<?xml version="1.0" encoding="utf-8"?>
<?xml-stylesheet type="text/xsl" href="/global/feed/rss.xslt" ?>
<rss version="2.0" xmlns:atom="http://www.w3.org/2005/Atom" xmlns:googleplay="http://www.google.com/schemas/play-podcasts/1.0" xmlns:itunes="http://www.itunes.com/dtds/podcast-1.0.dtd" xmlns:media="http://search.yahoo.com/mrss/" xmlns:podaccess="https://access.acast.com/schema/1.0/" xmlns:acast="https://schema.acast.com/1.0/">
    <channel>
		<ttl>60</ttl>
		<generator>acast.com</generator>
		<title>The Girls Bathroom</title>
		<link>https://thegirlsbathroom.komi.io/</link>
		<atom:link href="https://feeds.acast.com/public/shows/bd38ad29-6b25-4be0-8796-a310aded9b55" rel="self" type="application/rss+xml"/>
		<language>en</language>
		<copyright>Sophia and Cinzia Limited</copyright>
		<itunes:keywords>influencers,youtube,dilemmas,help,advice,girls,girl chat,best friends</itunes:keywords>
		<itunes:author><![CDATA[Sophia & Cinzia]]></itunes:author>
		<itunes:subtitle/>
		<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
		<itunes:explicit>false</itunes:explicit>
		<itunes:owner>
			<itunes:name>The Girls Bathroom</itunes:name>
			<itunes:email>podcasts@audioalways.com</itunes:email>
		</itunes:owner>
		<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
		<acast:showUrl>thegirlsbathroom</acast:showUrl>
		<acast:signature key="EXAMPLE" algorithm="aes-256-cbc"><![CDATA[wbG1Z7+6h9QOi+CR1Dv0uQ==]]></acast:signature>
		<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmStkiTEE0CNxIPxmLPEYNwMKCHLDRL22sHQZ4ElCEGqt3fze1jZ6iH+IMFJT2mYmZIGeQl0MV7COoGndi3kg33+KMHK20X86EXsQQCaKB4hyoGHRa71WOqAcTVRNiFenMII5jpxFxjITGkCP8YwfJjv2Ys0CXu+4eAML5WGUfhaiK6XYp7Tn6vczFzbMH/QT4b2eQf+lipAZkyfRSgdXbwTFHw2h/qOgXcK0rR2q8EzAXd4YNcmWW6T+9CdEo5wdiHpe+toS28H/h2xjPplcbrU=]]></acast:settings>
        <acast:network id="68a87ce9f93480550cb71f2a" slug="audioalwaysymu"><![CDATA[Audio Always YMU]]></acast:network>
		<acast:importedFeed>https://rss.acast.com/thegirlsbathroom</acast:importedFeed>
		<itunes:type>episodic</itunes:type>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<image>
				<url>https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg</url>
				<link>https://thegirlsbathroom.komi.io/</link>
				<title>The Girls Bathroom</title>
			</image>
			<itunes:new-feed-url>https://feeds.acast.com/public/shows/bd38ad29-6b25-4be0-8796-a310aded9b55</itunes:new-feed-url>
		<item>
			<title>LIVE FROM COACHELLA</title>
			<itunes:title>LIVE FROM COACHELLA</itunes:title>
			<pubDate>Tue, 14 Apr 2026 23:01:00 GMT</pubDate>
			<itunes:duration>1:03:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/69de44136d8c6df94040c28e/media.mp3" length="61193822" type="audio/mpeg"/>
			<guid isPermaLink="false">69de44136d8c6df94040c28e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/live-from-coachella</link>
			<acast:episodeId>69de44136d8c6df94040c28e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>live-from-coachella</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCc9u/Nko8A0wtT2CDLVGCAe3oVmlG1n883EvSBukbXGmMFp2NKFl8XDErdFLj8IlRwSyS7oKQqjPf7tXOI3fMGwxDLmCvk6K/PFvDKdg7DA/ffKJwFrPWjz8qMoobZ5C5wJOU+Zh/dXu8Y/n6bRth6jHt85gpkD4jhiRJnlTUZO6I5jhKjakYwOcVoDfFNTAhO3WLpJap8xzctMixwxhnimdV5Buq/qMImDSlE/DC4bG4lGrxVysnqiWOTdzb9u6nJYGnclUGslJ8mMc9+EulvX]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1776178070520-46304ca8-ff47-484a-9610-70620dcfe599.jpeg"/>
			<description><![CDATA[<p>S+C are coming to you straight from their Coachella bathroom floor!! Expect fave LA food recs, festival chaos, and all your dilemmas solved from the desert. This week the girls are untangling secret girlfriends, virgin Brians, and adding hussy to the TGB dictionary. Oh, and Cinzia’s officially considering a life of lies...shoutout RPatz, you started something.​​​​​​​​​​​​​​​​</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>S+C are coming to you straight from their Coachella bathroom floor!! Expect fave LA food recs, festival chaos, and all your dilemmas solved from the desert. This week the girls are untangling secret girlfriends, virgin Brians, and adding hussy to the TGB dictionary. Oh, and Cinzia’s officially considering a life of lies...shoutout RPatz, you started something.​​​​​​​​​​​​​​​​</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: his mum BANNED me from their house?!</title>
			<itunes:title>Girl Talk: his mum BANNED me from their house?!</itunes:title>
			<pubDate>Tue, 07 Apr 2026 23:01:00 GMT</pubDate>
			<itunes:duration>1:02:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/69d5002b012eba63c500f11a/media.mp3" length="59601397" type="audio/mpeg"/>
			<guid isPermaLink="false">69d5002b012eba63c500f11a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-his-mum-banned-me-from-their-house</link>
			<acast:episodeId>69d5002b012eba63c500f11a</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-his-mum-banned-me-from-their-house</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCekRk+Ex79MxcF5sBrvLrVZ2f6oVTDdrF17kolPjDcHwe3OwmagS3W6dBvZgufUJmziPMeNNeXhVO2Oxy7/PwqRr5P9N5jKBmMRLxVW7ucBldy6a0XefRuWITCZZRt/l8tH+j+DGStJkXd/D1WdqMsEONvFLNR4BVmj0moXsPhGIwa0A1rj1DOiBGq9bT8ItEE6b+sPbo85MQ4fge23ZeosCZYOoPlPHdu0vfuSRs9VOLmfUTvEj9H2708httMaZMCA+mOGO0sCK483Bis+eLX2]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>346</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1775567683221-53352bc5-af36-4b01-b1c4-73a13083493b.jpeg"/>
			<description><![CDATA[<p>The girls are back in TGB HQ and the Sarahs did NOT hold back on the question of the week, secret pregnancies, shared vibrators and sugar daddies… we are genuinely not okay. One Sarah's mother-in-law has pulled off the most unexpected villain arc after four years of "daughter she never had" energy, another's housemate ick has taken over her entire Australia experience, and one bestie has basically issued a bachelorette ultimatum. Oh, and our star of the week has us in our FEELINGS.&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>The girls are back in TGB HQ and the Sarahs did NOT hold back on the question of the week, secret pregnancies, shared vibrators and sugar daddies… we are genuinely not okay. One Sarah's mother-in-law has pulled off the most unexpected villain arc after four years of "daughter she never had" energy, another's housemate ick has taken over her entire Australia experience, and one bestie has basically issued a bachelorette ultimatum. Oh, and our star of the week has us in our FEELINGS.&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: he has a GIRLS SHELF… should I be worried?</title>
			<itunes:title>Boy Talk: he has a GIRLS SHELF… should I be worried?</itunes:title>
			<pubDate>Tue, 31 Mar 2026 23:01:00 GMT</pubDate>
			<itunes:duration>1:00:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/69cbe00f8f05a4cf4576e1fc/media.mp3" length="58560261" type="audio/mpeg"/>
			<guid isPermaLink="false">69cbe00f8f05a4cf4576e1fc</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-she-wants-himshes-80</link>
			<acast:episodeId>69cbe00f8f05a4cf4576e1fc</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-she-wants-himshes-80</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfopVQU7WBEjaZ/eB/rD/NrHdTZkzA0vaWTMuAXi14Ah7ZnWCS45474hFoHcCDUkKXANC3CaLp4LCarYr6aKbIBhN0fTEFv9hzC0223D3+7+ij+0ofo5W2oM1xKL2MJr3SA5Q1UL5sLdKuLqRNEs+d+fxszV44JHhuXgJEGWgksgQlNXqGcn3u3pOPXqR7eL6FvXFb6tm+Y7704IpEg6GT7lSbqTv2KJpdBfKO0kF6XN5sakMUu3uf4GYRdqQnHxf5La/fYFNXpzQIzmCcOyWpa]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>345</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1774968894681-d73eb7ba-5ee6-4e38-96bf-5d3ff2b82e92.jpeg"/>
			<description><![CDATA[<p>What do you do when the Brian you're dating has a shelf just for girls? Yep, Sarah’s dealing with a truly bizarre dilemma. Meanwhile, Cinzia’s been warming up her vocal cords, but will she&nbsp;ever&nbsp;manage to pull off a prank on Sophia? And we’re also diving into the chaos of living with an ex-boyfriend, as one Sarah considers whether it’s finally time to install a mini fridge in her bedroom just to survive the drama…</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>What do you do when the Brian you're dating has a shelf just for girls? Yep, Sarah’s dealing with a truly bizarre dilemma. Meanwhile, Cinzia’s been warming up her vocal cords, but will she&nbsp;ever&nbsp;manage to pull off a prank on Sophia? And we’re also diving into the chaos of living with an ex-boyfriend, as one Sarah considers whether it’s finally time to install a mini fridge in her bedroom just to survive the drama…</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: who even IS my SISTER...</title>
			<itunes:title>Girl Talk: who even IS my SISTER...</itunes:title>
			<pubDate>Wed, 25 Mar 2026 00:01:00 GMT</pubDate>
			<itunes:duration>1:16:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/69c2ae38d99df75cc3984e26/media.mp3" length="73398648" type="audio/mpeg"/>
			<guid isPermaLink="false">69c2ae38d99df75cc3984e26</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-who-even-is-my-sister</link>
			<acast:episodeId>69c2ae38d99df75cc3984e26</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-who-even-is-my-sister</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fh8gO4DvlGA40yms2g0/hOkcrfHIopjTygHFqGwwOPKFIai4SuTvs86Lx3UYCyl6Zsma6ZjxY1sbH02l3rfpxRZ43Ste+PAyCExiAhTyfOG+TzuZdrFC1LU6JG1nWLoeUFxdmpMAnblC6eO4YzjKaXPHbXE9EGmR9ZatonXQM//sA7TW2wxXGmJu+55MOYhv7z]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>344</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1774366690140-6bd8908c-fcde-4c74-9db4-2f86510fa060.jpeg"/>
			<description><![CDATA[<p>Fake careers and imaginary allergies to fake family members and secret rotisserie chickens… the girls read out your most chaotic “Question of the Week” responses. Who else thinks Tony Blair is a silver fox?? Our Sarahs are dealing with a friend who constantly lies and one-ups you, a sister who seems to shapeshift depending on who she’s around, a birthday fallout that might have ended a friendship for good, and the awkward situation of someone expecting a wedding invite after years of ghosting.BUT… fear not, as Sam saves the day with his own private book club as our Star of the Week!</p><br><p>AD - It’s a match! Discover True Match Foundation and Infallible Setting Mist, the ultimate duo, online or in-store: https://www.loreal-paris.co.uk/true-match/foundation/4-n</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Fake careers and imaginary allergies to fake family members and secret rotisserie chickens… the girls read out your most chaotic “Question of the Week” responses. Who else thinks Tony Blair is a silver fox?? Our Sarahs are dealing with a friend who constantly lies and one-ups you, a sister who seems to shapeshift depending on who she’s around, a birthday fallout that might have ended a friendship for good, and the awkward situation of someone expecting a wedding invite after years of ghosting.BUT… fear not, as Sam saves the day with his own private book club as our Star of the Week!</p><br><p>AD - It’s a match! Discover True Match Foundation and Infallible Setting Mist, the ultimate duo, online or in-store: https://www.loreal-paris.co.uk/true-match/foundation/4-n</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[X-RATED: Is it normal for my man to be doing this whilst I'm asleep?!!]]></title>
