa League fixtures.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Adrian Clarke assess the latest setback at Arsenal as they drop Alexis Sanchez and drop out of the top four, while the pod also dissect the other big stories from the Premier League and look ahead to the next round of Champions League and Europa League fixtures.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Were Leicester right to sack Ranieri?</title>
			<itunes:title>Were Leicester right to sack Ranieri?</itunes:title>
			<pubDate>Mon, 27 Feb 2017 18:52:02 GMT</pubDate>
			<itunes:duration>29:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/wereleicesterrighttosackranieri-/media.mp3" length="71279228" type="audio/mpeg"/>
			<guid isPermaLink="false">7927de86-48ed-4726-9b55-89e19ef1afd6</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/wereleicesterrighttosackranieri-</link>
			<acast:episodeId>7927de86-48ed-4726-9b55-89e19ef1afd6</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>wereleicesterrighttosackranieri-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRMhi8ILIkolZFIl0IpRf285tLqt10X1PtfPXIqPppIdnxaMN5xYyGeaNES2M2FX0IiQla+JiSu0UILGA8AUMfYZEX5m+sobDMtJ8aE6DWcXnrVbjCPwvxQDDSO5ED0QHLbcvf4fD3pGcxGy/+iB4oPwQPt5s1Ny0DpnABLE0YjfC1DNBdga1tMecjGP+/EUnGNL0lmgzHS4AMCt/W+6B9tnB/I4/SysGOreo+5G4xxu/IyV8tcsoC+AHCHxY2kXU+pNZSfI4laGvOxr0N20eJS42UcAuuiWuxa7ijJf3a0Cl]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Dominic Fifield and Tom Hopkinson to discuss the sacking of Claudio Ranieri, Manchester United’s League Cup final win over Southampton and Liverpool’s colossal ‘top-four’ clash with Arsenal, live on BT Sport on Saturday. ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5221.jpg"/>
			<description><![CDATA[Mike Calvin is joined by Dominic Fifield and Tom Hopkinson to discuss the sacking of Claudio Ranieri, Manchester United’s League Cup final win over Southampton and Liverpool’s colossal ‘top-four’ clash with Arsenal, live on BT Sport on Saturday.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Dominic Fifield and Tom Hopkinson to discuss the sacking of Claudio Ranieri, Manchester United’s League Cup final win over Southampton and Liverpool’s colossal ‘top-four’ clash with Arsenal, live on BT Sport on Saturday.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Mourinho pick up his first trophy as United boss?</title>
			<itunes:title>Will Mourinho pick up his first trophy as United boss?</itunes:title>
			<pubDate>Mon, 20 Feb 2017 17:00:14 GMT</pubDate>
			<itunes:duration>33:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willmourinhopickuphisfirsttrophyasunitedboss-/media.mp3" length="47885343" type="audio/mpeg"/>
			<guid isPermaLink="false">773b6034-069d-4ea7-8169-b8d1fcb90ad0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willmourinhopickuphisfirsttrophyasunitedboss-</link>
			<acast:episodeId>773b6034-069d-4ea7-8169-b8d1fcb90ad0</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willmourinhopickuphisfirsttrophyasunitedboss-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRC/AIlqX750ckpgfyPWSOCK/6A071XsLNSPkeS305A3mPfS3Hu7Fp+Qx0pq+eqSCOqMc2+oXLvGGwXezJ4LchRTaAKzMTZob72KwD3tpC3X7++M+fgMCE6hs3dyEnKm0hvTmHuU0tWEndfLv2phBHgqcxY0ktSRgSkocgNW7zSxWgrACt0ujYtQ3fS0KMKXShs+0oo6RtZe5DDsfynf/fmKwSzTYZr0I4b5BOO7gfEumeAIJ3LxlVoOGx73u3Un+DH4ZxZrVgODJW21hmlmb34fsacosNUFgB1Sytw5Hc2Nl]]></acast:settings>
			<itunes:subtitle><![CDATA[John Cross and Jonathan Northcroft join Mike Calvin to preview the week's action, including the EFL Cup final between Manchester United and Southampton at Wembley. The trio also review a superb week of FA Cup fifth round action and look ahead to t...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5228.jpg"/>
			<description><![CDATA[John Cross and Jonathan Northcroft join Mike Calvin to preview the week's action, including the EFL Cup final between Manchester United and Southampton at Wembley. The trio also review a superb week of FA Cup fifth round action and look ahead to the latest round of 16 Champions League fixtures.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[John Cross and Jonathan Northcroft join Mike Calvin to preview the week's action, including the EFL Cup final between Manchester United and Southampton at Wembley. The trio also review a superb week of FA Cup fifth round action and look ahead to the latest round of 16 Champions League fixtures.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Arsenal finally beat Bayern?</title>
			<itunes:title>Will Arsenal finally beat Bayern?</itunes:title>
			<pubDate>Mon, 13 Feb 2017 19:45:00 GMT</pubDate>
			<itunes:duration>30:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willarsenalfinallybeatbayern-/media.mp3" length="72747092" type="audio/mpeg"/>
			<guid isPermaLink="false">dffdf091-6a51-498f-af13-892de9f867b5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willarsenalfinallybeatbayern-</link>
			<acast:episodeId>dffdf091-6a51-498f-af13-892de9f867b5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willarsenalfinallybeatbayern-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREOdy8xBI3vhi6q68dq0h4i5waoX5ITl1puJ/kX0iU8avuG5mr69ynZG3LE7f0Tvv2zaVHSB2qTh8//K2wPewR0+OT0QnLZSwHMehkL9A9YzTknSuQBbXlnHLFYfI/9OxbkWNZMcuAAMQsDWBwu4xQlur3Q7j84QsmMf0bKy6IZsSnFQUpzMo8DPMfO+nKRV2CRjHrUbk7T67stRH2gp4bVHYZMPiUhQJ7h1+pySYceKHtaRufpElGao/D3CWlht2lDOtYeacOPqsUMMgX3dtnRnynm1b7NYK3BSS9kOOqbY]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by ESPN’s Tony Evans and Tom Collomosse of the Evening Standard to discuss Arsenal’s chances against Bayern Munich in the Champions League and what lies ahead for Arsene Wenger regardless of the result. The team also look ahead to...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e522f.jpg"/>
			<description><![CDATA[Mike Calvin is joined by ESPN’s Tony Evans and Tom Collomosse of the Evening Standard to discuss Arsenal’s chances against Bayern Munich in the Champions League and what lies ahead for Arsene Wenger regardless of the result. The team also look ahead to Man Utd and Spurs in the Europa League and all the weekend’s FA Cup action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by ESPN’s Tony Evans and Tom Collomosse of the Evening Standard to discuss Arsenal’s chances against Bayern Munich in the Champions League and what lies ahead for Arsene Wenger regardless of the result. The team also look ahead to Man Utd and Spurs in the Europa League and all the weekend’s FA Cup action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is it time for Wenger to go?</title>
			<itunes:title>Is it time for Wenger to go?</itunes:title>
			<pubDate>Mon, 06 Feb 2017 18:47:30 GMT</pubDate>
			<itunes:duration>32:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isittimeforwengertogo-/media.mp3" length="76919960" type="audio/mpeg"/>
			<guid isPermaLink="false">a8d733c9-3408-43e1-ac6a-440e61cd8317</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isittimeforwengertogo-</link>
			<acast:episodeId>a8d733c9-3408-43e1-ac6a-440e61cd8317</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isittimeforwengertogo-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9uStq3KjJpo2DUROt3inNcqt43IxQjpyDwwTQAq61CxAYW7T9/BUeAnRB3v6esjx07ar3ykhUTmNxc6e9KuNgejMnbmSkfB2LedUB4k9rUiiHxnXI9w7JNcBQoxhVE1fvSiCNcAhx0CAQOTBpbch/X9BRufIw3zOA4ULh3VYvlSuoZ2zOjDGz0D3Msxn0yXLBg+JTHNbmgIiDfiVUVCzhCG61pXqQS/S21rc/NpVUt+KnBhokMaYjGees5hQxVfEu]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Miguel Delaney and Darren Lewis to dissect a rollercoaster Premier League weekend, including Arsenal's familiar February crumble, Chelsea's relentless pursuit of the title, the impact of Gabriel Jesus and the fight to...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5236.jpg"/>
			<description><![CDATA[Mike Calvin is joined by Miguel Delaney and Darren Lewis to dissect a rollercoaster Premier League weekend, including Arsenal's familiar February crumble, Chelsea's relentless pursuit of the title, the impact of Gabriel Jesus and the fight to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Miguel Delaney and Darren Lewis to dissect a rollercoaster Premier League weekend, including Arsenal's familiar February crumble, Chelsea's relentless pursuit of the title, the impact of Gabriel Jesus and the fight to avoid relegation.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is this the week Chelsea wrap up the title?</title>
			<itunes:title>Is this the week Chelsea wrap up the title?</itunes:title>
			<pubDate>Mon, 30 Jan 2017 17:38:21 GMT</pubDate>
			<itunes:duration>33:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthistheweekchelseawrapupthetitle-/media.mp3" length="47757639" type="audio/mpeg"/>
			<guid isPermaLink="false">f23348fb-3f9c-412a-a4a3-a0d301666182</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthistheweekchelseawrapupthetitle-</link>
			<acast:episodeId>f23348fb-3f9c-412a-a4a3-a0d301666182</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthistheweekchelseawrapupthetitle-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRA6kWrQW7z146vZpJTLa1b5bWp7IPXKsDuLt1lflcCFY72soLMFhS/K5lIa4ja2ZDMzIhW6k9k10RhFZWTART1FPT8bP2FS+3WDLSbwNURIqdjhh8ujZ0R1d/hpSmIQDE9XBrCl+6v8ExyehGznE+XwBuE6zafnHjutLmBgMK9174YUwtbFDJuGR1yXDcxGMMMgac32H9jIdU8gY9VpFSy/J8FzA3aAwJBXhD8/ElJlPT7xQ+Im3k8Gpi8xVp1DLPH3m2WQ3IB9kK6uJRqQd9hpkGsQ8o0OZqb6IpqkkZQqS]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by David Walker and Adrian Clarke to preview a huge week in the Premier League title race as Chelsea face Liverpool and Arsenal, plus a look at the latest January transfer dealings and the future of Wayne Rooney. &nbsp;Se...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e523d.jpg"/>
			<description><![CDATA[Mike Calvin is joined by David Walker and Adrian Clarke to preview a huge week in the Premier League title race as Chelsea face Liverpool and Arsenal, plus a look at the latest January transfer dealings and the future of Wayne Rooney.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by David Walker and Adrian Clarke to preview a huge week in the Premier League title race as Chelsea face Liverpool and Arsenal, plus a look at the latest January transfer dealings and the future of Wayne Rooney.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Chelsea’s title? Is it all over for Liverpool?</title>
			<itunes:title>Chelsea’s title? Is it all over for Liverpool?</itunes:title>
			<pubDate>Mon, 23 Jan 2017 18:10:24 GMT</pubDate>
			<itunes:duration>32:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/chelsea-stitle-isitalloverforliverpool-/media.mp3" length="47604895" type="audio/mpeg"/>
			<guid isPermaLink="false">031c60ef-83f0-4b89-a209-0ec1ea12df4a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/chelsea-stitle-isitalloverforliverpool-</link>
			<acast:episodeId>031c60ef-83f0-4b89-a209-0ec1ea12df4a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>chelsea-stitle-isitalloverforliverpool-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9b7G9RpINmYXocJg+A6I0n01Bu6TobDjpVtwiyA5EKJpwgYpcCE4jXb3BXkLsRpg26Tr3PhQn10Jpd2Fe79NcECV21LNTzFtBx5NeO58tbfJgtIJQs58nf7rPEMnHEDU67aZynXoSVGkqdbK8T9umwBkyW4ycWC7t2Wleqq7cs8ZRsN0FUssLZ26HE/D9sTdqtqNl/JjH03OhPzPni5lza9kh4biEhPZusLda4LY1Q8LLqJA9obEu0tR51HpHNijZ]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Tony Evans and Jonathan Northcroft to discuss another dramatic Premier League weekend at both ends of the table as Liverpool and Tottenham lose ground to Chelsea in the title race and Swansea boost their survival hopes. Plus a ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5244.jpg"/>
			<description><![CDATA[Mike Calvin is joined by Tony Evans and Jonathan Northcroft to discuss another dramatic Premier League weekend at both ends of the table as Liverpool and Tottenham lose ground to Chelsea in the title race and Swansea boost their survival hopes. Plus a look ahead to the League Cup semi-finals and the FA Cup fourth round.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Tony Evans and Jonathan Northcroft to discuss another dramatic Premier League weekend at both ends of the table as Liverpool and Tottenham lose ground to Chelsea in the title race and Swansea boost their survival hopes. Plus a look ahead to the League Cup semi-finals and the FA Cup fourth round.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Man City to miss out on the top four?</title>
			<itunes:title>Man City to miss out on the top four?</itunes:title>
			<pubDate>Mon, 16 Jan 2017 17:34:23 GMT</pubDate>
			<itunes:duration>34:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mancitytomissoutonthetopfour-/media.mp3" length="81615872" type="audio/mpeg"/>
			<guid isPermaLink="false">e80ed6e4-939d-4962-a8e1-b55ff19c8c1c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mancitytomissoutonthetopfour-</link>