			<itunes:title><![CDATA[X-RATED: Is it normal for my man to be doing this whilst I'm asleep?!!]]></itunes:title>
			<pubDate>Wed, 18 Mar 2026 00:01:00 GMT</pubDate>
			<itunes:duration>57:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/69b95d8d07e3ef5cb9baec1e/media.mp3" length="83846648" type="audio/mpeg"/>
			<guid isPermaLink="false">69b95d8d07e3ef5cb9baec1e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/x-rated-hes-wanking-while-im-asleep</link>
			<acast:episodeId>69b95d8d07e3ef5cb9baec1e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>x-rated-hes-wanking-while-im-asleep</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCevXZKZXyKKbKTH+E5Rtrc4KgkCZuP1bnlPz/SMK6WmQ35eDZFOWwXJWddLGqSSt0R/y9VRntF30r3XV1ZaCprFzPot4bAAVMIBciaZJuILjWVyogG2tVCu9LmBkhBEYFSLjBgTw2KSd8DQ7CpYvGQ9AUoPv0CGhQUyeIBhTxP6T1MkjA6HI8PKn8nCK0oocRBowYu3sf6trh7cBX16hZvqxgeTFto+IlT80UDrcFgPnnNxertFLHnN443NrSEcKLId//Xto5iGpjTTkcO5yI9dPOglJY1iruD4fwG/amWwUQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>343</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1773755826520-cebc5eba-0803-4d2a-9e81-e01e67ad7c62.jpeg"/>
			<description><![CDATA[<p>X-RATED is BACK&nbsp;and we’re diving headfirst into our sexual awakenings… because apparently when Shrek turns human in&nbsp;Shrek 2, that did something to Sophia! From dolphins allegedly plotting kidnappings, to&nbsp;Blue Therapy&nbsp;debates, to the most unhinged confessions (yes, we’re talking peeing, unexpected kinks, and questionable bedtime behaviour 😭)… this episode is all over the place in the best way. It’s chaotic and honestly? We might need help. P.S. Gerald, if you’re listening… please don’t kidnap us.</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>X-RATED is BACK&nbsp;and we’re diving headfirst into our sexual awakenings… because apparently when Shrek turns human in&nbsp;Shrek 2, that did something to Sophia! From dolphins allegedly plotting kidnappings, to&nbsp;Blue Therapy&nbsp;debates, to the most unhinged confessions (yes, we’re talking peeing, unexpected kinks, and questionable bedtime behaviour 😭)… this episode is all over the place in the best way. It’s chaotic and honestly? We might need help. P.S. Gerald, if you’re listening… please don’t kidnap us.</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: You’ll never guess who he cheated on me with…</title>
			<itunes:title>Boy Talk: You’ll never guess who he cheated on me with…</itunes:title>
			<pubDate>Wed, 11 Mar 2026 00:01:00 GMT</pubDate>
			<itunes:duration>1:02:32</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/69b0384256b1c82b94ea4c59/media.mp3" length="60040672" type="audio/mpeg"/>
			<guid isPermaLink="false">69b0384256b1c82b94ea4c59</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-youll-never-guess-who-he-cheated-on-me-with</link>
			<acast:episodeId>69b0384256b1c82b94ea4c59</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-youll-never-guess-who-he-cheated-on-me-with</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdj/kgtjmxCZWnPCnXxNalCo4be25Zv6Vr/2kDcgEZi2MH7f+b9NrqpYUhH/loVvndeC9O4E6RZw+aWhZMpyi1hbcRWiavlcoo8iMT5mumiFoFImp24bq9VPAaQOeG/VkUXAVq+PaiKCR8dpZP+VctUHlpAeGjqx+qWOg3BXqf8rwemVJEuwKY8tHb7NhV2rF5jraVgMP+o+llrCFHwiF/cSxSAazkRGik9U6FR+s+Lrd3JclZhruBuPo8pgAB+8WPqJTM6IKtm/5v8hYA7sH8T]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>342</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1773160691668-bac3fe6f-0b24-49c9-a463-aaa091cf917e.jpeg"/>
			<description><![CDATA[<p>It’s the pinnacle of your week, S+C are back in TGB talking all things males! From getting undressed under the covers to blowing noses in the shower, the girls dive into all the slightly odd things your boyfriends do that drive you crazy in Question of The Week. Cinzia calls Sophia out on her lack of TikTok responses… we all know that one person who re-sends TikToks you’ve already sent them! Plus, your dilemmas are answered, and let’s just say one of them takes a very unexpected turn.</p><br><p>We want to hear from you! 💌 Fill out our audience survey here:<strong> </strong><a href="https://thegirlsbathroom.typeform.com/AudienceSurvey" rel="noopener noreferrer" target="_blank">https://thegirlsbathroom.typeform.com/AudienceSurvey</a></p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It’s the pinnacle of your week, S+C are back in TGB talking all things males! From getting undressed under the covers to blowing noses in the shower, the girls dive into all the slightly odd things your boyfriends do that drive you crazy in Question of The Week. Cinzia calls Sophia out on her lack of TikTok responses… we all know that one person who re-sends TikToks you’ve already sent them! Plus, your dilemmas are answered, and let’s just say one of them takes a very unexpected turn.</p><br><p>We want to hear from you! 💌 Fill out our audience survey here:<strong> </strong><a href="https://thegirlsbathroom.typeform.com/AudienceSurvey" rel="noopener noreferrer" target="_blank">https://thegirlsbathroom.typeform.com/AudienceSurvey</a></p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Her dad wants to WINE AND DINE ME?!</title>
			<itunes:title>Girl Talk: Her dad wants to WINE AND DINE ME?!</itunes:title>
			<pubDate>Wed, 04 Mar 2026 00:05:00 GMT</pubDate>
			<itunes:duration>1:02:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/69a71b062fb50a2e1767dc17/media.mp3" length="90808592" type="audio/mpeg"/>
			<guid isPermaLink="false">69a71b062fb50a2e1767dc17</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-her-dad-wants-to-wine-and-dine-me</link>
			<acast:episodeId>69a71b062fb50a2e1767dc17</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-her-dad-wants-to-wine-and-dine-me</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcD1oHznqbjdXMXff0hmEfuzFhqiwXjyCYMca0boiamip6ZUXDbPAQZCpaWxa16EF0E6Nc8dT8uforQbenqBe+ViM36ce679XXzQRA5L1ab7IduME1EfxyYn8ishp8UmTakaZOnb7dcP+T0WGV/64F9VW9zlJTmaMqFRwlYyUeyXUfYkRJt0V8V3T4zTG8+WeByBbV/aXBu7kXGeF7Q7+e21gKGUFcEuBTJIN7ZeJoXOJSdqWS/+ONXL7eDqyQi8LWnE8p8AKMZonS/TFB6KubxI6L9DUPtYuFJFB+NEOT3pg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>341</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1772558180991-a04e36b0-32a1-466b-82c2-d94f79d0dc99.jpeg"/>
			<description><![CDATA[<p>Spring has well and truly sprung, and we are feeling it here at TGB HQ, the toes are out and the 3/4 sleeve tops are on. We're so here for nudelates (IFYKYK), but… we’ll take our own mats, thank you! In this episode, we uncover a wine-and-dine bandit and a tale as old as time: the never-ending problems of the girl best friend. Will Sarah and Susan make amends after listening to this episode? Who knows…As always, all faith is restored in Star of the Week, where a first date is recreated for a very special reason.</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Spring has well and truly sprung, and we are feeling it here at TGB HQ, the toes are out and the 3/4 sleeve tops are on. We're so here for nudelates (IFYKYK), but… we’ll take our own mats, thank you! In this episode, we uncover a wine-and-dine bandit and a tale as old as time: the never-ending problems of the girl best friend. Will Sarah and Susan make amends after listening to this episode? Who knows…As always, all faith is restored in Star of the Week, where a first date is recreated for a very special reason.</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My boyfriend hacked my online banking???</title>
			<itunes:title>Boy Talk: My boyfriend hacked my online banking???</itunes:title>
			<pubDate>Wed, 25 Feb 2026 00:01:00 GMT</pubDate>
			<itunes:duration>1:01:46</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/699da038e58ea91138833be0/media.mp3" length="89741136" type="audio/mpeg"/>
			<guid isPermaLink="false">699da038e58ea91138833be0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-boyfriend-hacked-my-online-banking</link>
			<acast:episodeId>699da038e58ea91138833be0</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-boyfriend-hacked-my-online-banking</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCca5OwJ1goYEOTOod7LyOD/A7/z/deoTH4t2CfeH9z3OHOw50SHCZaYFKVKxXEJZ+TmjQ08xNhx0zQ6vGEK/yJhHItjyOWkYbsm/S55ltMIlp4ovcNjHPacZo+84cREuHN0xSVdx0td5qrRFcT3qrm3HPlAUVOngT4wzIGjYSazb6wJBZKtz3oA7Kh5SbsZH70juUUW0kT4hFrmyt5VgdSvdDpFJQ1zxc7lAXSXmxFZlwBWvwpvGA7NjTkQoQ8j9oCoLmbMJIO94LQrAM4+XXrn9cTHaYO6bP3T14aFlFQL2w==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>340</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1771936424968-d9035457-d7f2-4674-81f2-f18167d7e18c.jpeg"/>
			<description><![CDATA[<p>We have been through it all this week and it's only Wednesday! Nostalgia is high as we go through your first ever songs on your iPods big shoutout to the iPod nanos, and Cinzia shares her blow dry tips for that extra va-va-voom. Our Sarah's reach out in despair this week, from a fiancé with extremely smelly breath to another Brian who is a bit too comfortable with his girlfriend's banking app and lets not forget the Brian who won't get rid of his exes engagement ring...this is not a case of reduce, reuse, recycle Brian!! Buckle up girlies we're in for a crazy ride!!</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>We have been through it all this week and it's only Wednesday! Nostalgia is high as we go through your first ever songs on your iPods big shoutout to the iPod nanos, and Cinzia shares her blow dry tips for that extra va-va-voom. Our Sarah's reach out in despair this week, from a fiancé with extremely smelly breath to another Brian who is a bit too comfortable with his girlfriend's banking app and lets not forget the Brian who won't get rid of his exes engagement ring...this is not a case of reduce, reuse, recycle Brian!! Buckle up girlies we're in for a crazy ride!!</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: His mum is STEALING my clothes??</title>
			<itunes:title>Girl Talk: His mum is STEALING my clothes??</itunes:title>
			<pubDate>Wed, 18 Feb 2026 00:01:00 GMT</pubDate>
			<itunes:duration>1:13:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6994902308b58c2f93f7f26b/media.mp3" length="106688575" type="audio/mpeg"/>
			<guid isPermaLink="false">6994902308b58c2f93f7f26b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-his-mum-is-stealing-my-clothes</link>
			<acast:episodeId>6994902308b58c2f93f7f26b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-his-mum-is-stealing-my-clothes</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCctGNRHNyWpqWW3+sJSU2hVdVeX5BNvRBNit2p1vs9OOBZVoBgC4vxHOON08O94pmLfMRlxInorxHEKpD3vT6SJLulsddafpuO2X+Uzy2zNBHwTiPKIckw7MeUkfMByWov8zeRvPhATZKTyHJwqL0uLVxWDNh0BzepezfTbOe9Yun9uZJHBWKy3Dg9yEdWsZ+FLRCdzCW5nGX3FY7WOMbSwJsDkJcGN9kF46V+S7JGZQmN++58dranU0tFc3Aerz4fyWNGCRZ+QgOuZ91kGPDzw]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>339</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1771343879131-00ca78fc-a980-40fa-87d7-e3fff5f840c3.jpeg"/>
			<description><![CDATA[<p>Will their big toenails ever be the same again? The girls are asking the important questions...and quickly discovering they might need the help of a podiatrist (definitely not a “pedomatrist”). Those with toenail problems please enter stage right! But toe troubles aren’t the only drama unfolding… We’re also investigating a mysterious case of stolen clothing. Our poor Sarah is simply trying to be reunited with her beloved slippers. Will justice be served?</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Will their big toenails ever be the same again? The girls are asking the important questions...and quickly discovering they might need the help of a podiatrist (definitely not a “pedomatrist”). Those with toenail problems please enter stage right! But toe troubles aren’t the only drama unfolding… We’re also investigating a mysterious case of stolen clothing. Our poor Sarah is simply trying to be reunited with her beloved slippers. Will justice be served?</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Valentine's Special: No room at the love lodge!?]]></title>
			<itunes:title><![CDATA[Valentine's Special: No room at the love lodge!?]]></itunes:title>
			<pubDate>Wed, 11 Feb 2026 00:01:00 GMT</pubDate>
			<itunes:duration>1:12:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/698b42eeba80cf1ecbfc928e/media.mp3" length="104902467" type="audio/mpeg"/>
			<guid isPermaLink="false">698b42eeba80cf1ecbfc928e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/valentines-special-no-room-at-the-love-lodge</link>
			<acast:episodeId>698b42eeba80cf1ecbfc928e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>valentines-special-no-room-at-the-love-lodge</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe1Nb1kxoRnH5E4aKNT8w1hIkou3rNmIL7iW8wZfpuxE58IpX/UCkEvpqUMPWGLfaRzrVguveQppKN3ZrVEMc/kkCfJdZ7N6UZAw8hE9Ehszizk1bkToD1ivpgMZ2xHLCFmyB8UDuCBSG8Yzur+PnArlQ9IzZtxniXZSlLp4YFeTtOby/O9zHZ7L4dBqhWzIUK/RhnCEPRpOsHPcATPBWYSLsJe4VRSTVL+SwvEOxFawddYiNCXVydVmg/yUrLGCMpsK4WyZZlqvqmNFnQokxquR1LLIKs2m0zP6BCwo+kLpQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>338</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1770734263607-4bed8d50-ba81-41f8-b36e-22977f6d9cbb.jpeg"/>
			<description><![CDATA[<p>Valentine’s Day is approaching, and here at TGB HQ we’re trying to figure out one very important question: what is the boy equivalent of flowers??? One of our Sarahs admits to going on a breakfast date… a lunch date… and a dinner date all in one Valentine’s Day...clever? We think so! Are we really asking for too much these days, equality or chivalry? One Sarah asks herself that very question in this week’s Valentine’s Special.</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com </p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Valentine’s Day is approaching, and here at TGB HQ we’re trying to figure out one very important question: what is the boy equivalent of flowers??? One of our Sarahs admits to going on a breakfast date… a lunch date… and a dinner date all in one Valentine’s Day...clever? We think so! Are we really asking for too much these days, equality or chivalry? One Sarah asks herself that very question in this week’s Valentine’s Special.</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com </p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title> Girl Talk: Is my mum sabotaging my proposal?!</title>
			<itunes:title> Girl Talk: Is my mum sabotaging my proposal?!</itunes:title>
			<pubDate>Wed, 04 Feb 2026 00:01:00 GMT</pubDate>
			<itunes:duration>1:03:29</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/698222c7cbdc915a1c11535b/media.mp3" length="91940779" type="audio/mpeg"/>
			<guid isPermaLink="false">698222c7cbdc915a1c11535b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/is-my-mum-sabotaging-my-proposal</link>
			<acast:episodeId>698222c7cbdc915a1c11535b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>is-my-mum-sabotaging-my-proposal</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf1//s3BUY0GQMvG2mH9x2yHbb59/Co8uCPgP7A2SpRdxMClNzTEZCsCZmBd+Xv9+vHGEhwy8BZ9YZrvwDlGhdTQDKh6TzW6Nn8o25T+WaR+GeHfOV+cWspnUI+yfQDEOdmw1j4GYZEPOGIPfYaXAi4gPk/FX3AOpPGC7NfVMUg8dcAo7i14uQauPd6anypl53xuIIPFPMwlU+xieukMW2/WVnGzSlhFptZnV3f2RIS7I0ovKPZlaG7M1ttF7c+7rxuVRWvgwvdYO9qE+F+4P7n]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>337</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1770136228268-d7f58e4f-99a6-40ec-9467-0f3e6cadb099.jpeg"/>
			<description><![CDATA[<p>Men using the stairmaster, men on scooters, eating apples and microfibre cloths… niche pet peeves have officially hit an all-time high here at TGB HQ. This week we’re debating prom dress regrets (spoiler: we have none and we stand by our choices), before diving into a truly unhinged dilemma involving a saboteur...and yes, it’s Sarah’s own mum. Plus, we’ve got a special one-off star of the week to restore our faith in girlhood!</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram <a href="https://www.instagram.com/thegirlsbathroom/" rel="noopener noreferrer" target="_blank">@thegirlsbathroom</a></p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Men using the stairmaster, men on scooters, eating apples and microfibre cloths… niche pet peeves have officially hit an all-time high here at TGB HQ. This week we’re debating prom dress regrets (spoiler: we have none and we stand by our choices), before diving into a truly unhinged dilemma involving a saboteur...and yes, it’s Sarah’s own mum. Plus, we’ve got a special one-off star of the week to restore our faith in girlhood!</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram <a href="https://www.instagram.com/thegirlsbathroom/" rel="noopener noreferrer" target="_blank">@thegirlsbathroom</a></p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>X-RATED: WHOOP told me he was masturbating?!</title>
			<itunes:title>X-RATED: WHOOP told me he was masturbating?!</itunes:title>
			<pubDate>Wed, 28 Jan 2026 00:01:00 GMT</pubDate>
			<itunes:duration>52:01</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6978dbfda40f59499ea5af3e/media.mp3" length="75499148" type="audio/mpeg"/>
			<guid isPermaLink="false">6978dbfda40f59499ea5af3e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/x-rated-whoop-told-me-he-was-masturbating</link>
			<acast:episodeId>6978dbfda40f59499ea5af3e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>x-rated-whoop-told-me-he-was-masturbating</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeimBjTlP1JBmZl590AfnbwV0yoPNNP/EaeiDU7q5yYOvGX8xp/GqDuSITvmXglZjqCWZdHFXrd4M7xka/kujcA3sNhhKvSz/7BJvYJJqXAT4wUshPbynSZbKKhZS6YsToNVCXFPZ4SyaodAS6CsRHyNVp2yVa8VGJ6ihMZ4lKy2Xuj9osSuxmOguknXh0TzC3ZQ7MBhgLnLCmb4LpGXqJnXTaXgC7NMIfLzhXr+QLyPcJF6lBkq+98zQc7VAHtIVvWiZvWAzctUyfuhXRe2N0L]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>336</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1769528274983-d87b3d85-adc3-4446-ad6c-e22f142c1fe1.jpeg"/>
			<description><![CDATA[<p>The girls debate Twilight loyalties, crown the bush as vintage chic, and unpack listener dilemmas, from threesomes to surprise belfies (yes, bum selfies). Plus, one Sarah finds out some very interesting information through her partner’s Whoop! And lo and behold, we have a vibrator success story. Hurrah!</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram <a href="https://www.instagram.com/thegirlsbathroom/" rel="noopener noreferrer" target="_blank">@thegirlsbathroom</a></p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>The girls debate Twilight loyalties, crown the bush as vintage chic, and unpack listener dilemmas, from threesomes to surprise belfies (yes, bum selfies). Plus, one Sarah finds out some very interesting information through her partner’s Whoop! And lo and behold, we have a vibrator success story. Hurrah!</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram <a href="https://www.instagram.com/thegirlsbathroom/" rel="noopener noreferrer" target="_blank">@thegirlsbathroom</a></p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Does it count as cheating…if I felt single?</title>
			<itunes:title>Boy Talk: Does it count as cheating…if I felt single?</itunes:title>
			<pubDate>Wed, 21 Jan 2026 00:01:00 GMT</pubDate>
			<itunes:duration>1:13:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/696f9b0bf66127afddbeb085/media.mp3" length="107237395" type="audio/mpeg"/>
			<guid isPermaLink="false">696f9b0bf66127afddbeb085</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk</link>
			<acast:episodeId>696f9b0bf66127afddbeb085</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdgIPBjpkaGYc9e+DlaER2XHA1hbCWepNGhlikfmshdAJWRtJOJf98Vo5aAsC08CloMIJgEkioB/k24VIAEPl5oEsvztIo/S4WiFd5xb8JLFKoNY3gHMgo+UAWMIaWVVYJHaLghTbdkXwb8t6WTQgeG+Gj5eC85P51h6Svgev7APxFP1yiBpcvH/8KT21bSXe2oi6fRaia5B5bnZqQ8t8Kl5h+3v097iMprMIjr57lEru5wLyMWwcuy2kIsuVdvz+WRKtVufM5myhZpHcAocbznVF/2COoNp7YJ03C4me8HXQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>335</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1768919597411-676658b9-6f37-4efd-90de-7f0c437bd097.jpeg"/>
			<description><![CDATA[<p>This week on The Girls Bathroom we are asking you, what is the cringiest thing you have ever done to flirt? From pretending to be a gamer girl to stalking his Spotify and even letting your crush give you an eyebrow split we have truly heard it all! Our Hinge chronicles are never ending here at TGB HQ as one of our Sarahs discovers it is her Brians most used app...ouch!!! Meanwhile another Sarah finds herself asking the question does it count as cheating if she felt single?? Tune in next Wednesday for Girl Talk!</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram <a href="https://www.instagram.com/thegirlsbathroom/" rel="noopener noreferrer" target="_blank">@thegirlsbathroom</a></p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>This week on The Girls Bathroom we are asking you, what is the cringiest thing you have ever done to flirt? From pretending to be a gamer girl to stalking his Spotify and even letting your crush give you an eyebrow split we have truly heard it all! Our Hinge chronicles are never ending here at TGB HQ as one of our Sarahs discovers it is her Brians most used app...ouch!!! Meanwhile another Sarah finds herself asking the question does it count as cheating if she felt single?? Tune in next Wednesday for Girl Talk!</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram <a href="https://www.instagram.com/thegirlsbathroom/" rel="noopener noreferrer" target="_blank">@thegirlsbathroom</a></p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My bestie is CATFISHING??</title>