			<acast:episodeId>e80ed6e4-939d-4962-a8e1-b55ff19c8c1c</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mancitytomissoutonthetopfour-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9x8W6QKIgf90SJ2Bhh5/SmJ3PimPRshfhTYIG34Txu+MMIHnX7rj9NWHkDuRp9bcj8s4l+5DYXyEaCAKT4F9J87cvmR0dzhg0TNrEpvsQUTABKwkSZLFQV6b5jswMSgwphYoAiZMvNLsfo+okySni1Wjy/nFZ6GD5f+7wVn9Xq3JW5AK5Qfk+B1+t+pajJBWSRkUwuajtCE1fzfRrFsgdMRz51U2t+LrQaU/Gyu7vSUnAc3Lx4KeQxAUpZ8j8SDO/]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by John Cross (Mirror) and Dominic Fifield (Guardian) to discuss Man City’s woeful display at Goodison Park, player loyalty, the lure of the Chinese Super League, and whether Tottenham and Liverpool can challenge Chelsea for the P...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e524b.jpg"/>
			<description><![CDATA[Mike Calvin is joined by John Cross (Mirror) and Dominic Fifield (Guardian) to discuss Man City’s woeful display at Goodison Park, player loyalty, the lure of the Chinese Super League, and whether Tottenham and Liverpool can challenge Chelsea for the Premier League title.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by John Cross (Mirror) and Dominic Fifield (Guardian) to discuss Man City’s woeful display at Goodison Park, player loyalty, the lure of the Chinese Super League, and whether Tottenham and Liverpool can challenge Chelsea for the Premier League title.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[United v Liverpool: Chelsea's two closest challengers for the title?]]></title>
			<itunes:title><![CDATA[United v Liverpool: Chelsea's two closest challengers for the title?]]></itunes:title>
			<pubDate>Mon, 09 Jan 2017 18:35:17 GMT</pubDate>
			<itunes:duration>33:54</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/unitedvliverpool-chelseastwoclosestchallengersforthetitle-/media.mp3" length="81305804" type="audio/mpeg"/>
			<guid isPermaLink="false">c85528a3-533b-419b-aeb5-bd56c9f31b3a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/unitedvliverpool-chelseastwoclosestchallengersforthetitle-</link>
			<acast:episodeId>c85528a3-533b-419b-aeb5-bd56c9f31b3a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>unitedvliverpool-chelseastwoclosestchallengersforthetitle-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9udJzp0THs9SJexcr1nhu7WSI4qTK3Ssw9LMY978HT1O8JYjZPxPnW7kM7C14KiTz2D5NOOxR0/fsPpLzyTLtMFjHkCp9xHZIuxJv7oP9/NHufkUwrE6K6q1C5LglHtP2T/WF1WIEy0v7ftq8th2SOF2XaY70CRgQEmND5y3tNRWUaW3TiO8Dko7Sz4pTZDNaEPEMQgjmhLYoL0zPgglGlXdx9yIJ9zQeKnCeQrBPcEILj9U8JKk4GR5GcBVhN1Ps]]></acast:settings>
			<itunes:subtitle><![CDATA[Adrian Clarke (Arsenal TV) and Tom Hopkinson (Mirror) join Mike Calvin to discuss Mourinho's meeting with Klopp this Sunday and whether these two sides are the most likely to challenge Chelsea for the title - as well as all other goings on at the ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5252.jpg"/>
			<description><![CDATA[Adrian Clarke (Arsenal TV) and Tom Hopkinson (Mirror) join Mike Calvin to discuss Mourinho's meeting with Klopp this Sunday and whether these two sides are the most likely to challenge Chelsea for the title - as well as all other goings on at the top and bottom of the Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Adrian Clarke (Arsenal TV) and Tom Hopkinson (Mirror) join Mike Calvin to discuss Mourinho's meeting with Klopp this Sunday and whether these two sides are the most likely to challenge Chelsea for the title - as well as all other goings on at the top and bottom of the Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Man Utd win the FA Cup again?</title>
			<itunes:title>Will Man Utd win the FA Cup again?</itunes:title>
			<pubDate>Mon, 02 Jan 2017 07:00:00 GMT</pubDate>
			<itunes:duration>24:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willmanutdwinthefacupagain-/media.mp3" length="58359728" type="audio/mpeg"/>
			<guid isPermaLink="false">9df5b19c-b6d8-42f2-a420-79a8a99397ab</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willmanutdwinthefacupagain-</link>
			<acast:episodeId>9df5b19c-b6d8-42f2-a420-79a8a99397ab</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willmanutdwinthefacupagain-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9HGxjVLM57VWfGnEadEIUFwHa4t9qPwDluhMc5hmzOcK8ZtgUo6xqFvjkXJqNC7W2vxFCcN6yLGldT3ZPZHiML/Gju/9einT7Gp7kYTDymGIQR8lMkG/qAEaC9iKzDPMAJjovuSEu9yP5w85gKolIM7jpNGkJTOYu9RGpGHSPPTQ4gFEuMy7DlMD0MI117sTUSkbFlU1U/VGiohrarjY6I6ZnjZY3asPbP5PNWc1K293kK48DdGnBYaeHqS3rReE8]]></acast:settings>
			<itunes:subtitle>​Jonathan Northcroft (Times) and Tony Evans (Standard) join Mike Calvin to discuss the big games from the FA Cup third round. Will Mourinho focus on defending it for United? Is it Liverpool’s year with Klopp at the helm, or is it a season for the minno...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5259.jpg"/>
			<description><![CDATA[​Jonathan Northcroft (Times) and Tony Evans (Standard) join Mike Calvin to discuss the big games from the FA Cup third round. Will Mourinho focus on defending it for United? Is it Liverpool’s year with Klopp at the helm, or is it a season for the minnows?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[​Jonathan Northcroft (Times) and Tony Evans (Standard) join Mike Calvin to discuss the big games from the FA Cup third round. Will Mourinho focus on defending it for United? Is it Liverpool’s year with Klopp at the helm, or is it a season for the minnows?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Premier League mid-season review</title>
			<itunes:title>Premier League mid-season review</itunes:title>
			<pubDate>Mon, 26 Dec 2016 13:29:29 GMT</pubDate>
			<itunes:duration>26:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/premierleaguemid-seasonreview/media.mp3" length="51655733" type="audio/mpeg"/>
			<guid isPermaLink="false">6a50c5c5-cd72-420d-b193-755635ae62e7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/premierleaguemid-seasonreview</link>
			<acast:episodeId>6a50c5c5-cd72-420d-b193-755635ae62e7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>premierleaguemid-seasonreview</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRGofb8EprJGdVZRBDwzrw21xlcDWLXdQdLqoZYEMbDsryufxX2IJw+ftAfxN/CNqzyuLKLaHqGl45Mkbx9bKPsLyrYslUgwzpzUK/zhz5ZuNdm4ayTmzR5pY6/aAiyYiUuUZq8+z07UA/sZFeTNCthkmi/H6rhQkZy6KpXS8QCBzVSEQ6NWXdtYGIBCy1X0igkKNcQSI4jdYWaMRYGLo+8NqhDVHtv4jvu9InrF7TjICE4xqcdulljN/k9Xmfm0xHaMz+cyNTjCmQDen5t4+V1tFvdA+Zag3ESnmF1v6Houm]]></acast:settings>
			<itunes:subtitle><![CDATA[The Football Writers team have a look at the season so far, assessing how all sides in the Premier League have performed up until Christmas, who’s over-performing, which managers are in trouble and who needs what in January. &nbsp;See acast.co...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5260.jpg"/>
			<description><![CDATA[The Football Writers team have a look at the season so far, assessing how all sides in the Premier League have performed up until Christmas, who’s over-performing, which managers are in trouble and who needs what in January.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[The Football Writers team have a look at the season so far, assessing how all sides in the Premier League have performed up until Christmas, who’s over-performing, which managers are in trouble and who needs what in January.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Have Arsenal’s wheels fallen off sooner than usual?</title>
			<itunes:title>Have Arsenal’s wheels fallen off sooner than usual?</itunes:title>
			<pubDate>Mon, 19 Dec 2016 16:35:45 GMT</pubDate>
			<itunes:duration>32:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/havearsenal-swheelsfallenoffsoonerthanusual-/media.mp3" length="47541043" type="audio/mpeg"/>
			<guid isPermaLink="false">397212b8-14a9-416f-a319-408607cbb319</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/havearsenal-swheelsfallenoffsoonerthanusual-</link>
			<acast:episodeId>397212b8-14a9-416f-a319-408607cbb319</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>havearsenal-swheelsfallenoffsoonerthanusual-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROtxInawmdltNdECeJaQLcgdHsWqySXh0hvrmAijsZYnqpFiYgmCp1iDsZp/lNQNHE9y7i8Dk40fATjRlL5qFoQhH0PyLIklWK4M275LnVrxfR+uhW/yRwu5ijUsCHFWXxAkUrw+GTo3AsMNEMv+A8R2Gj3fFuNdiExHxYgoMAfzITWTirDYpfkxrSPsIN3PIeTXiVUNkSBXauZFBm+xQadJZ8KwaY2Y+ZOp4lalQGL/COj8z/GEDg+quqhvdkoKdV/nNeX8NDag5A2GEd6r/SclDT5OpSnDr0fp1+i9tzb4]]></acast:settings>
			<itunes:subtitle><![CDATA[Jonathan Northcroft (Telegraph) and Tony Evans (Evening Standard) join Mike Calvin to discuss Arsenal’s recent dip in form, Chelsea’s unbeaten run and all other goings on at the top and bottom of the Premier League table &nbsp;See acast.com/pr...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5267.jpg"/>
			<description><![CDATA[Jonathan Northcroft (Telegraph) and Tony Evans (Evening Standard) join Mike Calvin to discuss Arsenal’s recent dip in form, Chelsea’s unbeaten run and all other goings on at the top and bottom of the Premier League table<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Jonathan Northcroft (Telegraph) and Tony Evans (Evening Standard) join Mike Calvin to discuss Arsenal’s recent dip in form, Chelsea’s unbeaten run and all other goings on at the top and bottom of the Premier League table<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is this Arsenal’s year to beat Bayern?</title>
			<itunes:title>Is this Arsenal’s year to beat Bayern?</itunes:title>
			<pubDate>Mon, 12 Dec 2016 19:22:10 GMT</pubDate>
			<itunes:duration>31:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthisarsenal-syeartobeatbayern-/media.mp3" length="61053658" type="audio/mpeg"/>
			<guid isPermaLink="false">9848e26b-a086-4856-93a0-ccd7227437ec</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthisarsenal-syeartobeatbayern-</link>
			<acast:episodeId>9848e26b-a086-4856-93a0-ccd7227437ec</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthisarsenal-syeartobeatbayern-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRHoDm6KWdBs05N8Qh84K94yST5z2V9WW+t8Fdj1/CKGzZMIfegHwTV7RBk6BqRIOs1LAXRZqT72VI5ZPPcw4aUjZo65RJocTWAIXMrk3jQRdmcop8JVKhwQHaXcuhpnQmnuVjNQmW6lPE2feTW4GJ55UIy6xa7OOEerAXXIbHE98MSmyApCkmmxXv7EwbuudhXuqKD6JMA7daMIP8cb4HbjLCc45h3LOywcP0YFzYik8bDzrAf/SJGMnljSXVZfoIVkVYAeM6SmaqnMF/u5qG3BjQfBnOrwU2usSwa85VlOC]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by Dom Fifield (Guardian) and Tom Collomosse (Standard) to discuss the Champions League and Europa League draws and what lies ahead for the 5 English teams still in Europe, as well as analysis of last weekend’s football and a look...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e526e.jpg"/>
			<description><![CDATA[Mike Calvin is joined by Dom Fifield (Guardian) and Tom Collomosse (Standard) to discuss the Champions League and Europa League draws and what lies ahead for the 5 English teams still in Europe, as well as analysis of last weekend’s football and a look ahead to an action packed week with 20 Premier League matches.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Dom Fifield (Guardian) and Tom Collomosse (Standard) to discuss the Champions League and Europa League draws and what lies ahead for the 5 English teams still in Europe, as well as analysis of last weekend’s football and a look ahead to an action packed week with 20 Premier League matches.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Chelsea collapse shows Guardiola’s Man City are far from flawless</title>
			<itunes:title>Chelsea collapse shows Guardiola’s Man City are far from flawless</itunes:title>
			<pubDate>Mon, 05 Dec 2016 18:32:17 GMT</pubDate>
			<itunes:duration>32:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/chelseacollapseshowsguardiola-smancityarefarfromflawless/media.mp3" length="62964973" type="audio/mpeg"/>
			<guid isPermaLink="false">7758600e-103b-4bc7-914f-c761e4b7c605</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/chelseacollapseshowsguardiola-smancityarefarfromflawless</link>
			<acast:episodeId>7758600e-103b-4bc7-914f-c761e4b7c605</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>chelseacollapseshowsguardiola-smancityarefarfromflawless</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFtjLUD5/370+B4O00DA4pGphkuknjwQPFgERY7pdynvC4quh6oRO+OrqKBM1zTALfrh9X4Ow/6brD24HSN6wncyK5o5GWS0YX23eXTHlhu15u/vsvegrzEVbHM1D2BUKFjBq9py5I2+SBq/uLMd+I8H2le2x4/jEVJG0jfI0S0iinuHKGXhWSiGp7nazVbff4iVJCGZHE/WjeLVgImFaXlu6Wdy/NpMvaYOvqJMaSlqidOTeJf/HZQkBVVOmaJm3A66uopFzPQIjcspBAKtpIxkT3DIwvOqOb1NCEdWcGji]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by John Cross and Adrian Clarke to round up the biggest football stories from the weekend, including Man City’s collapse against Chelsea, Man United’s inability to close out matches, Leicester’s relegation fears and whether Liverp...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5275.jpg"/>