			<itunes:title>Girl Talk: My bestie is CATFISHING??</itunes:title>
			<pubDate>Wed, 14 Jan 2026 00:01:00 GMT</pubDate>
			<itunes:duration>1:08:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/69666cebeb641da7e2496308/media.mp3" length="99779638" type="audio/mpeg"/>
			<guid isPermaLink="false">69666cebeb641da7e2496308</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-bestie-is-catfishing</link>
			<acast:episodeId>69666cebeb641da7e2496308</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-bestie-is-catfishing</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFPvCa8ks4rS3tDY9XvEGMkaPE82chSKV00tpMlG5FxXldHE6DvBmY76dcv8V8rXxm8ITqG44XIojyZuWO9BBDKPTz+L7dRx3GX6jIsoNQPVGJfyjFa4zvDqUcT8oEwlu6PhWQoABahO4FPjlCKTJzopDmbosU97MtPZELpSiNJabEWhilLt+CNyGuZ26US8ppxpT4oVoofQ9mY0JY9V/wgqnOXtyXAiNl1Ctg3F/WTWQKciIkc6fDr8Kw9FEpKENhDunUhi2ZSkJKRL7tsKHi8QlAwPenxv8jtoD5ziWxIQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>334</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1768320181089-4a81267c-7af7-4a25-8fd0-a7178fc23446.jpeg"/>
			<description><![CDATA[<p>It’s Wednesday and we’re back in TGB HQ where things get chaotic immediately as we try and fail to figure out the difference between Hozier and Gotye, because why is the resemblance actually uncanny! Once we get past that identity crisis we dive straight into your dilemmas. On this week's agenda, we are dealing with an unwanted holiday guest, choosing between friends and a Brian yes really, jealous friends and a full blown catfish situation! But the real question is would you help your friend catfish???</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram <a href="https://www.instagram.com/thegirlsbathroom/" rel="noopener noreferrer" target="_blank">@thegirlsbathroom</a></p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It’s Wednesday and we’re back in TGB HQ where things get chaotic immediately as we try and fail to figure out the difference between Hozier and Gotye, because why is the resemblance actually uncanny! Once we get past that identity crisis we dive straight into your dilemmas. On this week's agenda, we are dealing with an unwanted holiday guest, choosing between friends and a Brian yes really, jealous friends and a full blown catfish situation! But the real question is would you help your friend catfish???</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram <a href="https://www.instagram.com/thegirlsbathroom/" rel="noopener noreferrer" target="_blank">@thegirlsbathroom</a></p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I planned our wedding…but he says we are just smashing?! </title>
			<itunes:title>Boy Talk: I planned our wedding…but he says we are just smashing?! </itunes:title>
			<pubDate>Wed, 07 Jan 2026 00:01:00 GMT</pubDate>
			<itunes:duration>1:10:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/695cf5f0c61b033dae5b669d/media.mp3" length="101885856" type="audio/mpeg"/>
			<guid isPermaLink="false">695cf5f0c61b033dae5b669d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-i-planned-our-weddingbut-he-says-we-are-just-smashi</link>
			<acast:episodeId>695cf5f0c61b033dae5b669d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-i-planned-our-weddingbut-he-says-we-are-just-smashi</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcwWOIp6xaEdyNTTHa+5Dqzp6+BBLbxrRaSZn5YhqB9fKX5tekNhH0llQfmsRuJa+L5blepEkCJTMmYkOLiVeQdfVuP7OI4+Z3PXv3Jmh8899nQss4K43h6T38h68l7zQD2/bU3Io0XTQL71yHD501sJAtpyKmmIV6/s7P3Cnzl6LLM1jHJM34qF9BAPLfXJ1dUJWoRdc8Q1YogDi8dUgGXDNoweEkmJ7fWXOt3MxBVX4L2bbAjhTrTaNUf4AonjDfhg+VwXnV6EVUa8+OZlzBsbv5qhysLzJACjFEGmJ4zjg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>333</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1767699539147-31b2ff98-d2f3-47a8-83e9-80396c3c430a.jpeg"/>
			<description><![CDATA[<p>It’s the first episode of 2026, and although we’ve adopted our new motto, “let it flow and let it go,” men are still causing our Sarahs trouble. One Sarah is negotiating romance via Monzo split-the-bill requests, while another is planning a whole future with a man who ends it in two words.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It’s the first episode of 2026, and although we’ve adopted our new motto, “let it flow and let it go,” men are still causing our Sarahs trouble. One Sarah is negotiating romance via Monzo split-the-bill requests, while another is planning a whole future with a man who ends it in two words.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: He's leaving me on NYE?!]]></title>
			<itunes:title><![CDATA[Girl Talk: He's leaving me on NYE?!]]></itunes:title>
			<pubDate>Wed, 31 Dec 2025 00:01:00 GMT</pubDate>
			<itunes:duration>55:11</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6953fbd144fae3e802dcd531/media.mp3" length="79929631" type="audio/mpeg"/>
			<guid isPermaLink="false">6953fbd144fae3e802dcd531</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-hes-leaving-me-on-nye</link>
			<acast:episodeId>6953fbd144fae3e802dcd531</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-hes-leaving-me-on-nye</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfGXdxwDN2xiOfMjc5gPJpUhm+dvtPHFJ/i34nZns69Dt3uxkvLYa/B9XHE3dhMBt1kFTHaMSrYGo2fdbvEn7cb/y82c1zvRJ8N8lGP+OMWavq/+vt+kEVqcJntdqtO/OeEDbtm2VrJ4rt2iAdVjDSdx+E71y8aaDeMTDzEstdY/TLdhYh7Bc2cH9Ddm84sc2/4LWeeA4j/QHxgJtTDYlB16dtRFM9KaEideLX6EtQk8xj8XX4K42XpFx6BUROplyYQwtRtfu0j0TbaYArJzRwWqGPKnWCSFLwdHQbG+TyMFQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>332</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1767110710617-c033e75e-2b60-4937-9edf-1c1d4f966b05.jpeg"/>
			<description><![CDATA[<p>2026 is almost here and we’re officially entering our&nbsp;<em>let it flow and let it go</em>&nbsp;era! Could hypnotising be on the cards for 2026? Maybe. One Sarah has taken borrowing clothes to the next level by stealing her sister’s identity (Shane… or Jane enter stage left), while another Sarah is stressing because her Brian might not spend New Year’s Eve with her.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>2026 is almost here and we’re officially entering our&nbsp;<em>let it flow and let it go</em>&nbsp;era! Could hypnotising be on the cards for 2026? Maybe. One Sarah has taken borrowing clothes to the next level by stealing her sister’s identity (Shane… or Jane enter stage left), while another Sarah is stressing because her Brian might not spend New Year’s Eve with her.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Christmas Eve Special: She won’t let him spend Christmas with me!!</title>
			<itunes:title>Christmas Eve Special: She won’t let him spend Christmas with me!!</itunes:title>
			<pubDate>Wed, 24 Dec 2025 00:01:00 GMT</pubDate>
			<itunes:duration>1:14:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/694a5e9ff75671173914f81d/media.mp3" length="107702187" type="audio/mpeg"/>
			<guid isPermaLink="false">694a5e9ff75671173914f81d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/christmas-special-she-wont-let-him-spend-christmas-with-me</link>
			<acast:episodeId>694a5e9ff75671173914f81d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>christmas-special-she-wont-let-him-spend-christmas-with-me</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCc/te+9r3F+jl+iaMSwQYF2qdd3ZNj1Vv51EeVMXulxjJQaiaauYO56eIi62DAd/XwXIfA83kRoX82C5f75EBJ4GVeS8trYO2UiMX+AZmcSX3BgKKgLfKU/vmvYozmeM5KbaAanpE3em6tqDkc+TWVYItY/cA3IQ38HWxD0iDdDyTH7XzSC8HIOUJLR7TruejS+sC1E5Izp+knQoxMiY780+KOcg7WfwS8YyzgUi5ftWJhKGFfIsRTJU+KyUaUC3QHd2sNQCJI4gHtFA2KFTHHvA1Pc8VFwzDGtLZ8GzXJypQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>331</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1766494621164-0e6afe08-201a-4947-bcbb-40153e0ddbaf.jpeg"/>
			<description><![CDATA[<p>It was a freezing cold Christmas eve at TGB HQ, Sarah’s far and wide wrote in with their Christmas dilemmas. One Sarah ponders on how to survive the festive period with a copycat sister in law and another wonders if she’ll ever see her own family on Christmas Day…because tis it not ever the season for a dilemma??</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It was a freezing cold Christmas eve at TGB HQ, Sarah’s far and wide wrote in with their Christmas dilemmas. One Sarah ponders on how to survive the festive period with a copycat sister in law and another wonders if she’ll ever see her own family on Christmas Day…because tis it not ever the season for a dilemma??</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He said he was a SPY?!!!</title>
			<itunes:title>Boy Talk: He said he was a SPY?!!!</itunes:title>
			<pubDate>Wed, 17 Dec 2025 00:01:00 GMT</pubDate>
			<itunes:duration>1:16:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/69419a7c891c3619dc89f965/media.mp3" length="111319352" type="audio/mpeg"/>
			<guid isPermaLink="false">69419a7c891c3619dc89f965</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-said-he-was-a-spy</link>
			<acast:episodeId>69419a7c891c3619dc89f965</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-said-he-was-a-spy</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCehW+9kADjeFzgri+c1ECthzyprQZNlSGtyewTaYaT/cPsImhAkb+Yvy2IMvDnBcX4ws5jTvCeOq2BD3As/322aPci55vdwPaAsCBRvrYWIS9qtQG8jOTHtuUUJ5fZDK4953WWCBXFpTv8sRZu/r7+5ujPH7VrciNYT5Z9ufS03hVtRID3ceR5chVxSLmGEsMcP3bvEO6MFt6BgO+gSaG8vtL6dR9B2pct/MOIVNWrrHwY5mXNTTo1rDfqcBIqZD/AKEq+DUtqeqUKyHq0F36dOUsFLpBwD4BFQvX6piVrI0w==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>330</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1765903126012-c8e43307-c87c-424e-9ad2-9f4ea2737433.jpeg"/>
			<description><![CDATA[<p>The countdown to Christmas is on and we’re in our PJs, getting in the festive spirit! This week, our Sarahs are keeping us BUSY. One Sarah has been told by a Brian that he’s a&nbsp;<em>spy</em>&nbsp;(yes, seriously…), while another Sarah is wondering why her Brian has apparently blacklisted her family from Christmas forever. Festive? Yes. Concerning? Also yes.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>The countdown to Christmas is on and we’re in our PJs, getting in the festive spirit! This week, our Sarahs are keeping us BUSY. One Sarah has been told by a Brian that he’s a&nbsp;<em>spy</em>&nbsp;(yes, seriously…), while another Sarah is wondering why her Brian has apparently blacklisted her family from Christmas forever. Festive? Yes. Concerning? Also yes.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: His mum is obsessed with our sex life?</title>