			<description><![CDATA[Mike Calvin is joined by John Cross and Adrian Clarke to round up the biggest football stories from the weekend, including Man City’s collapse against Chelsea, Man United’s inability to close out matches, Leicester’s relegation fears and whether Liverpool’s defence is strong enough to make them genuine title challengers.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by John Cross and Adrian Clarke to round up the biggest football stories from the weekend, including Man City’s collapse against Chelsea, Man United’s inability to close out matches, Leicester’s relegation fears and whether Liverpool’s defence is strong enough to make them genuine title challengers.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Chelsea now title favourites?</title>
			<itunes:title>Are Chelsea now title favourites?</itunes:title>
			<pubDate>Mon, 28 Nov 2016 18:30:42 GMT</pubDate>
			<itunes:duration>35:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/arechelseanowtitlefavourites-/media.mp3" length="84486872" type="audio/mpeg"/>
			<guid isPermaLink="false">788122bd-3668-4525-9443-695017622579</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/arechelseanowtitlefavourites-</link>
			<acast:episodeId>788122bd-3668-4525-9443-695017622579</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>arechelseanowtitlefavourites-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9zHTn6nOxIO5v48BunA3igPDHW2WTZxJFPj04XG7gIagFfSo1G0C6BfzGUloqBgTNboVPXpaXbSBORgcAYLKoFZ37vGnyIpGkiwblwAGMqpBOBhIHN8cV236oh/vr+popccbtGn+wFgywUko26DlBCKoJDXGi/yVuOsoO95jm03+0RMF3gCfzm5GuwvLwpjDs4kzQAJSi68FpJodOfKsa0UAWFSZQKnd57HTuuiV4I/P+CGQ3fEjcfy189kWebv6S]]></acast:settings>
			<itunes:subtitle>Miguel Delaney (Sunday Independent) and Darren Lewis (Daily Mirror) join Mike Calvin to discuss Chelsea’s fantastic form under Conte, whether Man City and Liverpool are their only title rivals and more issues for Mourinho and Man Utd – with live questi...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e527c.jpg"/>
			<description><![CDATA[Miguel Delaney (Sunday Independent) and Darren Lewis (Daily Mirror) join Mike Calvin to discuss Chelsea’s fantastic form under Conte, whether Man City and Liverpool are their only title rivals and more issues for Mourinho and Man Utd – with live questions from users on the BT Sport Facebook page.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Miguel Delaney (Sunday Independent) and Darren Lewis (Daily Mirror) join Mike Calvin to discuss Chelsea’s fantastic form under Conte, whether Man City and Liverpool are their only title rivals and more issues for Mourinho and Man Utd – with live questions from users on the BT Sport Facebook page.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Spurs bury memories of Battle of Stamford Bridge?</title>
			<itunes:title>Can Spurs bury memories of Battle of Stamford Bridge?</itunes:title>
			<pubDate>Tue, 22 Nov 2016 15:24:18 GMT</pubDate>
			<itunes:duration>32:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canspursburymemoriesofbattleofstamfordbridge-/media.mp3" length="79051808" type="audio/mpeg"/>
			<guid isPermaLink="false">7584792e-6131-4d47-a637-da4bffe0be8a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canspursburymemoriesofbattleofstamfordbridge-</link>
			<acast:episodeId>7584792e-6131-4d47-a637-da4bffe0be8a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canspursburymemoriesofbattleofstamfordbridge-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRO9kKWZwVjFe0OOf4XqkB9qAExQHdiioKEEifNcwftir67woh6YXeeyTCwNxgTXBtBGKrzCF6qz3A5TqvMCRsbH01FxWQCOKp4rhAojdtSAX/3ao0Kr4/nGuSdyPRbiQ5QIHbvG5wr6ZwP1Aeb0qA2ajEeu6WGZQDMN5ZdHLw+1lNpnLH+mSc5q7IiBUtyN8zCJsQ54vKg8kAaPNDFw8GaFjRO8szRN0AvtCxUzpP7qJW3ZV1TD4jYlj/EjxgLseVsF6ovRz60/dIiZRQQPpRXea3nqHWRtrcEuORVKbhdkj]]></acast:settings>
			<itunes:subtitle><![CDATA[Martin Lipton (Sun) and Jim Holden (Sunday Express) join Mike Calvin to discuss Tottenham’s return to Stamford Bridge, following the capitulation in May that ended their Premier League title bid. &nbsp;See acast.com/privacy for privacy and opt...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5283.jpg"/>
			<description><![CDATA[Martin Lipton (Sun) and Jim Holden (Sunday Express) join Mike Calvin to discuss Tottenham’s return to Stamford Bridge, following the capitulation in May that ended their Premier League title bid.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Martin Lipton (Sun) and Jim Holden (Sunday Express) join Mike Calvin to discuss Tottenham’s return to Stamford Bridge, following the capitulation in May that ended their Premier League title bid.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Mourinho vs Wenger – Who comes out on top?</title>
			<itunes:title>Mourinho vs Wenger – Who comes out on top?</itunes:title>
			<pubDate>Mon, 14 Nov 2016 16:29:51 GMT</pubDate>
			<itunes:duration>30:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/mourinhovswenger-whocomesoutontop-/media.mp3" length="71972444" type="audio/mpeg"/>
			<guid isPermaLink="false">b8d7c818-0389-4349-9c2f-621360b8d088</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/mourinhovswenger-whocomesoutontop-</link>
			<acast:episodeId>b8d7c818-0389-4349-9c2f-621360b8d088</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>mourinhovswenger-whocomesoutontop-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRH9Y9Ja1of3X6tRxRMFsJzSSKQovn2uAamc2LTPM48BArKswhB6qcpR2Dv8yWbXs+dj9P+nIFff5MaS0qyoXJ/lJeuLjoyfL1fLKWBDV1BwzFtYMdUVt9y7kzQNXjGop3xNqzVQN9VJkulTFqCY6XPha9i+scopPh/E4JjOMJW45QQixQrHzrbqcSBKn+VjgvPNEmjhDSfWuW0ilurasYdUW4paaOM8hDlDNFgogIa77HVOaWJzyzLJ2JgLoD8D0AGKtJ9bfKtyM8UWHeow6dAbCv2GF62MWLTw+LHu3uLAZ]]></acast:settings>
			<itunes:subtitle>Jonathan Northcroft (Sunday Times) and Tom Hopkinson (The People) join Mike Calvin to discuss the animosity between Jose Mourinho and Arsene Wenger and whose team is faring better going into their match this weekend. The panel also discuss Conte’s impr...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e528a.jpg"/>
			<description><![CDATA[Jonathan Northcroft (Sunday Times) and Tom Hopkinson (The People) join Mike Calvin to discuss the animosity between Jose Mourinho and Arsene Wenger and whose team is faring better going into their match this weekend. The panel also discuss Conte’s impressive start to life at Chelsea, and what Liverpool need to bring in in January.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Jonathan Northcroft (Sunday Times) and Tom Hopkinson (The People) join Mike Calvin to discuss the animosity between Jose Mourinho and Arsene Wenger and whose team is faring better going into their match this weekend. The panel also discuss Conte’s impressive start to life at Chelsea, and what Liverpool need to bring in in January.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>England v Scotland: Career defining for both managers?</title>
			<itunes:title>England v Scotland: Career defining for both managers?</itunes:title>
			<pubDate>Mon, 07 Nov 2016 17:32:10 GMT</pubDate>
			<itunes:duration>30:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/englandvscotland-careerdefiningforbothmanagers-/media.mp3" length="72535160" type="audio/mpeg"/>
			<guid isPermaLink="false">e325639b-9b42-4aa6-8183-83a9562fe6e4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/englandvscotland-careerdefiningforbothmanagers-</link>
			<acast:episodeId>e325639b-9b42-4aa6-8183-83a9562fe6e4</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>englandvscotland-careerdefiningforbothmanagers-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRLEnJ/7UwMO3uMytYl5yNwKRgwmiHjoBr0kg/GgWAwrt209z9XJL/V8sD/x5dxWoz+IujtIiDbuEdYhnINwNGVeTnncvB60Q8aF9Dsi6sRXw1qjqbmAo5i8hIbZk4GRN8q5xXgxIUhcOPHg+tJZg6r9oRMjwwiUb0S34KyrYHv6CwfvDDO07VIOuWHy4Expkj5GNyPYVbGDXUgOAjyh//5hAulrgaDihrbqG3WrJ4EEgkC87yzvwn1NlhdYsRBkhbgQHdnZBWU4nM/2IJu+n5ZZHBEgaivmSF9QGogyhBeoA]]></acast:settings>
			<itunes:subtitle><![CDATA[Tony Evans (Evening Standard) and Adrian Clarke (PremerLeague.com) join Mike Calvin to discuss England’s match against Scotland, the futures of both teams’ managers and all the goings on at both ends of the Premier League. &nbsp;See acast.com/...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5291.jpg"/>
			<description><![CDATA[Tony Evans (Evening Standard) and Adrian Clarke (PremerLeague.com) join Mike Calvin to discuss England’s match against Scotland, the futures of both teams’ managers and all the goings on at both ends of the Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Tony Evans (Evening Standard) and Adrian Clarke (PremerLeague.com) join Mike Calvin to discuss England’s match against Scotland, the futures of both teams’ managers and all the goings on at both ends of the Premier League.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is this the biggest ever North London derby?</title>
			<itunes:title>Is this the biggest ever North London derby?</itunes:title>
			<pubDate>Mon, 31 Oct 2016 16:40:28 GMT</pubDate>
			<itunes:duration>31:39</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthisthebiggestevernorthlondonderby-/media.mp3" length="60724668" type="audio/mpeg"/>
			<guid isPermaLink="false">07f5fc5a-1628-4e5e-a477-420f957c6bc5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthisthebiggestevernorthlondonderby-</link>
			<acast:episodeId>07f5fc5a-1628-4e5e-a477-420f957c6bc5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthisthebiggestevernorthlondonderby-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9hZqTgDER4Wj9Hbo6NH3H2jklW+K3KfOcGkBK1Geq79DfFQOOtJHNfJjMPHsRV6o9DA+CX5iBO3hwX8tAJTu2xUUaM5AOYwEsBTLZ7jRdAAApl2M6IvSmfBqPARFHRuPkLyVon0LFjjGZE+JvL68tR1bEG1nnrJZJxsrtYPlbzbSnotwK6d/JKxr3WckiJAqZczkatIzTlzfFirw6Lasm0drH/2yRz318cPCGoAxAph7A+gHmwbsHUF6zG16VUNsp]]></acast:settings>
			<itunes:subtitle>Tom Hopkinson (The People) and David Walker (Daily Mirror) join Mike Calvin to discuss wherever this week’s North London derby will showcase this season’s champions, a massive game for City against Barcelona in the Champions League on Tuesday, Mourinho...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5298.jpg"/>
			<description><![CDATA[Tom Hopkinson (The People) and David Walker (Daily Mirror) join Mike Calvin to discuss wherever this week’s North London derby will showcase this season’s champions, a massive game for City against Barcelona in the Champions League on Tuesday, Mourinho’s struggles at United and a potential transfer for Wayne Rooney to Everton.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Tom Hopkinson (The People) and David Walker (Daily Mirror) join Mike Calvin to discuss wherever this week’s North London derby will showcase this season’s champions, a massive game for City against Barcelona in the Champions League on Tuesday, Mourinho’s struggles at United and a potential transfer for Wayne Rooney to Everton.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is the Mourinho era over?</title>
			<itunes:title>Is the Mourinho era over?</itunes:title>
			<pubDate>Mon, 24 Oct 2016 17:04:25 GMT</pubDate>
			<itunes:duration>33:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthemourinhoeraover-/media.mp3" length="32189541" type="audio/mpeg"/>
			<guid isPermaLink="false">92e42941-7344-4ca3-80a0-1e7fd14edafe</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthemourinhoeraover-</link>
			<acast:episodeId>92e42941-7344-4ca3-80a0-1e7fd14edafe</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthemourinhoeraover-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREE9Ux3M9+fND/llD7rvF99NsS5p2kEuP3KnFa/p7qSq7HhcyaO46weGNUSc/+2Xd98vJmGavKsjimS4em5uqFqrgZWbLnykCRuU5aR733kD6LILkyGHiOS/YIAJyZm8XOXqMQNdt1S1WnHzir0oODjtrGCGQJ/5Y6bUdhICB+6vYtjIpfKd7k9eRwufqqU9TEdJk9xS2sbAIa7pxev5z7ylVK+We0J96v8FJIhAQDnRy3IT4uY8zcExyZsWEIM8bJKTGZzxc2Za+fc1W/HUkdWeszjPMu1xDRs5f9AZIJ6z]]></acast:settings>
			<itunes:subtitle><![CDATA[Dom Fifield (Guardian) and Darren Lewis (Mirror) join Mike Calvin to discuss Mourinho’s vast issues at Manchester United, problems for Pep at City and recent resurgences for Chelsea and Liverpool. &nbsp;See acast.com/privacy for privacy and op...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e529f.jpg"/>
			<description><![CDATA[Dom Fifield (Guardian) and Darren Lewis (Mirror) join Mike Calvin to discuss Mourinho’s vast issues at Manchester United, problems for Pep at City and recent resurgences for Chelsea and Liverpool.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Dom Fifield (Guardian) and Darren Lewis (Mirror) join Mike Calvin to discuss Mourinho’s vast issues at Manchester United, problems for Pep at City and recent resurgences for Chelsea and Liverpool.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Pep take down Barcelona?</title>
			<itunes:title>Can Pep take down Barcelona?</itunes:title>
			<pubDate>Mon, 17 Oct 2016 13:20:55 GMT</pubDate>
			<itunes:duration>32:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canpeptakedownbarcelona-/media.mp3" length="76769624" type="audio/mpeg"/>
			<guid isPermaLink="false">32245534-f677-4c45-8530-403d6d4213e5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canpeptakedownbarcelona-</link>