			<itunes:title>Girl Talk: His mum is obsessed with our sex life?</itunes:title>
			<pubDate>Wed, 10 Dec 2025 00:01:00 GMT</pubDate>
			<itunes:duration>56:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/69382998f05d0f360743e45b/media.mp3" length="81771359" type="audio/mpeg"/>
			<guid isPermaLink="false">69382998f05d0f360743e45b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-his-mum-is-obsessed-with-our-sex-life</link>
			<acast:episodeId>69382998f05d0f360743e45b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-his-mum-is-obsessed-with-our-sex-life</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe6GayDse1PAVUPVhZ9MQUNamdEOy7C+dG7tBIgeGVUklBh1yPA6ycSSyncRZ5JA04nF7YYlypJ7SPNuKFYfHZcRR6kP/X3MtaL0mE+2wUeNHIEZfQ6LsTqUPYfA7stlJvNRY8aqEOQXs2DZwpxS0QW1Fjqk4msdTckmJTJ71Bw/2O9nUbRfdP22Tl+Cu7yHbl9GNlXnPKNtk5WObIyN1jKSVvK26hGv/RDvIi+34aRwxHjoqc9QKxWpCL92WTVjaVhaqr3rFoeiUcp3tIqoGpg9Ocnqv8ByVWnH7DfY4p3uQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>329</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1765287971795-5b8fd9bd-94c1-4bbc-a5d1-e9039bc80a12.jpeg"/>
			<description><![CDATA[<p>Wednesday is here and we’re diving into family chaos at TGB HQ! An auntie is convinced her niece is trying to steal her Brian. Yep, that’s where we’re at.&nbsp;And as if that wasn’t enough, we’ve got a Brian whose relationship with his mum is just a touch too open. Like, “discussing his love life over spaghetti” open.&nbsp;</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Wednesday is here and we’re diving into family chaos at TGB HQ! An auntie is convinced her niece is trying to steal her Brian. Yep, that’s where we’re at.&nbsp;And as if that wasn’t enough, we’ve got a Brian whose relationship with his mum is just a touch too open. Like, “discussing his love life over spaghetti” open.&nbsp;</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>X-RATED: He watches WHAT porn...?</title>
			<itunes:title>X-RATED: He watches WHAT porn...?</itunes:title>
			<pubDate>Wed, 03 Dec 2025 00:01:00 GMT</pubDate>
			<itunes:duration>1:02:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/692ef0e9c6420629333807e0/media.mp3" length="91050214" type="audio/mpeg"/>
			<guid isPermaLink="false">692ef0e9c6420629333807e0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/x-rated-he-watches-what-porn</link>
			<acast:episodeId>692ef0e9c6420629333807e0</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>x-rated-he-watches-what-porn</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcXIS+UE8HwmHVj0PVgz87Sx5eI3femCOU1HZvVdDQfK1HDl+bAc83SXEFYrEBMyEYAa1Cibm4AwAZTJtcRC75lNeCBRc6nJgrBTMokZkAJSI+rxoAomRqo5QEt/lat+OhBhUnyutFfDxXsGOrSA9b7HfDxbXR41TDK0ebmRFbpyOMl18cOU3WXaK27Ox0ic3K91frxsGWv4zgTQyGUH5GXD73n2GPA+xpQZf3eapMotkUKslOHhNa1RlIsrydH+/VSfaric4bvCyfJwGcBxsxibNuoIwrGHvwwe0+ShEUPnA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>328</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1764683389292-e65add07-ee1b-4b64-8f86-ab9f6ba40837.jpeg"/>
			<description><![CDATA[<p>The festive season has officially begun, and you&nbsp;know&nbsp;TGB HQ went all-in on the decorations. But what’s Christmas without a little X-rated chaos? Our Sarahs have slid into the inbox with some truly wild dilemmas: one battling an aggressively sore labia and another who’s just discovered a… let’s say&nbsp;<em>niche</em>&nbsp;new porn category. Don’t worry, we’ll bring the wholesome vibes back just in time for&nbsp;Star of the Week, where a Brian pulls out all the stops to treat his Sarah before their big day.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>The festive season has officially begun, and you&nbsp;know&nbsp;TGB HQ went all-in on the decorations. But what’s Christmas without a little X-rated chaos? Our Sarahs have slid into the inbox with some truly wild dilemmas: one battling an aggressively sore labia and another who’s just discovered a… let’s say&nbsp;<em>niche</em>&nbsp;new porn category. Don’t worry, we’ll bring the wholesome vibes back just in time for&nbsp;Star of the Week, where a Brian pulls out all the stops to treat his Sarah before their big day.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He made me sign an NDA to be with him</title>
			<itunes:title>Boy Talk: He made me sign an NDA to be with him</itunes:title>
			<pubDate>Wed, 26 Nov 2025 00:01:00 GMT</pubDate>
			<itunes:duration>1:07:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6925efa3e85b4ee0f9d5d64d/media.mp3" length="97779296" type="audio/mpeg"/>
			<guid isPermaLink="false">6925efa3e85b4ee0f9d5d64d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-made-me-sign-an-nda-to-be-with-him</link>
			<acast:episodeId>6925efa3e85b4ee0f9d5d64d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-made-me-sign-an-nda-to-be-with-him</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdr+vOJCzetBVzKy/eOkyg8fRan4Gf3yULunh4IdaJh+qM/dMG3fA3NPWyeqLEFnhTaAGO8Leqoxc7x6W3TBVqxd5K+f0T2xqr5tCAMmc5F6uPqll6y1YbefH3aCO13FIgAD+Bc19qPn7OmL0uEVazLPQnWkv1YXKSJmPRXE29+BflTgngGlEyjdDaupzvbdJEj8dkYlZO1N03+bf9JnqpBzQ/pOjsyjCsvH6sQu/5Oixqaqk8WXo6PPLP/1q5C4uu7DB2j2L9xikejLC+RCsOC]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>327</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1764093289227-69f70450-9d14-47ea-8061-9a1960a3cdb9.jpeg"/>
			<description><![CDATA[<p>We’ve signed NDAs for work… but for a relationship? Absolutely not... well, unless you’re one of our Sarahs, because she’s signed one and she is in deep! We’re diving into festive decorations, your weird food combos, and of course a birthday shoutout to a fabulous husband in Star of the Week!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>We’ve signed NDAs for work… but for a relationship? Absolutely not... well, unless you’re one of our Sarahs, because she’s signed one and she is in deep! We’re diving into festive decorations, your weird food combos, and of course a birthday shoutout to a fabulous husband in Star of the Week!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I’ve got TikTok beef with his ex</title>
			<itunes:title>Girl Talk: I’ve got TikTok beef with his ex</itunes:title>
			<pubDate>Wed, 19 Nov 2025 00:01:00 GMT</pubDate>
			<itunes:duration>1:05:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/691c9770589629f7d6d46977/media.mp3" length="96064419" type="audio/mpeg"/>
			<guid isPermaLink="false">691c9770589629f7d6d46977</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-ive-got-tiktok-beef-with-his-ex</link>
			<acast:episodeId>691c9770589629f7d6d46977</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-ive-got-tiktok-beef-with-his-ex</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcvhDhrltLddf9Pmd5Zj+T+SU8EBzQjQ71lRGGyKMtjR1EoNfxrkgJcDqmyW7cujx7asoO2Hdq5rcCqx/2yThje2Yxx7Ex5hZJ2EmcvSIwFmmDhRy+evSHatAR26yzNrbaZncj1lZnOIwO+vp6nNBD0EVoMmWRBqfpeZHbnCOeEqL8Qe78aLt7PvG5FtLPcQ8d43HPclDVV/5t7l4rftXu3eFN+M6I92nNSqGPMTjFj8MhM2p5zvMs+FI/v4TIfEivyf070ip+qmlTOxixWn91z]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>326</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1763481170076-d53cc96b-8806-4a76-a3b0-9f31484b0cf2.jpeg"/>
			<description><![CDATA[<p>Is this truly a tale as old as time… the notorious crazy ex? One Sarah is facing a hacker ex causing chaos, whilst another Sarah finds an unwelcome visitor lurking in the group chat. P.S. Whoever’s still holding onto that long chip from primary school… it might finally be time to let it go!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Is this truly a tale as old as time… the notorious crazy ex? One Sarah is facing a hacker ex causing chaos, whilst another Sarah finds an unwelcome visitor lurking in the group chat. P.S. Whoever’s still holding onto that long chip from primary school… it might finally be time to let it go!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: You won’t believe why he won’t stay over?</title>
			<itunes:title>Boy Talk: You won’t believe why he won’t stay over?</itunes:title>
			<pubDate>Wed, 12 Nov 2025 00:01:00 GMT</pubDate>
			<itunes:duration>1:11:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6913345bdac02c1fcf9d402d/media.mp3" length="111190805" type="audio/mpeg"/>
			<guid isPermaLink="false">6913345bdac02c1fcf9d402d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-you-wont-believe-why-he-wont-stay-over</link>
			<acast:episodeId>6913345bdac02c1fcf9d402d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-you-wont-believe-why-he-wont-stay-over</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdn2l4cyfVPXbtpRazJTWrtrw++fAqp2DPjyLaIqDsRaHt1sti5i+v1+hA/KSQnStnRb3GT9fc0jXf/Or+XOC/BoFQ+nl0bC4HpJBs3WmRneyRBqvdLXEMfdp3fLuw4s3PN/EmD2Zf0NfxAs9IqMYJhEFoZNx7cWVeKAOSJTfksQ1BOXkIUf5g6qtmaQVOAlQMZ+cB79N3JBi5y3ZjPJ9BqwZ3DlukhmdBBmC96l9CJuZ43FRcMhEHsAkMKPzD9Sl8tHL0ctaX9Hmi80cCRALaR]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>325</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762866810007-c7f8ce98-7875-424f-9c8f-50ab1fb61263.jpeg"/>
			<description><![CDATA[<p>Happy Wednesdayyy!! Can you spot anything different? We’ve had a little makeover and we’re obsessed — hope you love it just as much as we do! This week, one Sarah might need to find herself a new man after discovering his rather peculiar bedtime habit. And as if that wasn’t enough, things take an unexpected turn when a Sarah writes in about a strange discovery around the flat involving her boyfriend’s boxers… something definitely isn’t adding up.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Happy Wednesdayyy!! Can you spot anything different? We’ve had a little makeover and we’re obsessed — hope you love it just as much as we do! This week, one Sarah might need to find herself a new man after discovering his rather peculiar bedtime habit. And as if that wasn’t enough, things take an unexpected turn when a Sarah writes in about a strange discovery around the flat involving her boyfriend’s boxers… something definitely isn’t adding up.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: She had sex… at MY wedding!!!</title>
			<itunes:title>Girl Talk: She had sex… at MY wedding!!!</itunes:title>
			<pubDate>Wed, 05 Nov 2025 00:01:00 GMT</pubDate>
			<itunes:duration>1:08:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/690a2986fd4632b31f70d043/media.mp3" length="108230114" type="audio/mpeg"/>
			<guid isPermaLink="false">690a2986fd4632b31f70d043</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-she-had-sex-at-my-wedding</link>
			<acast:episodeId>690a2986fd4632b31f70d043</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-she-had-sex-at-my-wedding</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd9x+GiyUVS7RB9cc+JoCcnWciYRyuKjFdIvdsh37s1w+p/z2+DO8LiNdBTXpOWLLidoeTeY0JhiPVhONK3Cyd15I273lsnuAsJcdQQNUco54KIpf2yix2wG6AqTR1SJghfUv4SQKhOk5nOi3JZicbokIzf3y3rReqXHFuv2bBbSvwvxwKyudMfMi5tt5tSO1OjQDfM/2Sh0tw70RQzrbBHVYE/VzEPeiwrE0Yh5qAi3ANoTuiPyFTBCZEeaFsez+3zi+oijVHcD/pjaD68WKom9eicC+Huh+ATO2z4AVGacg==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>324</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762340621224-a3fea3e3-ea62-4a93-a5e1-7e3e6bcecc7e.jpeg"/>
			<description><![CDATA[<p>We’re out of costume and back to our true selves—ready to dive into your dilemmas! This week, one Sarah writes in about a very&nbsp;smelly situation, while another opens up about her less-than-dreamy wedding day. But don’t worry, faith is fully restored with this week’s Star of the Week—a seriously swoon-worthy proposal!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>We’re out of costume and back to our true selves—ready to dive into your dilemmas! This week, one Sarah writes in about a very&nbsp;smelly situation, while another opens up about her less-than-dreamy wedding day. But don’t worry, faith is fully restored with this week’s Star of the Week—a seriously swoon-worthy proposal!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>A Haunted Halloween Special: Does this call for an etsy witch?</title>
			<itunes:title>A Haunted Halloween Special: Does this call for an etsy witch?</itunes:title>
			<pubDate>Wed, 29 Oct 2025 00:01:00 GMT</pubDate>
			<itunes:duration>1:04:10</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/690102312d04968b775c61ac/media.mp3" length="93559862" type="audio/mpeg"/>
			<guid isPermaLink="false">690102312d04968b775c61ac</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/a-haunted-halloween-special-does-this-call-for-an-etsy-witch</link>
			<acast:episodeId>690102312d04968b775c61ac</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>a-haunted-halloween-special-does-this-call-for-an-etsy-witch</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAv2g3sMTgfXRcQTrI9v8uMVdHs9FkeaNs2y6meh1b/6LEzTiSJVOoFjjkQ5rEsOPcWKIUZ+hLBcExzQHCTx4ia1LyrxQa4W3xNFFF7VPAY+mVlzNWAl7lUqFYs/2E7kHLyK7Fj7/zSL4iG95pR2sEhr0o+V7Vl3h0bEdNVgPEC1ASHmr8FO1kcByoA+Qs9wF0Mc/MfIqucBghw6/bMSk3CcU1J/bWOvQItEEZAjjT85Q]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>323</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1761720178767-317034f2-6245-4181-b201-7d24e4236577.jpeg"/>
			<description><![CDATA[<p>You’ve all been waiting for it... we proudly present our second Haunted Halloween Special! Our beloved Malvina is back with an update, and one of our Sarahs is seriously thinking about hiring her very own Etsy witch to break a hex - because what’s Halloween without a little light curse removal?!</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>You’ve all been waiting for it... we proudly present our second Haunted Halloween Special! Our beloved Malvina is back with an update, and one of our Sarahs is seriously thinking about hiring her very own Etsy witch to break a hex - because what’s Halloween without a little light curse removal?!</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[A Haunted Halloween Special: He's taking a ghost on dates?]]></title>
			<itunes:title><![CDATA[A Haunted Halloween Special: He's taking a ghost on dates?]]></itunes:title>
			<pubDate>Tue, 21 Oct 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:10:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68f7714e84f5a4920efb8565/media.mp3" length="103442432" type="audio/mpeg"/>
			<guid isPermaLink="false">68f7714e84f5a4920efb8565</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/a-haunted-halloween-special-hes-taking-a-ghost-on-dates</link>
			<acast:episodeId>68f7714e84f5a4920efb8565</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>a-haunted-halloween-special-hes-taking-a-ghost-on-dates</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAjaBNzNv8n33mf3l8IKl/1Vm+bQ2s7Yo7l25uAldLYzy/5D1ZRjCcMczj1gh8PAc4XfbCpnJpThtO2qcs/IPfU/rZ4EYd0wq61aFDxZ/j5J9iqg6QHL2QQ/40sAjd4CyHTCTpAXAD+qTIB0ZAxo9RK1uD6RNxAjjQmvSgZr9gQVG3Du9Zh5Fe5L1bJ0L2u64O8ik3NWGpB3ZSpA8A6J14OzrD4xWjBVY22oO86f2Xe/mEati0Yl2UViHa9c0BxfyUQ==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>322</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1761045576105-f6d213d0-f55b-4d7e-89f6-ef494f8d2e48.jpeg"/>
			<description><![CDATA[<p>Spooky season has well and truly arrived here at TGB HQ! We highly recommend you watch this week's episode if you can! Please do not be alarmed, we have not been hijacked. To celebrate the start of spooky season we have transformed into our elderly alter egos, Brian and Doris! We find out your ghosting disasters in question of the week and a Sarah from last Halloween gives us a jaw-dropping update! Oh, and there's one very ghostly dilemma we have to deal with...will we get to the bottom of it?</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Spooky season has well and truly arrived here at TGB HQ! We highly recommend you watch this week's episode if you can! Please do not be alarmed, we have not been hijacked. To celebrate the start of spooky season we have transformed into our elderly alter egos, Brian and Doris! We find out your ghosting disasters in question of the week and a Sarah from last Halloween gives us a jaw-dropping update! Oh, and there's one very ghostly dilemma we have to deal with...will we get to the bottom of it?</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>X-RATED: He gets HARD… to cartoons?</title>
			<itunes:title>X-RATED: He gets HARD… to cartoons?</itunes:title>
			<pubDate>Tue, 14 Oct 2025 23:00:00 GMT</pubDate>
			<itunes:duration>59:10</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68ee0d4358893bb6e39bfb87/media.mp3" length="86167699" type="audio/mpeg"/>
			<guid isPermaLink="false">68ee0d4358893bb6e39bfb87</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/x-ratedhe-gets-hard-to-cartoons</link>
			<acast:episodeId>68ee0d4358893bb6e39bfb87</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>x-ratedhe-gets-hard-to-cartoons</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PApSvSA1/BehkFep2vHfuEyJNPMZ7VvRp64+q8VnMetTsfSKArCzlrm0L7U54QCr8AaPEh/PsWYb6CQ/cnOhoLKpQENK58wa+zI70a9N+1KxxMpuHAOFjHtHswSrcUFOIw9oT6l8S9neStVm6qOMhFNNbPga/Q/EzsyONbPIMUX8oFjDA6+umDLchlx0mMHFddfnmM0SRNsW0LgRYzD/SZQW0d34B0k5gFSze9FzBsaqB]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>321</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1760431461434-7a73ab8c-f083-4448-8341-80234205d539.jpeg"/>
			<description><![CDATA[<p>We’re back with an X-RATED episode! What’s the most unsexy song that’s ever come on during the deed? Because honestly, we need answers from whoever said Frosty the Snowman and Cotton Eye Joe — HOW did we get here?! We’ve also got a dilemma that has us asking, “Wait… do all men do this? Plus, an update (you know we live for the updates)</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>We’re back with an X-RATED episode! What’s the most unsexy song that’s ever come on during the deed? Because honestly, we need answers from whoever said Frosty the Snowman and Cotton Eye Joe — HOW did we get here?! We’ve also got a dilemma that has us asking, “Wait… do all men do this? Plus, an update (you know we live for the updates)</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: I found a love note... it wasn't for me]]></title>
			<itunes:title><![CDATA[Boy Talk: I found a love note... it wasn't for me]]></itunes:title>
			<pubDate>Tue, 07 Oct 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:10:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68e3cc722298c9c49d259fa5/media.mp3" length="102040718" type="audio/mpeg"/>
			<guid isPermaLink="false">68e3cc722298c9c49d259fa5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-i-found-a-love-note-it-wasnt-for-me</link>
			<acast:episodeId>68e3cc722298c9c49d259fa5</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-i-found-a-love-note-it-wasnt-for-me</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAh/kIsUV6zQfdKg2C2RNY4h6yL0CoJ5Q7d2PJr7IVejXFcf8GMyQmAUJln7NbhdN3j46gQ4cvvgAAMXW0ONuQ51GwfuMxw6/k/lVvIWLqU6/Bc8Qyz+K/+V/FmJcQ/GI4TOU6LPB3HaCq3vDbCyhABC89uok2Ui7zEiDdCvhCjMHWoC6w/7bO7StjmTyLn55seZWM/UHVLj0vXveKVc7ptcRCXhcanI1KheN4uXxyhI4]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>320</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1759759461251-b5b702d0-c388-404d-8a60-1723d7ad4202.jpeg"/>
			<description><![CDATA[<p>We’re back in the TGB HQ trying&nbsp;desperately to understand a love letter and one of our Sarahs finds out her Brian has been living a double life, and yes - we hear the classic line…<em>“We were on a break!”</em>&nbsp;But don’t panic, because our faith in Brians everywhere is saved by one heroic Star of the Week!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>We’re back in the TGB HQ trying&nbsp;desperately to understand a love letter and one of our Sarahs finds out her Brian has been living a double life, and yes - we hear the classic line…<em>“We were on a break!”</em>&nbsp;But don’t panic, because our faith in Brians everywhere is saved by one heroic Star of the Week!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Brian messaged her… then told me to message you?!</title>
			<itunes:title>Girl Talk: Brian messaged her… then told me to message you?!</itunes:title>
			<pubDate>Tue, 30 Sep 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:04:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68dbabad597bc7d53f659630/media.mp3" length="94516434" type="audio/mpeg"/>
			<guid isPermaLink="false">68dbabad597bc7d53f659630</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk</link>
			<acast:episodeId>68dbabad597bc7d53f659630</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAvRQDNZ7Ts+QtVrOLDOFjbDDz3oGuk0G41mZmXnHDWLy/mZauT5zk6jk4vlMp5zZhl3h39BEBm5WTl0nI0TIp17/JcqaGmy0Hed2u+kAZwcJNqzY1IrpETieCwiiscOP9e4vq+cqzIYL57Ql8mbzh4zn5PQJZrHQQ8gkVPYqzQLRu+o+T+Y3JalAnAIYXEULhx3PyeKT0ofjGmif7L/bzmHL/TGVVktHddLWvBvOtrPS4xyTgoXH7ATU3gxCDwlXkw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>319</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1759226861922-4c71b6a0-91be-4efe-938d-d0259a43cadf.jpeg"/>