			<acast:episodeId>32245534-f677-4c45-8530-403d6d4213e5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canpeptakedownbarcelona-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROpiEQCZrK+rgMw2RQLFb3bZdGn4yTXQtCne01rAeKlKCdapPjsvBUMuyF5W+1E3eC/gD1gGx4i7iCTMxj0F2ne2gWfZ+6WlsStdxsB4DtbviRCK3tZ9HRFkjhGsentN2MkqqscRt5lYwyu6mpQPixHAnZ3bwpUnifLQ8KDRKlRaGKUbziYPBvhOfZf4uwdTfYajnVF0RspmRIFKGwQk0n/Hnkg7i2/EPr4hhSyrwvMSC4bN/J5QRuPrRJNjRNX2RDCOKDrEQ/AbKV0WDp30yiJLIJZZ27aj3FfMUiZlAbzl]]></acast:settings>
			<itunes:subtitle><![CDATA[John Cross and Adrian Clarke join Mike Calvin to discuss a huge match for City and Pep in the Champions League, Walcott’s new-found form at Arsenal, and Spurs’ chances of winning the title. &nbsp;See acast.com/privacy for privacy and opt-out i...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52a6.jpg"/>
			<description><![CDATA[John Cross and Adrian Clarke join Mike Calvin to discuss a huge match for City and Pep in the Champions League, Walcott’s new-found form at Arsenal, and Spurs’ chances of winning the title.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[John Cross and Adrian Clarke join Mike Calvin to discuss a huge match for City and Pep in the Champions League, Walcott’s new-found form at Arsenal, and Spurs’ chances of winning the title.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Klopp’s Liverpool maintain their title challenge for the whole season?</title>
			<itunes:title>Will Klopp’s Liverpool maintain their title challenge for the whole season?</itunes:title>
			<pubDate>Mon, 10 Oct 2016 15:10:25 GMT</pubDate>
			<itunes:duration>34:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willklopp-sliverpoolmaintaintheirtitlechallengeforthewholeseason-/media.mp3" length="33096933" type="audio/mpeg"/>
			<guid isPermaLink="false">be680c42-3560-4527-87c9-bb003fbe8664</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willklopp-sliverpoolmaintaintheirtitlechallengeforthewholeseason-</link>
			<acast:episodeId>be680c42-3560-4527-87c9-bb003fbe8664</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willklopp-sliverpoolmaintaintheirtitlechallengeforthewholeseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz94ANq6b/XlxuwtNxQlQ3e4YtFMka+CeZw7ky8F8iI1diUA4RJa7jfY98exhooeMyrAHWIYy3wGibne38mDcm0XKNwswL/0zDpjeYmYHmQhruQE2hVlL6pV/zGu7DTVeGwP+I01gvI0rq0IBNPMsDI28S6zWgdXuY7Q6BnDTQtZHRRVwAWE4sL0rd2QNwQdnive7B6jwLMm7QMYpylCLy/TrzcfZJ1lHITcg0SU8xUxIMCgebhYNeobGZxNrN7uzoz]]></acast:settings>
			<itunes:subtitle>Jonathan Northcroft and Tony Evans join Mike Calvin to discuss Klopp’s new training regime at Liverpool, what the future holds for Danny Sturridge and Jordan Henderson and the crisis unfolding around Wayne Rooney and Man Utd. Plus all the biggest talki...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52ad.jpg"/>
			<description><![CDATA[Jonathan Northcroft and Tony Evans join Mike Calvin to discuss Klopp’s new training regime at Liverpool, what the future holds for Danny Sturridge and Jordan Henderson and the crisis unfolding around Wayne Rooney and Man Utd. Plus all the biggest talking points ahead of this weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Jonathan Northcroft and Tony Evans join Mike Calvin to discuss Klopp’s new training regime at Liverpool, what the future holds for Danny Sturridge and Jordan Henderson and the crisis unfolding around Wayne Rooney and Man Utd. Plus all the biggest talking points ahead of this weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is it important that England stick with an English manager?</title>
			<itunes:title>Is it important that England stick with an English manager?</itunes:title>
			<pubDate>Mon, 03 Oct 2016 15:23:45 GMT</pubDate>
			<itunes:duration>30:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isitimportantthatenglandstickwithanenglishmanager-/media.mp3" length="29892705" type="audio/mpeg"/>
			<guid isPermaLink="false">57070987-59c0-4ea8-a578-c433f96fab04</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isitimportantthatenglandstickwithanenglishmanager-</link>
			<acast:episodeId>57070987-59c0-4ea8-a578-c433f96fab04</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isitimportantthatenglandstickwithanenglishmanager-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz90hDSBMS1Y3tv/nxXgxtwuUlmbwP5+106orNd1B5waQea3ijm1EadVLTh2P8CCLd+nUZgTCkPA9sa0CWQzjdUjVUDE57dngjhgIMIbfv5Fmf5shO1AsnEFKqpch+MIyFgv02zQYkCkMpjBDk47uYDZYuQuaqLSK8BsfSK59cdNwrorSRpqwvU4Yx+O6dPZ96Xymrk6he8ggIGTx5p6sh7kFCgMjfz807/qW9WkLVQD1Z9R3vZh2Gi38wY6yMKRbfp]]></acast:settings>
			<itunes:subtitle>Darren Lewis and Tom Collomosse join Mike Calvin to discuss Gareth Southgate and the future of the England national team – as well as all the Premier League action from the weekend, including Mourinho’s outdated tactics, the Pogba problem and Pochettin...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52b4.jpg"/>
			<description><![CDATA[Darren Lewis and Tom Collomosse join Mike Calvin to discuss Gareth Southgate and the future of the England national team – as well as all the Premier League action from the weekend, including Mourinho’s outdated tactics, the Pogba problem and Pochettino’s growing dynasty at Tottenham.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Darren Lewis and Tom Collomosse join Mike Calvin to discuss Gareth Southgate and the future of the England national team – as well as all the Premier League action from the weekend, including Mourinho’s outdated tactics, the Pogba problem and Pochettino’s growing dynasty at Tottenham.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are Manchester City approaching the perfect squad?</title>
			<itunes:title>Are Manchester City approaching the perfect squad?</itunes:title>
			<pubDate>Mon, 26 Sep 2016 15:59:38 GMT</pubDate>
			<itunes:duration>33:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/aremanchestercityapproachingtheperfectsquad-/media.mp3" length="32134080" type="audio/mpeg"/>
			<guid isPermaLink="false">88c54065-26c8-475c-8327-5263083d0dbd</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/aremanchestercityapproachingtheperfectsquad-</link>
			<acast:episodeId>88c54065-26c8-475c-8327-5263083d0dbd</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>aremanchestercityapproachingtheperfectsquad-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9KPBBUNSnO8Ya2PctlTzlCf8vQWEk/gYquyq8IMJh/mA5uVLIfd70wysY3SjRctPRCNuilbJ6rVB703LgewDHipZnK+iNZlxskktb7HyyD/7xjTjyfnntwMzzHvAArQUsm3lzvmKcDVaPINHz+DSJ22oupqqi83ZLJBFprfMXdRKsgdOmXjLXAK1Zh8LbqEHnUCtGd1HQ0YylXTvBkGX4D1KeCSfyjPMoBa6HYhfsLMU7CXLW9Qz6GlCOq6gbW9sy]]></acast:settings>
			<itunes:subtitle><![CDATA[Dom Fifield and Tom Hopkinson join Mike Calvin to discuss what the future holds for Wayne Rooney, City’s 10/10 start under Pep and Chelsea’s defensive and midfield struggles. &nbsp;See acast.com/privacy for privacy and opt-out information.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52bb.jpg"/>
			<description><![CDATA[Dom Fifield and Tom Hopkinson join Mike Calvin to discuss what the future holds for Wayne Rooney, City’s 10/10 start under Pep and Chelsea’s defensive and midfield struggles.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Dom Fifield and Tom Hopkinson join Mike Calvin to discuss what the future holds for Wayne Rooney, City’s 10/10 start under Pep and Chelsea’s defensive and midfield struggles.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is it time for Mourinho to drop Rooney?</title>
			<itunes:title>Is it time for Mourinho to drop Rooney?</itunes:title>
			<pubDate>Mon, 19 Sep 2016 14:51:21 GMT</pubDate>
			<itunes:duration>32:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isittimeformourinhotodroprooney-/media.mp3" length="31218348" type="audio/mpeg"/>
			<guid isPermaLink="false">990f9530-dada-486f-91d0-5a3b5e10f338</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isittimeformourinhotodroprooney-</link>
			<acast:episodeId>990f9530-dada-486f-91d0-5a3b5e10f338</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isittimeformourinhotodroprooney-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREVB84oh3XuvRjs/uT7vvjDGA/pxr5Bb8sa9QxGTIPeHhWvwnLoIjyUJeo25GU6QaL6y3lKBvJv/mNcD8M7dIV5fQUjsZlddJqjx2FAnmcHY+C0QI+fZttDpF4ukeHOO8tZbb10+EXQkPI37bxteEaaiGj0NPn1O6M00R9MS6rR9tJfeOcudmmPm7fA4qi++PSoAAb8bullO1lafW7vzZyh/gaaiBIqwa+xs54PLspBTkg8Jhdg2Ei6qvA0eFpDWRYEWdIlrxSMvW4Uo5YBy0R6kG9BQIYbhRqiCpGcU0XlX]]></acast:settings>
			<itunes:subtitle>Miguel Delaney and John Cross join Mike Calvin to discuss Manchester United’s recent downturn in form under Jose Mourinho, whether Liverpool are genuine title contenders and BT Sport’s live televised Premier League game this weekend between London riva...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52c2.jpg"/>
			<description><![CDATA[Miguel Delaney and John Cross join Mike Calvin to discuss Manchester United’s recent downturn in form under Jose Mourinho, whether Liverpool are genuine title contenders and BT Sport’s live televised Premier League game this weekend between London rivals Arsenal and Chelsea.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Miguel Delaney and John Cross join Mike Calvin to discuss Manchester United’s recent downturn in form under Jose Mourinho, whether Liverpool are genuine title contenders and BT Sport’s live televised Premier League game this weekend between London rivals Arsenal and Chelsea.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Are any British clubs good enough to win Champions League this year?</title>
			<itunes:title>Are any British clubs good enough to win Champions League this year?</itunes:title>
			<pubDate>Mon, 12 Sep 2016 15:44:04 GMT</pubDate>
			<itunes:duration>31:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/areanybritishclubsgoodenoughtowinchampionsleaguethisyear-/media.mp3" length="30455655" type="audio/mpeg"/>
			<guid isPermaLink="false">ce63a4b8-2869-4769-b419-f3ca5a0ef9f5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/areanybritishclubsgoodenoughtowinchampionsleaguethisyear-</link>
			<acast:episodeId>ce63a4b8-2869-4769-b419-f3ca5a0ef9f5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>areanybritishclubsgoodenoughtowinchampionsleaguethisyear-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRGuwZODqAWCwVbVQepgkV4dqKwwBirLIG3+Yv3Obe9tvhsxreP0Kx8Gg9nxIaOgoWzjEvaX1aIiG2tDUK/K2TuhF7VvE1qCfmwQ4zdT963V8rIXjOBqWzA0huMykTqxQboxVqfGs5QpCNJbEhP71g2XBwM9qj9sNEXsVYkUlq2njDJ5OKmuV5sVqeZWFM+9jb3RTnsaJbEdR/VLUObkvreKK/5fpr9Y+jSMTzOtW1mlSD+mvMVTxnW4giihFvJzC2LTxNGHIDvuOCxOm7SzfJivwCszt3JwQ7ACSXa9jc9zJ]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin is joined by Jim Holden of the Daily Express and Tony Evans from the evening Standard to discuss Champions League and Europe League games for Britain’s top clubs this week and look ahead to the weekend’s Premier League action. &nbs...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52c9.jpg"/>
			<description><![CDATA[Mike Calvin is joined by Jim Holden of the Daily Express and Tony Evans from the evening Standard to discuss Champions League and Europe League games for Britain’s top clubs this week and look ahead to the weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by Jim Holden of the Daily Express and Tony Evans from the evening Standard to discuss Champions League and Europe League games for Britain’s top clubs this week and look ahead to the weekend’s Premier League action.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>The Manchester Derby: Who is in better shape going in?</title>
			<itunes:title>The Manchester Derby: Who is in better shape going in?</itunes:title>
			<pubDate>Mon, 05 Sep 2016 14:19:49 GMT</pubDate>
			<itunes:duration>31:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/themanchesterderby-whoisinbettershapegoingin-/media.mp3" length="29910636" type="audio/mpeg"/>
			<guid isPermaLink="false">75a20287-ac69-467f-968f-c1d8bc2ffd6a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/themanchesterderby-whoisinbettershapegoingin-</link>
			<acast:episodeId>75a20287-ac69-467f-968f-c1d8bc2ffd6a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>themanchesterderby-whoisinbettershapegoingin-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPKetMXXadC5ap+jkYMp5tNjA2g19rdbRIdROH+0dyBgCCszH0b2nVdU6mLu5aTxw2Xeta/sEOGEIydpx1JenxMivr9QZzFjOLILJJ0YITOi5U2URmcA7Rrsh0YbdsWIVwwSjJXH2e15YgosUis20Zkaqapm7eJMBYaf9J9in+hnKqDTfaLktEg+ghfE37GG+vbS/ghiBhhV26/68pupGqi1Y0IHodCjCptcyCWKmeCVxhQanSGJhUu6I00j5r88O8aOGtdnxwM4MH+mzoYkVTiK1Gvz0B7L1Cs/kXW+8Nek]]></acast:settings>
			<itunes:subtitle><![CDATA[The Sunday Mirror's Tom Hopkinson and Adrian Clarke of Arsenal TV join Mike Calvin to discuss which of the Manchester teams have had better starts to the season, Chelsea's resurgence under Conte and how England faired in their first match und...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52d0.jpg"/>