			<description><![CDATA[<p>Good Wednesday to all Sarahs, Brians, and mysterious listeners far and wide! This week we’re sniffing out the truth: what’s the weirdest smell you secretly love? Cinzia’s all about the perm-solution scent, Sophia can’t resist a whiff of petrol, and honestly, some of you admitted to even stranger smells. Meanwhile, Blueberry can't keep still, and one Sarah somehow managed to accidentally share her boyfriend… with her best friend?!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Good Wednesday to all Sarahs, Brians, and mysterious listeners far and wide! This week we’re sniffing out the truth: what’s the weirdest smell you secretly love? Cinzia’s all about the perm-solution scent, Sophia can’t resist a whiff of petrol, and honestly, some of you admitted to even stranger smells. Meanwhile, Blueberry can't keep still, and one Sarah somehow managed to accidentally share her boyfriend… with her best friend?!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Is he rinsing me for rent?</title>
			<itunes:title>Boy Talk: Is he rinsing me for rent?</itunes:title>
			<pubDate>Tue, 23 Sep 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:07:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68d29a016f2bb8719f2390ec/media.mp3" length="97629332" type="audio/mpeg"/>
			<guid isPermaLink="false">68d29a016f2bb8719f2390ec</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-is-he-rinsing-me-for-rent</link>
			<acast:episodeId>68d29a016f2bb8719f2390ec</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-is-he-rinsing-me-for-rent</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAhyR25bPTXan5RdDL8CWm7K+9Bi8MrpSGqPMmy3gBdYwDFTkclA9CBgZUBVVZV0Orh8WURwXuWkev1cqGvgk71ipCQXgbH007IMptPi/Nptqd2MKGDOdIhsCYLP4zupvY8s/g+4tDBIQ9p615s//+oTVfCCDAcm1tFqmAcBwCULhw/Te8O4LcqjZztom/rINQgG0/TWhoKm7y2yTuq1/W6pJWBg9/IOuNVGypR9Pg/E4]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>318</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1758632429971-a3f75750-4ae6-45d8-abea-4ba2ed04f263.jpeg"/>
			<description><![CDATA[<p>It’s the best day of the week — not only do you have a brand new episode to listen to, but there’s also a very important live show announcement!&nbsp;Our Sarahs are really going through it: falling in love with sneaky links, finding strippers in Brian’s phone, and dealing with slow movements in the bedroom… it’s all a bit too much! Faith is restored in Star of The Week with a gorgeous love story from a gorgeous couple!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It’s the best day of the week — not only do you have a brand new episode to listen to, but there’s also a very important live show announcement!&nbsp;Our Sarahs are really going through it: falling in love with sneaky links, finding strippers in Brian’s phone, and dealing with slow movements in the bedroom… it’s all a bit too much! Faith is restored in Star of The Week with a gorgeous love story from a gorgeous couple!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Is her DYING wish to sleep with my boyfriend?</title>
			<itunes:title>Girl Talk: Is her DYING wish to sleep with my boyfriend?</itunes:title>
			<pubDate>Tue, 16 Sep 2025 23:01:00 GMT</pubDate>
			<itunes:duration>1:10:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68c9685f99bc5676a8c3861c/media.mp3" length="101910109" type="audio/mpeg"/>
			<guid isPermaLink="false">68c9685f99bc5676a8c3861c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talkis-her-dying-wish-to-sleep-with-my-boyfriend</link>
			<acast:episodeId>68c9685f99bc5676a8c3861c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talkis-her-dying-wish-to-sleep-with-my-boyfriend</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAo+nudNiOgXFt7upKKG5q29OqMOkpOeLsaxb3MBzV8XYxUmvw9mYrz5M1OGV688eYtV1ntULVPbNPx3UQmr+K8wgTG/X6wWv4SPze6A2ex+JpHiTKjV538VbstLzDjeMs+EBPBVy6oIcgHX+uVnhABW2nWVkuZ20mBF7FNsMR+nvUBfaGyX3vNgtiEwYI9HCaaysCD7cJAsoB0SCUYZkJbJuWC6ZyrOUKKrqQBIxoKDSaqcGspbB+twinlN7cuKsyw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>317</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1758034229825-dc6fa668-4076-4112-aa77-4e4778abd98a.jpeg"/>
			<description><![CDATA[<p>Alrighty roooo, we’re back in The Girls Bathroom, asking you what nicknames you’ve given your boss! What would you do if Sarah’s dying wish was to sleep with your Brian… YOLO or not so YOLO?! And finally, we’ve got a&nbsp;<em>Star of the Week</em>&nbsp;who actually listened to some top-notch advice from Sophia’s Brian’s tips!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Alrighty roooo, we’re back in The Girls Bathroom, asking you what nicknames you’ve given your boss! What would you do if Sarah’s dying wish was to sleep with your Brian… YOLO or not so YOLO?! And finally, we’ve got a&nbsp;<em>Star of the Week</em>&nbsp;who actually listened to some top-notch advice from Sophia’s Brian’s tips!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>X-RATED: Keep it a fantasy... or make it happen?</title>
			<itunes:title>X-RATED: Keep it a fantasy... or make it happen?</itunes:title>
			<pubDate>Tue, 09 Sep 2025 23:01:00 GMT</pubDate>
			<itunes:duration>1:06:18</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68c04f1cf5c5afe5c2731c92/media.mp3" length="95485049" type="audio/mpeg"/>
			<guid isPermaLink="false">68c04f1cf5c5afe5c2731c92</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/x-rated-keep-it-a-fantasy-or-make-it-happen</link>
			<acast:episodeId>68c04f1cf5c5afe5c2731c92</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>x-rated-keep-it-a-fantasy-or-make-it-happen</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAr+VSXgdo1r/2gMFwgnpB/JdtYuZCRq6iH1/PoP0lb1x6iIizbIZj/MiuAFE4KgB4nvEa+AS0arae/xnpFjrB6EFm0X42IE14qWIFydj0viNudDYqBXlczwVuJlb0cFy6eC7NRYdnicgS+MwbsSJ2i+o4RHpIULog+BJma+bf8xn94eqk7qlkIiU30s8CzyL1+x4rDiTXtOVvcsr/1v6DXpUndjwfS+4lKuJS598mn7z]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>316</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1757433691482-31ca76be-2d03-4326-90c9-c9e4ccd2348b.jpeg"/>
			<description><![CDATA[<p>It’s that time again—when we tackle your spiciest X-RATED dilemmas. Padmé, Shrek, Conrad and Belly, even a squirrel…who would&nbsp;<em>you</em>&nbsp;dress up as for a little role-play with your other half? One of our Sarahs finds herself in an extremely shitty situation, while another just wants things to last a little longer!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It’s that time again—when we tackle your spiciest X-RATED dilemmas. Padmé, Shrek, Conrad and Belly, even a squirrel…who would&nbsp;<em>you</em>&nbsp;dress up as for a little role-play with your other half? One of our Sarahs finds herself in an extremely shitty situation, while another just wants things to last a little longer!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My HUSBAND... or a CATFISH!?!</title>
			<itunes:title>Boy Talk: My HUSBAND... or a CATFISH!?!</itunes:title>
			<pubDate>Tue, 02 Sep 2025 23:01:00 GMT</pubDate>
			<itunes:duration>1:01:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68b6c82dd6e2cdaa26f20833/media.mp3" length="88394989" type="audio/mpeg"/>
			<guid isPermaLink="false">68b6c82dd6e2cdaa26f20833</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/my-husband-or-a-catfish</link>
			<acast:episodeId>68b6c82dd6e2cdaa26f20833</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>my-husband-or-a-catfish</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf22SLpOMH1GuqV8w117cnLtI8FtHjeV2VwtOUWQKLVpn/DyJ0ArVt+2HabrJGgh9dQGh/SvV2RLC5ZawIvxB39yMp7AHeHWMVi9dd60tHudLB4ESfSkx9NI77oFa705pDfHL4Cpf5EFYAjuJiwla2t+YGXYGGUwj817BC3VTXlW2FGig2KYbtC349iuQr1LLKmu+Oki3X2enMk/zBFjMw6GyQyIJq1818ZnsUTbgz2gaD/6jXevDY+6cJ29eVjLJ4lFtYqrbi0iekh6LVSG9wdNJ643DkDp09afitlvN/v4w==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>315</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1756809229973-1ad7bb41-3bcf-4927-a058-842a0c6f7659.jpeg"/>
			<description><![CDATA[<p>Happiest of Wednesdays girlies! This week’s&nbsp;<em>question of the week</em>&nbsp;is:&nbsp;<em>What’s the worst thing you’ve borrowed without someone knowing?</em>&nbsp;A shocking number of you need to replace your razors and toothbrushes immediately. We’ve got one Sarah who’s fallen in love with Steve the fire-breather, and a real-life HR Sarah giving us all the tea on how to file an official grievance.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Happiest of Wednesdays girlies! This week’s&nbsp;<em>question of the week</em>&nbsp;is:&nbsp;<em>What’s the worst thing you’ve borrowed without someone knowing?</em>&nbsp;A shocking number of you need to replace your razors and toothbrushes immediately. We’ve got one Sarah who’s fallen in love with Steve the fire-breather, and a real-life HR Sarah giving us all the tea on how to file an official grievance.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><br><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: She stole my vibrator?!</title>
			<itunes:title>Girl Talk: She stole my vibrator?!</itunes:title>
			<pubDate>Tue, 26 Aug 2025 23:01:00 GMT</pubDate>
			<itunes:duration>51:45</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68a74b9ee2f63983a7375b0c/media.mp3" length="74552455" type="audio/mpeg"/>
			<guid isPermaLink="false">68a74b9ee2f63983a7375b0c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-she-stole-my-vibrator</link>
			<acast:episodeId>68a74b9ee2f63983a7375b0c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-she-stole-my-vibrator</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAoJEh3Elwl9c34PDgp1zztJ4vDBsH4K4oRm1tCTrq56621ff96Feto21JsLBu6lpkPdT18pEy2KgKDOzp4JcK6UPLp5/YwmnmE8wR2TPr4gXvg1nD29ZvGlvDXtWT7h8XS+b0W3eaeeheu+A0H7jE2FIcBv2x3WUyzTKxHWhjPMy0f+thyGnQuUthiD7Q27wLsDuv06lMmCbgR5TKRyBFU6HG+6WJyaD/xhSnMck9Cukaiyvr75B/53ZZ9hSXsX83Q==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>314</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1756300093398-c9dc4343-c1bc-4c70-83e6-3b3ab43eabca.jpeg"/>
			<description><![CDATA[<p>Happy Wednesday our dearest listeners!!!! Autumn is fast approaching and we need Halloween ideas for little miss Blueberry. This week we asked you what's the most chaotic drunk text you've ever received... safe to say some of them were incredibly chaotic. One of our Sarah's fears she may be morphing into her Brian's ex...and another Sarah investigates the mystery of her missing vibrator!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Happy Wednesday our dearest listeners!!!! Autumn is fast approaching and we need Halloween ideas for little miss Blueberry. This week we asked you what's the most chaotic drunk text you've ever received... safe to say some of them were incredibly chaotic. One of our Sarah's fears she may be morphing into her Brian's ex...and another Sarah investigates the mystery of her missing vibrator!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: He's in JAIL… now I'm a lesbian?!]]></title>
			<itunes:title><![CDATA[Boy Talk: He's in JAIL… now I'm a lesbian?!]]></itunes:title>