			<description><![CDATA[The Sunday Mirror's Tom Hopkinson and Adrian Clarke of Arsenal TV join Mike Calvin to discuss which of the Manchester teams have had better starts to the season, Chelsea's resurgence under Conte and how England faired in their first match under Sam Allardyce.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[The Sunday Mirror's Tom Hopkinson and Adrian Clarke of Arsenal TV join Mike Calvin to discuss which of the Manchester teams have had better starts to the season, Chelsea's resurgence under Conte and how England faired in their first match under Sam Allardyce.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has Big Sam made a Rash decision?</title>
			<itunes:title>Has Big Sam made a Rash decision?</itunes:title>
			<pubDate>Tue, 30 Aug 2016 13:42:15 GMT</pubDate>
			<itunes:duration>31:35</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hasbigsammadearashdecision-/media.mp3" length="30469416" type="audio/mpeg"/>
			<guid isPermaLink="false">f9e3528d-c230-4fc1-9cf3-8e090b4d152b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hasbigsammadearashdecision-</link>
			<acast:episodeId>f9e3528d-c230-4fc1-9cf3-8e090b4d152b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hasbigsammadearashdecision-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9PuPUwvuOoaD+ddUJQJb0R31YD2QJMLLWW3me8MgbX1nCpd3xflw59sP0QBRe4Z0oy8Klf5MDVcbHRfIbDCQrECeC7ghz9jSpuBHonQguDerr+uVuhDI6Rf9O+LDa9Nfltcjxah+qyciOBRXQKmCq1n5vVrL+rdxYr1sAGCKG70VaZXZYUgqKCl0wYtoia6su6FsAf0IEJdUmnTpsPpQSYlDoSkiJh4MW4lFr8WDPmB8aRDed467xP7IAfLxCz1aN]]></acast:settings>
			<itunes:subtitle><![CDATA[Daily Mirror pair David Walker and Darren Lewis discuss the ins and outs of Sam Allardyce's first England squad, including the omission of Marcus Rashford and Ross Barkley.  &nbsp;See acast.com/privacy for privacy and opt-out information.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52d7.jpg"/>
			<description><![CDATA[Daily Mirror pair David Walker and Darren Lewis discuss the ins and outs of Sam Allardyce's first England squad, including the omission of Marcus Rashford and Ross Barkley.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Daily Mirror pair David Walker and Darren Lewis discuss the ins and outs of Sam Allardyce's first England squad, including the omission of Marcus Rashford and Ross Barkley.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Ibrahimovic the new Cantona?</title>
			<itunes:title>Is Ibrahimovic the new Cantona?</itunes:title>
			<pubDate>Mon, 22 Aug 2016 14:18:08 GMT</pubDate>
			<itunes:duration>33:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isibrahimovicthenewcantona-/media.mp3" length="32365939" type="audio/mpeg"/>
			<guid isPermaLink="false">3257240d-c960-401c-bb17-c211664687a8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isibrahimovicthenewcantona-</link>
			<acast:episodeId>3257240d-c960-401c-bb17-c211664687a8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isibrahimovicthenewcantona-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz98pOUFs4ak8DWZWlcrl5bOUadhDzfIrHT9TTmbUjRFjnOK0GeGGieWy03gTNrLtnCOJVyXRi2/QvnoKpE+OB7WujCJQh9vS+ZNfG6MRY0VcoAxIaEVeNw9C99mX1CfP5H96i9Y4BgaHW9zhs8dW6PszHE2js1WZMIiDTjrcGQYsbQ7FjaUZDhmhDYl1RN9X9gEJRzg1Lk49hkwj2iYAsKLl2nCo78jStb9ubNCNaTwIOikSLT/E1VyflNwxWuZxgE]]></acast:settings>
			<itunes:subtitle>The Daily Mirror’s David Walker and Darren Lewis join host Mike Calvin to review the latest Premier League action including the eye-catching form of Zlatan Ibrahimovic, the future for Manchester City keeper Joe Hart and the latest controversy surroundi...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52de.jpg"/>
			<description><![CDATA[The Daily Mirror’s David Walker and Darren Lewis join host Mike Calvin to review the latest Premier League action including the eye-catching form of Zlatan Ibrahimovic, the future for Manchester City keeper Joe Hart and the latest controversy surrounding Chelsea striker Diego Costa.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[The Daily Mirror’s David Walker and Darren Lewis join host Mike Calvin to review the latest Premier League action including the eye-catching form of Zlatan Ibrahimovic, the future for Manchester City keeper Joe Hart and the latest controversy surrounding Chelsea striker Diego Costa.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is Wenger in danger of destroying his legacy?</title>
			<itunes:title>Is Wenger in danger of destroying his legacy?</itunes:title>
			<pubDate>Mon, 15 Aug 2016 15:35:10 GMT</pubDate>
			<itunes:duration>30:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/iswengerindangerofdestroyinghislegacy-/media.mp3" length="45283458" type="audio/mpeg"/>
			<guid isPermaLink="false">6364f5fb-b5c8-463d-8336-8b993317c54b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/iswengerindangerofdestroyinghislegacy-</link>
			<acast:episodeId>6364f5fb-b5c8-463d-8336-8b993317c54b</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>iswengerindangerofdestroyinghislegacy-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRHBvHef5b+QIDj+1sE6JdDiRTtCPcE1rEf+Xne/gRNnP2GJ/XLplo5fKWuCUYBDgVE92n7L8jkscc+ZutUBySf34IRnBmgpiDc9kUoM06W+/Jn7/GmQ8hWpAr1AktNLsNXE2XpVkp5Etd/RQKNXAGnrCii95IbLsixU0KWBXTUsz7h5HGk2ZUhJOyhyiCQehKPBzM/hPOvhX9v2j8kCZoA/cdfo+mwJFpMc0w2x2UGZy+emvZnpi7bWfbhUMb0vLZO/t8sGsFlKVnwQNRajZ1WfFvT9wMfBd1K7uwG9zZSCj]]></acast:settings>
			<itunes:subtitle><![CDATA[The Daily Mirror’s chief football writer John Cross and Sunday Independent journalist Miguel Delaney join host Mike Calvin to chew over the opening weekend of the Premier League season.​ &nbsp;See acast.com/privacy for privacy and opt-out info...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52e5.jpg"/>
			<description><![CDATA[The Daily Mirror’s chief football writer John Cross and Sunday Independent journalist Miguel Delaney join host Mike Calvin to chew over the opening weekend of the Premier League season.​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[The Daily Mirror’s chief football writer John Cross and Sunday Independent journalist Miguel Delaney join host Mike Calvin to chew over the opening weekend of the Premier League season.​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Premier League 2016/17 season preview: Part four</title>
			<itunes:title>Premier League 2016/17 season preview: Part four</itunes:title>
			<pubDate>Mon, 08 Aug 2016 15:24:32 GMT</pubDate>
			<itunes:duration>44:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/premierleague2016-17seasonpreview-partfour/media.mp3" length="43236287" type="audio/mpeg"/>
			<guid isPermaLink="false">72af5ed9-cafe-4bcf-b71f-1f58c9c16a20</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/premierleague2016-17seasonpreview-partfour</link>
			<acast:episodeId>72af5ed9-cafe-4bcf-b71f-1f58c9c16a20</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>premierleague2016-17seasonpreview-partfour</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBcEplc1XMYW8XWz5jiCP98qdMEmWvxK5uFv/N/kZpDvLdwVcS5XbQqYCUkrII5LdgTSM9m55D9h3Tew0GlYJOMzKK+e7L6DbPk3dp/kD1tfcKZEa8nctQkYsQTKx7dvJ8LVE18EXrpUlv64PqQC5j0UiJskr6+1du7y9Uc8qOId3FKwO8lqmDrBr0mtB1fbow0iKhPnGSOWtTkxXhAL8SUGn/BOHjb6KKDBW9lmAy6XtAt8Pa1mDzPsK/WgUA5px968Kb3WYJMw9b9NPvFRJ8GNmsm1HsLbSTC+8B5+TEO8]]></acast:settings>
			<itunes:subtitle><![CDATA[Evening Standard journalist Tony Evans and Arsenal TV's Adrian Clarke join host Mike Calvin to predict the ups and downs from the forthcoming Premier League season.  &nbsp;See acast.com/privacy for privacy and opt-out information.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52ec.jpg"/>
			<description><![CDATA[Evening Standard journalist Tony Evans and Arsenal TV's Adrian Clarke join host Mike Calvin to predict the ups and downs from the forthcoming Premier League season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Evening Standard journalist Tony Evans and Arsenal TV's Adrian Clarke join host Mike Calvin to predict the ups and downs from the forthcoming Premier League season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Premier League 2016/17 season preview: Part three</title>
			<itunes:title>Premier League 2016/17 season preview: Part three</itunes:title>
			<pubDate>Mon, 01 Aug 2016 15:22:28 GMT</pubDate>
			<itunes:duration>31:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/premierleague2016-17seasonpreview-partthree/media.mp3" length="29762252" type="audio/mpeg"/>
			<guid isPermaLink="false">1c14b85a-21ca-47d1-bb66-59ddf89e4079</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/premierleague2016-17seasonpreview-partthree</link>
			<acast:episodeId>1c14b85a-21ca-47d1-bb66-59ddf89e4079</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>premierleague2016-17seasonpreview-partthree</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9WdJMRrXCzx9VCSaVahMEhKdHHg4BCjrCDiyVLZ2jEZY7XK2uGQxuoGbkKcaGFNA3Xo5rHJdYjpowfRVFySfVXTjPbNafVp7mBofHSWvYdHyd5tTQHlPOe9JTD/h0iJfoA6YCT2GKWEaQAJ/iZ48DSnnNnstRhqFtKbOdO2ndSkCaHoxeM5F5M021jrC3aYPdwKqJwJGLBgqsdevwFAfVfXUv9nmAuBIi7QcGjbjjL4GWpDkNPLDZnJ0cChbmNARy]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Adrian Clarke and Darren Lewis assess the chances of Manchester United, Middlesbrough, Southampton, Stoke City and Sunderland ahead of the coming season and debate whether Paul Pogba is worth his £100m price tag.​ &nbsp;See acast....]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52f3.png"/>
			<description><![CDATA[Mike Calvin, Adrian Clarke and Darren Lewis assess the chances of Manchester United, Middlesbrough, Southampton, Stoke City and Sunderland ahead of the coming season and debate whether Paul Pogba is worth his £100m price tag.​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Adrian Clarke and Darren Lewis assess the chances of Manchester United, Middlesbrough, Southampton, Stoke City and Sunderland ahead of the coming season and debate whether Paul Pogba is worth his £100m price tag.​<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Premier League 2016/17 season preview: Part two</title>
			<itunes:title>Premier League 2016/17 season preview: Part two</itunes:title>
			<pubDate>Mon, 25 Jul 2016 13:44:45 GMT</pubDate>
			<itunes:duration>30:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/premierleague2016-17seasonpreview-parttwo/media.mp3" length="29278463" type="audio/mpeg"/>
			<guid isPermaLink="false">5c36df75-8c9a-4625-8a8a-6132a2d36cf6</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/premierleague2016-17seasonpreview-parttwo</link>
			<acast:episodeId>5c36df75-8c9a-4625-8a8a-6132a2d36cf6</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>premierleague2016-17seasonpreview-parttwo</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9vI//Bih+sLi85e0iPNawR8Yu1ztlHt4OkYTYsRDXsoo4ep/lpLSC5gPxyU5TMDG0sTitqKUyoyWvmvoMujOte/SY7TyhtrX+IbEtg1Xl/f3YkigVT4VuPkQLKoSJADMpFDa0LuHjHkFumOfJUmpb6tTDxcZeLAhQFB4PNwEX/2MGx80wUAf1+lDaaunKB5HmfWcz2w9bGEz92hl5+SbRkI8M+4vFo4d0ntAlDHQe5+4NZQDdFzNo3tsta+0+kjD3]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Tom Hopkinson and Tony Evans assess the chances of Everton, Hull City, Leicester City, Liverpool and Manchester City ahead of the coming season and discuss the appointment of Sam Allardyce as England manager. &nbsp;See acast.com/p...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e52fa.jpg"/>
			<description><![CDATA[Mike Calvin, Tom Hopkinson and Tony Evans assess the chances of Everton, Hull City, Leicester City, Liverpool and Manchester City ahead of the coming season and discuss the appointment of Sam Allardyce as England manager.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tom Hopkinson and Tony Evans assess the chances of Everton, Hull City, Leicester City, Liverpool and Manchester City ahead of the coming season and discuss the appointment of Sam Allardyce as England manager.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Premier League 2016/17 season preview: Part one</title>
			<itunes:title>Premier League 2016/17 season preview: Part one</itunes:title>
			<pubDate>Mon, 18 Jul 2016 05:01:00 GMT</pubDate>
			<itunes:duration>31:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/premierleague2016-17seasonpreview-partone/media.mp3" length="22771591" type="audio/mpeg"/>
			<guid isPermaLink="false">5fe58c18-adec-4396-9864-1a359a2d9fa8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/premierleague2016-17seasonpreview-partone</link>
			<acast:episodeId>5fe58c18-adec-4396-9864-1a359a2d9fa8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>premierleague2016-17seasonpreview-partone</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBUqYZlDn2dvlmGVfHA0O1K6gLVDPJets4pb0Zw/jAWXA2titj5Kwe1bxXEdMVRD8cwexzN/XF1vDxnLM3+vQGjQKfzudo5AvacZ1CsiiAkIN+9KUTjWyEI4QJ3tjgBACOfwm+gKfOJuu4EnfylQQVANj/b9qML1JxJU8kIwJOGPk0HeU+AwtbQSqW32eKUG92VZ/I8wdY6Zfhci0NHTvJqK+iA8k9hMtzZuGkUc6ycUsFaymyPtplSgo5mAzgnWucsBPcYvZx203x5y9GLTGTrBoGVW6v+6AvtUmDQo2g0n]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Tony Evans and Adrian Clarke assess the chances of Arsenal, Bournemouth, Burnley, Chelsea and Crystal Palace ahead of the upcoming Premier League season. &nbsp;See acast.com/privacy for privacy and opt-out information.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5301.jpg"/>
			<description><![CDATA[Mike Calvin, Tony Evans and Adrian Clarke assess the chances of Arsenal, Bournemouth, Burnley, Chelsea and Crystal Palace ahead of the upcoming Premier League season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tony Evans and Adrian Clarke assess the chances of Arsenal, Bournemouth, Burnley, Chelsea and Crystal Palace ahead of the upcoming Premier League season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has Ronaldo become one of the all-time greats?</title>
			<itunes:title>Has Ronaldo become one of the all-time greats?</itunes:title>
			<pubDate>Mon, 11 Jul 2016 16:26:50 GMT</pubDate>
			<itunes:duration>30:54</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hasronaldobecomeoneoftheall-timegreats-/media.mp3" length="22419779" type="audio/mpeg"/>
			<guid isPermaLink="false">a8d9871a-a643-470d-8475-35e1734f7087</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hasronaldobecomeoneoftheall-timegreats-</link>
			<acast:episodeId>a8d9871a-a643-470d-8475-35e1734f7087</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hasronaldobecomeoneoftheall-timegreats-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRFMT0rVofJYgxBx4TzdUOTIl4cErN0eLXOeefk79skhv6HjK74X7LVub3aVajsFMcRC31v0xBlDP4qY7UL0kuoyqwx6JBNduSRGr6pmSpFhb6SsTs1NNtoQUSCNf2Ob8kFv8sXYFDinZ8c7eQEBPi3TxXZQ0QIHVBAIab5V2SWaciQ8nVppYAjjkTiwdPYFLDJnFCK0G2Vbja9hMSqBtUyObBtBPRpqXqXxZ/IA9/VjNyL53BYcgC2GsQ/8kCbG9qBn+kMwK3eUvrWAAEK8jGjaef+WDUxxgiov+BVg01dt3]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by football writers Tony Evans and Adrian Clarke to discuss all the fallout from Portugal’s Euro 2016 victory, who should be the new England manager, and take a look at the new signings and new managers joining the Premier League ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5308.jpg"/>
			<description><![CDATA[Mike Calvin is joined by football writers Tony Evans and Adrian Clarke to discuss all the fallout from Portugal’s Euro 2016 victory, who should be the new England manager, and take a look at the new signings and new managers joining the Premier League next season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by football writers Tony Evans and Adrian Clarke to discuss all the fallout from Portugal’s Euro 2016 victory, who should be the new England manager, and take a look at the new signings and new managers joining the Premier League next season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Fearless Wales can see off Portugal</title>
			<itunes:title>Fearless Wales can see off Portugal</itunes:title>
			<pubDate>Mon, 04 Jul 2016 15:21:26 GMT</pubDate>
			<itunes:duration>32:10</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/fearlesswalescanseeoffportugal/media.mp3" length="31019438" type="audio/mpeg"/>
			<guid isPermaLink="false">5af6a158-1a60-4106-a295-d72e8e913374</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/fearlesswalescanseeoffportugal</link>
			<acast:episodeId>5af6a158-1a60-4106-a295-d72e8e913374</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>fearlesswalescanseeoffportugal</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz98nf9WtcfdgYCjHK7oE9POyW3rX7bojGwce6QWpGunS9UtGo1fYV5QXJnc9l3kk9VKc4yZ/lXStGr72KXl4UlF/O0lmxDptaPFEmQ6KokaYrjAS+jYFf52L4Mf8kC2YfCVIQCE/WhQiTPknWRXGFbgpciVnwf2jwabTcZfIVYHwFkDvW09e25C8P1dslhYNNUmhzc8/Q9uyRTsc6wDbc6v8SR9/n8nZajpdCwdN94Oib3i3WklgmymVmyipPLbb5x]]></acast:settings>
			<itunes:subtitle><![CDATA[Sun journalist Martin Lipton and Tom Hopkinson from The Sunday People join host Mike Calvin to discuss England's failure and Wales' brilliance at Euro 2016. Plus Pep v Mourinho - best of enemies... &nbsp;See acast.com/privacy for pri...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e530f.png"/>
			<description><![CDATA[Sun journalist Martin Lipton and Tom Hopkinson from The Sunday People join host Mike Calvin to discuss England's failure and Wales' brilliance at Euro 2016. Plus Pep v Mourinho - best of enemies...<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Sun journalist Martin Lipton and Tom Hopkinson from The Sunday People join host Mike Calvin to discuss England's failure and Wales' brilliance at Euro 2016. Plus Pep v Mourinho - best of enemies...<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>‘Pathetic’ England deserved Euro 2016 humiliation</title>
			<itunes:title>‘Pathetic’ England deserved Euro 2016 humiliation</itunes:title>
			<pubDate>Tue, 28 Jun 2016 15:51:02 GMT</pubDate>
			<itunes:duration>32:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/-pathetic-englanddeservedeuro2016humiliation/media.mp3" length="31529012" type="audio/mpeg"/>
			<guid isPermaLink="false">94d0d0a0-5bd0-4577-8712-db432759060d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/-pathetic-englanddeservedeuro2016humiliation</link>
			<acast:episodeId>94d0d0a0-5bd0-4577-8712-db432759060d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>-pathetic-englanddeservedeuro2016humiliation</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9onLW20EcPgDS4Fpf988XlP2ysZppelgyuuac45VGBejgVCfzJ6nbKYqVPjJsDieppoWfZyDhgnq6jsNVwHPYTEVKVKNO/k/BMVCO62sw4bkkde32c8i/Vy+y3ZHPM1jNG4iXa708MVyuJuoFrpxUa5M/JydSfZjLcR85f4h5pgWlSLhHeK9/2RSQIS22KvuYfmUVYJXc0CGTbt9XEwV7dX+ZBlIgVzmqaNzFi4w5F7QMp7mXxhAjpgDEotKHAbnx]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Tony Evans and David Walker dissect England’s embarrassing Euro 2016 exit to Iceland and speculate who could replace Roy Hodgson. &nbsp;See acast.com/privacy for privacy and opt-out information.]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5316.jpg"/>
			<description><![CDATA[Mike Calvin, Tony Evans and David Walker dissect England’s embarrassing Euro 2016 exit to Iceland and speculate who could replace Roy Hodgson.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Tony Evans and David Walker dissect England’s embarrassing Euro 2016 exit to Iceland and speculate who could replace Roy Hodgson.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Have England showed progress at Euro 2016?</title>
			<itunes:title>Have England showed progress at Euro 2016?</itunes:title>
			<pubDate>Tue, 21 Jun 2016 15:58:21 GMT</pubDate>
			<itunes:duration>28:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/haveenglandshowedprogressateuro2016-/media.mp3" length="40848814" type="audio/mpeg"/>
			<guid isPermaLink="false">e6e1ed6d-2f4e-4be1-b5c0-1f983d62fac5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/haveenglandshowedprogressateuro2016-</link>
			<acast:episodeId>e6e1ed6d-2f4e-4be1-b5c0-1f983d62fac5</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>haveenglandshowedprogressateuro2016-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9TLjeNgosWjlzGnoFd9ojF2f3TvjkQfjCTq6rq5UhhYlP+6MHfYczbm5gzoQ84/dgUpOudjDjGPksmgZ+OLJdrk7D2jYH3Q5vm0An+jXtNhR1rXTwG652Bti0Jcx2Der1o0VuyAKeaRCsLL6CTv3/O6Rb6enEJH8KUhpby6HHBQJKeHimdMMVFTAYrEScI2JJ250bD9kEwp6pWnaFpHWB6TJeIy3xGd9rIy/RsIpZv8HlcfC2TSUKORDgGeElkIV5]]></acast:settings>
			<itunes:subtitle><![CDATA[Mike Calvin, Darren Lewis and Tom Hopkinson reflect on England’s group stage campaign and debate Roy Hodgson’s tactics, as well as taking a wider look at some of the other home nations and tournament favourites. &nbsp;See acast.com/privacy for...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e531d.png"/>
			<description><![CDATA[Mike Calvin, Darren Lewis and Tom Hopkinson reflect on England’s group stage campaign and debate Roy Hodgson’s tactics, as well as taking a wider look at some of the other home nations and tournament favourites.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin, Darren Lewis and Tom Hopkinson reflect on England’s group stage campaign and debate Roy Hodgson’s tactics, as well as taking a wider look at some of the other home nations and tournament favourites.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Did Roy’s conservatism cost England?</title>
			<itunes:title>Did Roy’s conservatism cost England?</itunes:title>
			<pubDate>Mon, 13 Jun 2016 15:23:30 GMT</pubDate>
			<itunes:duration>30:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/didroy-sconservatismcostengland-/media.mp3" length="29666195" type="audio/mpeg"/>
			<guid isPermaLink="false">d8d1a15b-fdfd-490f-9586-8f73a3ecc0a7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/didroy-sconservatismcostengland-</link>
			<acast:episodeId>d8d1a15b-fdfd-490f-9586-8f73a3ecc0a7</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>didroy-sconservatismcostengland-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9JKM8IUWvNwMIYntuY8w5aKjvfYfqEYyWy3mhQEkjeeG5aiu2ScC5KlumT7t286k7ZIZOLcEG7OnV3rRr8eIHZmqn8g3XogzSJoIUEQAPkQJfGOzNTPwQr+9UUdci+Vf2I0fvE+L0AAHP0xSZKtDWF+abAVdq0+TBic/tkfGo79V9IdmcQmXfpdL5l+2kbinCqagDA6tiVA2gHfMgsXWlNu/VeBPvYxrBW/laStLdsyQkPxb4xTp0Cf0XtouW9MH+]]></acast:settings>
			<itunes:subtitle><![CDATA[Our top football journalists discuss England and Wales’ chances at the Euros, Rooney’s new position and the security issues marring the tournament. Featuring Tony Evans of the Evening Standard and Arsenal TV’s Adrian Clarke. &nbsp;See acast.co...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5324.jpg"/>
			<description><![CDATA[Our top football journalists discuss England and Wales’ chances at the Euros, Rooney’s new position and the security issues marring the tournament. Featuring Tony Evans of the Evening Standard and Arsenal TV’s Adrian Clarke.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Our top football journalists discuss England and Wales’ chances at the Euros, Rooney’s new position and the security issues marring the tournament. Featuring Tony Evans of the Evening Standard and Arsenal TV’s Adrian Clarke.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Euro 2016 preview</title>
			<itunes:title>Euro 2016 preview</itunes:title>
			<pubDate>Mon, 06 Jun 2016 15:56:36 GMT</pubDate>
			<itunes:duration>31:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/euro2016preview/media.mp3" length="30515830" type="audio/mpeg"/>
			<guid isPermaLink="false">f75b2564-7238-4d3a-8856-c153d3a58a19</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/euro2016preview</link>
			<acast:episodeId>f75b2564-7238-4d3a-8856-c153d3a58a19</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>euro2016preview</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9EmLsqqmR1qwmNj3DJMiHDFV5jofQ1PRadrAekduZp1NmmW6xAY+1y4NDmaYqFzaXEBw12qk+PrLKpgi2sc93hkdz5yCRu6gDzWgA/MpedaMSgxuapGX83BTgAE8WEfhQeVEFezZb7ti0tMkIiCOu6WgKXaDOXKamQnQY/00dKC8uLnOMeWa4pE4thmzMS34aQx7Wdvsz99L2fYno4jp9UNO5gC7o6N1phVSeqIdi1Cp7dIv3OhJabP5UNOmYwNXw]]></acast:settings>
			<itunes:subtitle>The European Championships are nearly upon us with Roy Hodgson’s Three Lions kicking off against Russia on Saturday. Journalist Mike Calvin is joined by David Walker of the Daily Mirror and The Sunday People’s Tom Hopkinson to preview the tournament. ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e532b.jpg"/>
			<description><![CDATA[The European Championships are nearly upon us with Roy Hodgson’s Three Lions kicking off against Russia on Saturday. Journalist Mike Calvin is joined by David Walker of the Daily Mirror and The Sunday People’s Tom Hopkinson to preview the tournament.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[The European Championships are nearly upon us with Roy Hodgson’s Three Lions kicking off against Russia on Saturday. Journalist Mike Calvin is joined by David Walker of the Daily Mirror and The Sunday People’s Tom Hopkinson to preview the tournament.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>What will success at Euro 2016 look like for England?</title>
			<itunes:title>What will success at Euro 2016 look like for England?</itunes:title>
			<pubDate>Tue, 31 May 2016 19:09:49 GMT</pubDate>
			<itunes:duration>30:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatwillsuccessateuro2016looklikeforengland-/media.mp3" length="43772663" type="audio/mpeg"/>
			<guid isPermaLink="false">1e325586-0f3b-459f-a18d-67475a082044</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatwillsuccessateuro2016looklikeforengland-</link>
			<acast:episodeId>1e325586-0f3b-459f-a18d-67475a082044</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatwillsuccessateuro2016looklikeforengland-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9y2Hc75SnqLfY0ywPt9aZhVo7xGDziGDF155AllthZn7mhrFFjdg7VIVkj61rYuvuqqNNCO8pOZSOMPi1v3OIWo9J8dpWkFqb6JRW7rptBYSl6sK1E+GFRXXMX/pOPGym6c2ftn1RC5mJ2SbNrKTnUo4/tV4/HY6rzSULaC9Pbi/LnknGPm9mzoMlwFSwg4PPDin9W6VCmuXjDbY5ZPfZUc6U9s65g4JcsKSm0dix+lpCgl3NtlCsP0xlrN01Q7tp]]></acast:settings>
			<itunes:subtitle><![CDATA[Journalist Mike Calvin debates England’s chances at Euro 2016 with Darren Lewis of the Daily Mirror and The Sun’s Martin Lipton. The trio also take a look at the other major runners and riders ahead of the European Championships. &nbsp;See aca...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5332.jpg"/>
			<description><![CDATA[Journalist Mike Calvin debates England’s chances at Euro 2016 with Darren Lewis of the Daily Mirror and The Sun’s Martin Lipton. The trio also take a look at the other major runners and riders ahead of the European Championships.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Journalist Mike Calvin debates England’s chances at Euro 2016 with Darren Lewis of the Daily Mirror and The Sun’s Martin Lipton. The trio also take a look at the other major runners and riders ahead of the European Championships.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Mourinho and Ibrahimovic rescue United?</title>
			<itunes:title>Will Mourinho and Ibrahimovic rescue United?</itunes:title>
			<pubDate>Mon, 23 May 2016 16:56:36 GMT</pubDate>
			<itunes:duration>30:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willmourinhoandibrahimovicrescueunited-/media.mp3" length="29921493" type="audio/mpeg"/>
			<guid isPermaLink="false">7ef2d869-291a-4cf4-9b13-4c18a4b50b10</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willmourinhoandibrahimovicrescueunited-</link>
			<acast:episodeId>7ef2d869-291a-4cf4-9b13-4c18a4b50b10</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willmourinhoandibrahimovicrescueunited-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9yOmLR4A0qC9duIFuB6NONR5aOLdr7mOcd4VNGgVqB4jzWR4RRdXc6Iuk2N3l5NFEYsutaVsofzU2OR6K9QbPJaHDDPegXHLqlAul0hMcOwaa4mt7RCwjqg5EhLhcdkV2FIueUemFA1XjKthIs7RGiwv/NuWxk319d3/DlNRBC2h73SELxv/9iyVsFPMiBKtOf0CziwKTk//+1WBJ1JnV5nAeO3aDfwvEkWPxXQ8ATj2LKQ92wQabJ2WRVE9qDWlX]]></acast:settings>
			<itunes:subtitle><![CDATA[Host Mike Calvin is joined by the Daily Mirror's John Cross and The Guardian's Dom Fifield to debate the expected exit of Manchester United manager Louis van Gaal, Jose Mourinho's likely return to the Premier League stage and his rivalry...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5339.jpg"/>
			<description><![CDATA[Host Mike Calvin is joined by the Daily Mirror's John Cross and The Guardian's Dom Fifield to debate the expected exit of Manchester United manager Louis van Gaal, Jose Mourinho's likely return to the Premier League stage and his rivalry with new Manchester City boss Pep Guardiola. The trio also discuss England's Euro 2016 preparations and the Champions League Final showdown between Real Madrid and Atletico Madrid.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Host Mike Calvin is joined by the Daily Mirror's John Cross and The Guardian's Dom Fifield to debate the expected exit of Manchester United manager Louis van Gaal, Jose Mourinho's likely return to the Premier League stage and his rivalry with new Manchester City boss Pep Guardiola. The trio also discuss England's Euro 2016 preparations and the Champions League Final showdown between Real Madrid and Atletico Madrid.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Liverpool save their season with Europa League win?</title>
			<itunes:title>Can Liverpool save their season with Europa League win?</itunes:title>
			<pubDate>Mon, 16 May 2016 17:11:04 GMT</pubDate>
			<itunes:duration>31:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canliverpoolsavetheirseasonwitheuropaleaguewin-/media.mp3" length="29959109" type="audio/mpeg"/>
			<guid isPermaLink="false">4fd68fb2-bc29-43cb-b1aa-936a725677a2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canliverpoolsavetheirseasonwitheuropaleaguewin-</link>
			<acast:episodeId>4fd68fb2-bc29-43cb-b1aa-936a725677a2</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canliverpoolsavetheirseasonwitheuropaleaguewin-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRHc0ebqVIHU80LB45RVQcf8qcoLcrpBpADO8QT+v5+07ejXNJib+dFJ5ERUO05vNsQFL6sXpqJdAsgs87oOqKYxa/gZSoVgFonnos8MGEvANwLPdUdhuN5aSQDwT94fcVD1j7+HcRWfEERU8PzWb/gcB8COPQXo26fgjk2lycWP5VCkXW97+hVDNTXAtNRBt8YWVj/s5Wycwvszlx9m/BVkz1E1IrqU9k1CFXjLhAhg8VrpW+FoJxEiPUSbChknrCpc/ZWB2S6P/u39wq6dXTEhgl5sLot0AqZ7r/tMZWTOL]]></acast:settings>
			<itunes:subtitle>Tony Evans of the Standard and Arsenal TV’s Adrian Clarke join Mike Calvin to discuss Liverpool’s chances in the Europa League final and whether we’ll see the real Klopp after he’s had a chance to sign his own players. The team also discuss the England...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5340.jpg"/>
			<description><![CDATA[Tony Evans of the Standard and Arsenal TV’s Adrian Clarke join Mike Calvin to discuss Liverpool’s chances in the Europa League final and whether we’ll see the real Klopp after he’s had a chance to sign his own players. The team also discuss the England squad for the Euros, the FA Cup final and a bizarre last day of the football season for Manchester United and Tottenham.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Tony Evans of the Standard and Arsenal TV’s Adrian Clarke join Mike Calvin to discuss Liverpool’s chances in the Europa League final and whether we’ll see the real Klopp after he’s had a chance to sign his own players. The team also discuss the England squad for the Euros, the FA Cup final and a bizarre last day of the football season for Manchester United and Tottenham.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Hillsborough - we have the truth but do we have justice?</title>
			<itunes:title>Hillsborough - we have the truth but do we have justice?</itunes:title>
			<pubDate>Mon, 09 May 2016 15:41:40 GMT</pubDate>
			<itunes:duration>30:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hillsborough-wehavethetruthbutdowehavejustice-/media.mp3" length="29198423" type="audio/mpeg"/>
			<guid isPermaLink="false">6a4ecd96-314d-468e-892d-f44ebc28a060</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hillsborough-wehavethetruthbutdowehavejustice-</link>
			<acast:episodeId>6a4ecd96-314d-468e-892d-f44ebc28a060</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hillsborough-wehavethetruthbutdowehavejustice-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPN+V+7WyJXyl3ecqe2AtgRYmqCwiMDoGPrvq1OOYdietcaSEJQlPO+xQqfIFNvGls7kkNG1i71P461y/ycLOE5mPdQXK9klS8qKRtT4n46BfdYhTmQlg4CxfIKU3VZw5slzDyX9tGoLU+94MUg2UIk3POBklfHkfkJXiSEsB6vy9/56mxRf0n/E6IFDj4FcPu3J1F6rld55i039ygxyUouwo9fY7RdpcvklNG1ZpV9khbQT0IWLKZhFtyM6hHszCKBwSIXlck7bHbX6XiI2R8/xYQIEDqnOKTeVm77PGTTq]]></acast:settings>
			<itunes:subtitle><![CDATA[Host Mike Calvin is joined by the Evening Standard's Tony Evans to reflect on the recent ruling that the 96 victims of the 1989 Hillsborough stadium disaster were unlawfully killed while The People's Tom Hopkinson is also on hand to discuss ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5347.jpg"/>
			<description><![CDATA[Host Mike Calvin is joined by the Evening Standard's Tony Evans to reflect on the recent ruling that the 96 victims of the 1989 Hillsborough stadium disaster were unlawfully killed while The People's Tom Hopkinson is also on hand to discuss 'unsinkable' Sam Allardyce's quest to keep Sunderland in the Premier League, the battle at the top to secure Champions League football next season and the potential manager merry-go-round.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Host Mike Calvin is joined by the Evening Standard's Tony Evans to reflect on the recent ruling that the 96 victims of the 1989 Hillsborough stadium disaster were unlawfully killed while The People's Tom Hopkinson is also on hand to discuss 'unsinkable' Sam Allardyce's quest to keep Sunderland in the Premier League, the battle at the top to secure Champions League football next season and the potential manager merry-go-round.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Leicester City: The greatest story ever told?</title>
			<itunes:title>Leicester City: The greatest story ever told?</itunes:title>
			<pubDate>Tue, 03 May 2016 17:09:15 GMT</pubDate>
			<itunes:duration>30:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/leicestercity-thegreateststoryevertold-/media.mp3" length="36681957" type="audio/mpeg"/>
			<guid isPermaLink="false">76f388c8-c2ff-4a30-9923-7ad2d2b1c378</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/leicestercity-thegreateststoryevertold-</link>
			<acast:episodeId>76f388c8-c2ff-4a30-9923-7ad2d2b1c378</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>leicestercity-thegreateststoryevertold-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz98vvInYnZPjP5tfojAZl6+aHk5pmhmZMDToxdoXRYuYVeSb9FM2f4maNZFWR/3VnuP8Dpioof9Me72nSzHGoCjmHZ5/PRCHi+kKHrLZ//KAeLHfXvT6PEnD/mfKr945fDhUGSWfyvSNIt1AxGyvsUh1+zAFdxKTly8Cz7Wph2hPLRdoOPHHMe8XlF4D1UtVJRVTQa1QjjAl05zfrkAonG0bEE6jRmnqXELxc8By6HL8B31FCg0DvvbHTuxGj/Xt/A]]></acast:settings>
			<itunes:subtitle>Daily Mirror writers Darren Lewis and David Walker join Mike Calvin to discuss whether Sturridge will leave Liverpool if he doesn’t start against Villarreal, if Manchester City have been going backwards, Championship winning Leicester’s global appeal a...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e534e.jpg"/>
			<description><![CDATA[Daily Mirror writers Darren Lewis and David Walker join Mike Calvin to discuss whether Sturridge will leave Liverpool if he doesn’t start against Villarreal, if Manchester City have been going backwards, Championship winning Leicester’s global appeal and their unsung heroes behind the scenes.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Daily Mirror writers Darren Lewis and David Walker join Mike Calvin to discuss whether Sturridge will leave Liverpool if he doesn’t start against Villarreal, if Manchester City have been going backwards, Championship winning Leicester’s global appeal and their unsung heroes behind the scenes.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will winning the FA Cup save Louis van Gaal?</title>
			<itunes:title>Will winning the FA Cup save Louis van Gaal?</itunes:title>
			<pubDate>Mon, 25 Apr 2016 15:38:05 GMT</pubDate>
			<itunes:duration>31:25</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/willwinningthefacupsavelouisvangaal-/media.mp3" length="30366201" type="audio/mpeg"/>
			<guid isPermaLink="false">0ac527fb-f3af-4e10-b725-0de0508b1a7d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/willwinningthefacupsavelouisvangaal-</link>
			<acast:episodeId>0ac527fb-f3af-4e10-b725-0de0508b1a7d</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>willwinningthefacupsavelouisvangaal-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRBox8Aojgd9/v1uygCBoZJTRw8xLB3tMvDvRcsZP2tACQDt9mx/yCKe4exsxmXlJ9cQ3gogU47K/T3pX7gu67DpnH9rOu56/gYFXJHkQbw96KQlTeyYpcEA75ONN0LS9GFe5aXv4QnzWvGXUQFoqw0DPTU0rFr45l+sbubaJfi2edJx2HRAZG2VICGdHGEWqyt9MSFDfoqjqo2V8N40MC42zzcNKMIjx5PUiMPFZPt5v/bkEqdN31VKbwc2VQtAB8O9lUbVqgVeab0l0zGIzA5N98f5NomEtGmWICaDQ7/Yf]]></acast:settings>
			<itunes:subtitle><![CDATA[The Sun’s Martin Lipton and John Cross of the Daily Mirror join Mike Calvin to discuss the issues at Manchester United, a potential FA Cup fairy-tale for Pardew and Palace and huge European nights for Liverpool and Man City. &nbsp;See acast.co...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5355.jpg"/>
			<description><![CDATA[The Sun’s Martin Lipton and John Cross of the Daily Mirror join Mike Calvin to discuss the issues at Manchester United, a potential FA Cup fairy-tale for Pardew and Palace and huge European nights for Liverpool and Man City.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[The Sun’s Martin Lipton and John Cross of the Daily Mirror join Mike Calvin to discuss the issues at Manchester United, a potential FA Cup fairy-tale for Pardew and Palace and huge European nights for Liverpool and Man City.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Has Rashford saved big-spending Van Gaal?</title>
			<itunes:title>Has Rashford saved big-spending Van Gaal?</itunes:title>
			<pubDate>Mon, 18 Apr 2016 16:20:10 GMT</pubDate>
			<itunes:duration>30:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/hasrashfordsavedbig-spendingvangaal-/media.mp3" length="29583364" type="audio/mpeg"/>
			<guid isPermaLink="false">4cb81f93-fbee-4f02-a99c-64c52c6a2615</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/hasrashfordsavedbig-spendingvangaal-</link>
			<acast:episodeId>4cb81f93-fbee-4f02-a99c-64c52c6a2615</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>hasrashfordsavedbig-spendingvangaal-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnROE9OU5k50Jp0OX8iWDSXFOCaNK/FQZpExIuhtvS+DgJu6/dRxgtS6vcnA/DbnyHbBwX0BtnMgI9fEpn6A5t+pn54lRXLxFsFstkiSaPd4LacmGJrAr6IbrAIjrYyrF5KOiUmsrrtsolM7Pp2VVjgZAp083LUHyQyXOuoq3ktwxrj2/TcImEkV9H55ge42TV1YRk4nly9qghk+eTfk3TMYCKSrpWRV4XJ2f3O6E//I/3uGKY6NVDoLdqgHFg3glaGYFSMRWhKnVk7eIjE2sZ9zMlGAbCNIUct/4fhQ43Ifhe]]></acast:settings>
			<itunes:subtitle><![CDATA[Guardian journalist Dom Fifield and Tom Hopkinson from The Sunday People join host Mike Calvin to discuss LVG's 'lucky break', the battle at the bottom and their Player of the Year picks.  &nbsp;See acast.com/privacy for privacy...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e535c.jpg"/>
			<description><![CDATA[Guardian journalist Dom Fifield and Tom Hopkinson from The Sunday People join host Mike Calvin to discuss LVG's 'lucky break', the battle at the bottom and their Player of the Year picks.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Guardian journalist Dom Fifield and Tom Hopkinson from The Sunday People join host Mike Calvin to discuss LVG's 'lucky break', the battle at the bottom and their Player of the Year picks.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Will Leicester falter down the stretch like Spieth?</title>
			<itunes:title>Will Leicester falter down the stretch like Spieth?</itunes:title>
			<pubDate>Mon, 11 Apr 2016 16:28:32 GMT</pubDate>
			<itunes:duration>30:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/whatlessonscanbigclubslearnfromleicesterandspurs-/media.mp3" length="29149940" type="audio/mpeg"/>
			<guid isPermaLink="false">758649e0-a1ea-487d-a257-9013be43b26a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/whatlessonscanbigclubslearnfromleicesterandspurs-</link>
			<acast:episodeId>758649e0-a1ea-487d-a257-9013be43b26a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>whatlessonscanbigclubslearnfromleicesterandspurs-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9V068qYGs9WNu72QUXaTYvML2H/z3Oqn++OT7vUpuTpzw3/jvDOFyBkYW6a5QnAyfWd8DtKKPcO3JPpYam6+5AuFrHLzsZpqszx9INCU/bVZRUXtAgTg+cFePJclOe/83RCfWAKhzCYB9P7hSa/Sg6S5kOAbhod/rR3djZkShQu5rjjJdB0GoiwNrO6bJFEe7vvSVwkLdYj+6g5WtK4t27ySpxLxqtN7+3Q2zAKSdOEQMvD+dPuQIbIhICa+4QQp/]]></acast:settings>
			<itunes:subtitle><![CDATA[Host Mike Calvin is joined by Arsenal TV's Adrian Clarke and the Sunday Express' Jim Holden to analyse the latest developments in the Premier League title race and preview West Ham's FA Cup replay against Manchester United, Manchester Ci...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5363.jpg"/>
			<description><![CDATA[Host Mike Calvin is joined by Arsenal TV's Adrian Clarke and the Sunday Express' Jim Holden to analyse the latest developments in the Premier League title race and preview West Ham's FA Cup replay against Manchester United, Manchester City's Champions League showdown with Paris Saint-Germain and next weekend's relegation showdown between Norwich and Sunderland.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Host Mike Calvin is joined by Arsenal TV's Adrian Clarke and the Sunday Express' Jim Holden to analyse the latest developments in the Premier League title race and preview West Ham's FA Cup replay against Manchester United, Manchester City's Champions League showdown with Paris Saint-Germain and next weekend's relegation showdown between Norwich and Sunderland.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Is Conte 'Mourinho without the brains or the charm'?]]></title>
			<itunes:title><![CDATA[Is Conte 'Mourinho without the brains or the charm'?]]></itunes:title>
			<pubDate>Tue, 05 Apr 2016 15:06:43 GMT</pubDate>
			<itunes:duration>31:11</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/iscontemourinhowithoutthebrainsorthecharm-/media.mp3" length="30148027" type="audio/mpeg"/>
			<guid isPermaLink="false">798c1f70-1b15-476b-9c1f-5aa37e327bd8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/iscontemourinhowithoutthebrainsorthecharm-</link>
			<acast:episodeId>798c1f70-1b15-476b-9c1f-5aa37e327bd8</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>iscontemourinhowithoutthebrainsorthecharm-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRGH0Ef9VrPm320dOws+WNiy8uHD6x9eTS3BI3PwQrE6gXCs4ZBZ5GSa85zRSGtLo6Ok8qYP9TZXGLC/5l2Q5gX4Jw4mwZVOZiSHKjzUvX+0oHvwjJFpZTJO6Z9mKoBDzqtv0rK3fw01sGQeBpXzWQIQI3ta/LbENarUutBYpRgn+OXjGhdJfwrkCzgW69jbc3WCiLeUszNTiHxllS+EcoMfd+Ln64Q/MgSQ19qzpGSyr/AAsSOwAGOBgvoZjZeSZi9xMPX9ruJ7LgAgC/GH15tCaOBs3edPFhmYy9nqoJ4f9]]></acast:settings>
			<itunes:subtitle><![CDATA[Evening Standard columnist Tony Evans and Daily Mirror journalist Dave Kidd join host Mike Calvin to question the appointment of Antonio Conte at Chelsea, plus whether Zlatan is worth £600,000 a week and Jurgen Klopp's return to Dortmund.       ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e536a.jpg"/>
			<description><![CDATA[Evening Standard columnist Tony Evans and Daily Mirror journalist Dave Kidd join host Mike Calvin to question the appointment of Antonio Conte at Chelsea, plus whether Zlatan is worth £600,000 a week and Jurgen Klopp's return to Dortmund.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Evening Standard columnist Tony Evans and Daily Mirror journalist Dave Kidd join host Mike Calvin to question the appointment of Antonio Conte at Chelsea, plus whether Zlatan is worth £600,000 a week and Jurgen Klopp's return to Dortmund.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Is there room for Rooney at the Euros?</title>
			<itunes:title>Is there room for Rooney at the Euros?</itunes:title>
			<pubDate>Tue, 29 Mar 2016 15:09:09 GMT</pubDate>
			<itunes:duration>31:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/isthereroomforrooneyattheeuros-/media.mp3" length="29998815" type="audio/mpeg"/>
			<guid isPermaLink="false">60fe5db1-7937-4a5e-ab57-cea6aede241a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/isthereroomforrooneyattheeuros-</link>
			<acast:episodeId>60fe5db1-7937-4a5e-ab57-cea6aede241a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>isthereroomforrooneyattheeuros-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRPdjbJm7d4qQ2rUK1Oh2E65gYDhVAjVZ14DHwOhC8Pz9lQzwgWIeRE5jnjWFp9tYVYxfMfD/JHMUf5q12LIagPE5Uk+7c4JIv48HwNozX6C0QMmbxW12cYGuO5g2nYA7KqRVPmL54HdimAVd7/FwsdVeq3a9lx9A5z1KgPRP2iq6um4aCC6FcSiF37D2bUPIIu3NzNKBO07dG4jdpnx/FbZ1RQA0C3b6CfK05VcNdk867Zb/RsqqKvwfpVptEU87wweXx7e84bnc5JQh1NBE/RSjWMAt0e/sAScpw45PlDFg]]></acast:settings>
			<itunes:subtitle>Mike Calvin is joined by the Daily Mirror’s Darren Lewis and David Walker to discuss England’s chances in France this summer, Spurs’ fantastic spine of English youngsters, whether John Stones is the real deal, and all the Premier League news and gossip...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5371.jpg"/>
			<description><![CDATA[Mike Calvin is joined by the Daily Mirror’s Darren Lewis and David Walker to discuss England’s chances in France this summer, Spurs’ fantastic spine of English youngsters, whether John Stones is the real deal, and all the Premier League news and gossip.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Mike Calvin is joined by the Daily Mirror’s Darren Lewis and David Walker to discuss England’s chances in France this summer, Spurs’ fantastic spine of English youngsters, whether John Stones is the real deal, and all the Premier League news and gossip.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Spurs pip Leicester to the title?</title>
			<itunes:title>Can Spurs pip Leicester to the title?</itunes:title>
			<pubDate>Mon, 21 Mar 2016 16:38:02 GMT</pubDate>
			<itunes:duration>30:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canspurspipleicestertothetitle-/media.mp3" length="29946152" type="audio/mpeg"/>
			<guid isPermaLink="false">6a23908d-5fd6-4aa9-a539-61ee1a79491a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canspurspipleicestertothetitle-</link>
			<acast:episodeId>6a23908d-5fd6-4aa9-a539-61ee1a79491a</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canspurspipleicestertothetitle-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRL5HalemaKB8rRjav7Sa5/9jkznCeJmq4tBjvQSJfadeQcoRMn6JqSfkQLZ5RTCirLlXXeTAgh3pX8pthPmKpa6q3fzFMzWVo9+2xQTWBOA2qRvnjk3VlnGLnV+SSG46V2UFCi0GhPmdWMZNc4HVcd4zDceQz+1b+au3LM7+5Vkkum4Q32s6DOEC4PMjNmuv8+/ent7CPGvp8vQmiZeLsNDUx+JgWvTjpYHmeNkIGlqhsntpn43onTqXLGIkAW1b/dCnpIcljPc/KBjzvTJCkzAEgVyFw+mfOwInS+q+w88S]]></acast:settings>
			<itunes:subtitle>Host Mike Calvin is joined by Dom Fifield and Martin Lipton to discuss who will win the Premier League title - Leicester or Tottenham? Is desperation masquerading as innovation at Manchester United? And will England manager Roy Hodgson be bold against ...</itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5378.jpg"/>
			<description><![CDATA[Host Mike Calvin is joined by Dom Fifield and Martin Lipton to discuss who will win the Premier League title - Leicester or Tottenham? Is desperation masquerading as innovation at Manchester United? And will England manager Roy Hodgson be bold against Germany?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Host Mike Calvin is joined by Dom Fifield and Martin Lipton to discuss who will win the Premier League title - Leicester or Tottenham? Is desperation masquerading as innovation at Manchester United? And will England manager Roy Hodgson be bold against Germany?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Is Wenger's time up?]]></title>
			<itunes:title><![CDATA[Is Wenger's time up?]]></itunes:title>
			<pubDate>Mon, 14 Mar 2016 16:25:06 GMT</pubDate>
			<itunes:duration>30:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/iswengerstimeup-/media.mp3" length="29691615" type="audio/mpeg"/>
			<guid isPermaLink="false">b9e4e40e-5ce0-4c3d-8dfe-c4de30ae0f63</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/iswengerstimeup-</link>
			<acast:episodeId>b9e4e40e-5ce0-4c3d-8dfe-c4de30ae0f63</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>iswengerstimeup-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnRF+V1QD7/PhxxLvoYxCEt5UC2KehREFTsF0se9YXHOLHBehMJtopvuArR/gTtMZlba/ULfl8B7DtiGt8A4Twj6imjeR0hGFGjEuKcw8svgiSBnoJrcqQYTheC3FnCdPi2OlDDw4fh748zuQzWYez80s/s/42CV/YlShv7kRmeByFY1tKmPWeNZjUHxSt77SDS9tmNUtyu4fjDeSr34G7qzkQx1bRUx7Gl1f3wPVgC4OItZRPdfwA1P8nEBm5twHoTg0Tma3ZaZniRjh+B/jQyWLjREILz1vzS360mhOTSHMZ]]></acast:settings>
			<itunes:subtitle><![CDATA[Daily Mirror journalist John Cross and Tom Hopkinson from  The Sunday People join host Mike Calvin  to discuss whether it's time for Arsene Wenger to part company with Arsenal, plus the intriguing prospect of Pep Guardiola v Jose Mourinho in Manch...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e537f.jpg"/>
			<description><![CDATA[Daily Mirror journalist John Cross and Tom Hopkinson from  The Sunday People join host Mike Calvin  to discuss whether it's time for Arsene Wenger to part company with Arsenal, plus the intriguing prospect of Pep Guardiola v Jose Mourinho in Manchester next season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Daily Mirror journalist John Cross and Tom Hopkinson from  The Sunday People join host Mike Calvin  to discuss whether it's time for Arsene Wenger to part company with Arsenal, plus the intriguing prospect of Pep Guardiola v Jose Mourinho in Manchester next season.<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Can Leicester actually do it?</title>
			<itunes:title>Can Leicester actually do it?</itunes:title>
			<pubDate>Mon, 07 Mar 2016 14:41:37 GMT</pubDate>
			<itunes:duration>30:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/lifesapitch/canleicesteractuallydoit-/media.mp3" length="29109816" type="audio/mpeg"/>
			<guid isPermaLink="false">1eb3de43-f0fb-416a-941e-4731d2588fa4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/lifesapitch/episodes/canleicesteractuallydoit-</link>
			<acast:episodeId>1eb3de43-f0fb-416a-941e-4731d2588fa4</acast:episodeId>
			<acast:showId>c3d7e527-a19b-4b2e-a5ba-229c5d119435</acast:showId>
			<acast:episodeUrl>canleicesteractuallydoit-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmRbkUlg2iR8fDtnl1O71B2N8B7jZZH+7YdsHlGFxMJ/JB5ewwSWwnDfITsERRlXnREa2n+Py/fVsqlrGBPnde5PFepFEzRFodrXSsNTBLR1bqCltgIvYTeLZWqQEGm32tnmXmYyixurL4BM+yizl3Ud4OU52VCVGeDlkD5H2fCkr41Xyl14hUK+E4dmqdgUMCJ/toWioWrlyMdDMKN3aGUOgYA5Jvxg9BI9bhWzJlK4BTy58RJbz0CIpoOuS8LTSdoUIQpXiKWtnXfdxycLV6deQjIpvg4z6eadaEE4ovodEU1261Xt5YYXOxgmoi9DGNxl0eqESGomugWY7FVFDnFmn/ZA1UVTfUTqJssdF9I5p]]></acast:settings>
			<itunes:subtitle><![CDATA[Adrian Clarke and Tony Evans join host Mike Calvin to debate the big question of the week. Five points clear at the top of the Premier League, can Leicester actually win it? And have Arsenal and Tottenham blown it? &nbsp;See acast.com/privacy ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/611e56bb06c05eded6f407f5/611e57483f947400122e5386.jpg"/>
			<description><![CDATA[Adrian Clarke and Tony Evans join host Mike Calvin to debate the big question of the week. Five points clear at the top of the Premier League, can Leicester actually win it? And have Arsenal and Tottenham blown it?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[Adrian Clarke and Tony Evans join host Mike Calvin to debate the big question of the week. Five points clear at the top of the Premier League, can Leicester actually win it? And have Arsenal and Tottenham blown it?<hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
    	<itunes:category text="Sports"/>
		<itunes:category text="News">
			<itunes:category text="News Commentary"/>
		</itunes:category>
		<itunes:category text="Sports">
			<itunes:category text="Football"/>
		</itunes:category>
    </channel>
</rss>