			<pubDate>Tue, 19 Aug 2025 23:01:00 GMT</pubDate>
			<itunes:duration>56:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68a48d5673bf5b62988a51f1/media.mp3" length="81950968" type="audio/mpeg"/>
			<guid isPermaLink="false">68a48d5673bf5b62988a51f1</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-hes-in-jail-now-im-a-lesbian</link>
			<acast:episodeId>68a48d5673bf5b62988a51f1</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-hes-in-jail-now-im-a-lesbian</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCefcIkHNxu/UJOelU3VIHsJC06YYrrS29i3z0QbQwp34yd7eVDzyJmoZHdLEGH/mgPuMJSznMbipiLwM5iyMuZK6Cn32Z5EGOD8AtK/+DUGUsAaWgMfc3HJiGvl9uW+3VLeTuWsz00I/EcWmLxlzO3cfhWZRAjGtNhXR00rJFqv4nLBXvlFzuVn+hP01oz2Eum+sEpkXXIOQ7gNsvM2LSvdQokMmtsQpIUIVqge+olwG3s7Wxbl4PaNkDvgEByvr2cMSKPmgRdt5AuNRMfYkdLjs9r9ucE1H2HrTcoNHKStGA==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>313</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1756300147756-6ad4bdd3-450b-4fb4-aff4-05d2791c181f.jpeg"/>
			<description><![CDATA[<p>It’s Wednesdayyy, and Cinzia is celebrating the arrival of her first child, Blueberry Baylis! This week’s question reveals your unexpected childhood crush… and honestly, Tigger is kind of a zaddy, and we are&nbsp;so here for it. One of our Sarahs writes in as she experiences her lesbian awakening, while another admits she’s experiencing&nbsp;<em>zero</em>&nbsp;fanny flutters. And of course, we can’t forget our Star of the Week, another Brian has officially earned his place in the Hall of Fame!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It’s Wednesdayyy, and Cinzia is celebrating the arrival of her first child, Blueberry Baylis! This week’s question reveals your unexpected childhood crush… and honestly, Tigger is kind of a zaddy, and we are&nbsp;so here for it. One of our Sarahs writes in as she experiences her lesbian awakening, while another admits she’s experiencing&nbsp;<em>zero</em>&nbsp;fanny flutters. And of course, we can’t forget our Star of the Week, another Brian has officially earned his place in the Hall of Fame!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Am I crazy for telling my bff she’s about to get engaged?</title>
			<itunes:title>Girl Talk: Am I crazy for telling my bff she’s about to get engaged?</itunes:title>
			<pubDate>Tue, 12 Aug 2025 23:01:00 GMT</pubDate>
			<itunes:duration>59:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/689bae0f290bdec8f97a679c/media.mp3" length="86002779" type="audio/mpeg"/>
			<guid isPermaLink="false">689bae0f290bdec8f97a679c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-am-i-crazy-for-telling-my-bff-shes-about-to-get-en</link>
			<acast:episodeId>689bae0f290bdec8f97a679c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-am-i-crazy-for-telling-my-bff-shes-about-to-get-en</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeNqiRD8nzpgyQyMC/KNXqkAgphXSDncEKd+ktvN+sdUATdN6eeG3PleYe8OWuv2dVB08NJux1vr+ehgyW/PYhAtoMm04wysoqLstqji+GrPSi/gH0QEzVgh6FesYilPJEyO54bDjpuaGnXW958YtPLR2wA5iyQRtfmqXxka6bP0cqvyWr/Fb29aISAryHgQEOyzHeWn2CBNXJQy2SpdCEw1Sp9DR3lC81A6bH4S0hf00uetN0+spTRYB2tzKi3oNRto8oBelIo7mbzBs6UyYT9hTJ5vMXVVfz73wI0mLzl2g==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>312</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1755032489209-39c8adef-c470-475a-a0a3-00ae62651627.jpeg"/>
			<description><![CDATA[<p>Happy Wednesday everyone!!! We're asking about your holiday disaster stories in today's Question of the Week. Sticking on the holiday theme, there's one Sarah who's been shocked when an invite for a girls trip didn't come her way, another who doesn't know whether or not to tell her friend she's about to be engaged and a bridesmaid who's already pushed the bride too far only a week after being asked.</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Happy Wednesday everyone!!! We're asking about your holiday disaster stories in today's Question of the Week. Sticking on the holiday theme, there's one Sarah who's been shocked when an invite for a girls trip didn't come her way, another who doesn't know whether or not to tell her friend she's about to be engaged and a bridesmaid who's already pushed the bride too far only a week after being asked.</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>X-RATED: She CAN’T STOP banging the drum!!!</title>
			<itunes:title>X-RATED: She CAN’T STOP banging the drum!!!</itunes:title>
			<pubDate>Tue, 05 Aug 2025 23:01:00 GMT</pubDate>
			<itunes:duration>1:19:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/689230d13a582a36b3beaa65/media.mp3" length="115472230" type="audio/mpeg"/>
			<guid isPermaLink="false">689230d13a582a36b3beaa65</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/x-rated-she-cant-stop-banging-the-drum</link>
			<acast:episodeId>689230d13a582a36b3beaa65</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>x-rated-she-cant-stop-banging-the-drum</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfcxvcUF5r22Mwvg6enw/BrI/3fm3hQJtRGdscxoZ0h0U2ajiJQCURiPQpJ2Z2Qi0ZlaRgNyzQ3ceY1ks8tL9zbr8eiEXHJu0uP2PkGo0S4XLr74NabsJhlI6ZXwdG1JMnGmGdHZqHHje1u9bED+5vdmsJHpikx+7BMzUPqPma5SHD1f9LNzOokmBKMzEISnbkBQWMwbLzPT7Gmb3L/2rFygCD71Jx2DPyc734bwcRYYVtfiBSbpOITDugUcePX0KVSVuHceg2T5haPadbOB9sNEBPnVvxVv++eNe2j/xZDnw==]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>311</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1754411049697-b10ac8cd-71ed-473a-9831-cf0587f0d821.jpeg"/>
			<description><![CDATA[<p>Does it get much more x-rated than us asking you for the weirdest place you've had sex? Well we're also finding out whether one Brian's fetish has gone too far, another with a sensitive penis and there's a runner who gets far too hot and bothered in the bedroom.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Does it get much more x-rated than us asking you for the weirdest place you've had sex? Well we're also finding out whether one Brian's fetish has gone too far, another with a sensitive penis and there's a runner who gets far too hot and bothered in the bedroom.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>SOPHIA’S ENGAGED!!!</title>
			<itunes:title>SOPHIA’S ENGAGED!!!</itunes:title>
			<pubDate>Tue, 29 Jul 2025 23:00:00 GMT</pubDate>
			<itunes:duration>54:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68894952e0a86cc3ab5a3d50/media.mp3" length="107319661" type="audio/mpeg"/>
			<guid isPermaLink="false">68894952e0a86cc3ab5a3d50</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/sophias-engaged</link>
			<acast:episodeId>68894952e0a86cc3ab5a3d50</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>sophias-engaged</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcmatzHGYQph2mUVRtkBxBu//KPv66BwZO4833G95xjBcYE+6syCJCqaQNRoFM7/RHKcuCu8RrPqZMxOegrk5qJDhYnub0Q9aWFdmB3UhyD9u5JeboH3wgoFFH16Ivc7LMEy6b4etHXF5ScRS6GpCpcM3jk3OHuwy1BO2vFoXhlosKgcAGYQTa//QjdRkiPeF1M0h3tKqKxIW70s4kCP4IvLidjsbzcC5o914GHmrnw/z2C9S1hwR2um4eOYcGiOXQZhUrx45a78+NTMnDOfVyY]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>310</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1753820929692-0c94f7b2-e4c4-4919-a9ca-4625a6ecf364.jpeg"/>
			<description><![CDATA[<p>A VERY special episode this week as Sophia shares her engagement story!!! We're celebrating in textbook Girls Bathroom style, exchanging gifts and sharing Brian's Top Tips for a flawless engagement!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>A VERY special episode this week as Sophia shares her engagement story!!! We're celebrating in textbook Girls Bathroom style, exchanging gifts and sharing Brian's Top Tips for a flawless engagement!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He WATCHED her get l*cked out!!!!</title>
			<itunes:title>Boy Talk: He WATCHED her get l*cked out!!!!</itunes:title>
			<pubDate>Tue, 22 Jul 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:18:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/687ffe0cfd9acfeba49ec905/media.mp3" length="154035978" type="audio/mpeg"/>
			<guid isPermaLink="false">687ffe0cfd9acfeba49ec905</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-watched-her-get-licked-out</link>
			<acast:episodeId>687ffe0cfd9acfeba49ec905</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-watched-her-get-licked-out</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdxbdWw1jc7Ps+agDaPlmzQD6YdK8Ul7Jo6Kh4JB7HZuJq9em7+Bhp5qllGxM0Drniq6vZsUrlf1hF0VKUZOc1S410r3wB3RH6jAXAph6To0o3y5vAwbWznqudogmivdcgHE9+jCUwRP3VWP8yKFPSzmfMxW7S48zk+AKP5rLZmHDIP5upsne9Ux0qiILqFuAxYZZHKEhCwLjYmO8FuLi09lZK+8RyQYiI1TDv/ABezZf387ChtJSyqxmmr2X4P1vCBFmGnu0Wv92+i/L8228AG]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>309</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1753218653121-11e8d89b-d490-490e-a38b-f3910188c173.jpeg"/>
			<description><![CDATA[<p>Dearest gentle reader, practice your best Voldemort impression and ask 'Can THE Doctor see me now?' We're exploring icky hobbies and have one final update from an indecisive Sarah. A Brian enters the bathroom for advice and another is threatened by his partner's social life. We're also saying 'Hallo!' and 'Wie geht's?' to a deutsche Brian while another is ignoring every boundary in the book! Finally, we're asking if someone is to be trusted without a label and OF COURSE naming another angelic Brian our Star of the Week. </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Dearest gentle reader, practice your best Voldemort impression and ask 'Can THE Doctor see me now?' We're exploring icky hobbies and have one final update from an indecisive Sarah. A Brian enters the bathroom for advice and another is threatened by his partner's social life. We're also saying 'Hallo!' and 'Wie geht's?' to a deutsche Brian while another is ignoring every boundary in the book! Finally, we're asking if someone is to be trusted without a label and OF COURSE naming another angelic Brian our Star of the Week. </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: My man thinks my bff's IN LOVE with me]]></title>
			<itunes:title><![CDATA[Girl Talk: My man thinks my bff's IN LOVE with me]]></itunes:title>
			<pubDate>Tue, 15 Jul 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:06:54</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/687683ab01becb6b31a26775/media.mp3" length="131045968" type="audio/mpeg"/>
			<guid isPermaLink="false">687683ab01becb6b31a26775</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-man-thinks-my-bffs-in-love-with-me</link>
			<acast:episodeId>687683ab01becb6b31a26775</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-man-thinks-my-bffs-in-love-with-me</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe4RqqLvYhcvBurjBQ1uj56C8j4VPQHEoGquAz12cY4aoFaggj8FVEPi22ESMrsppdPnQK5d4dzlCodkGaKYz1pGrsHBdv+AJB03P7o9Bw1C+B6DHEJyxeedZdGw5DWxnd9N+sh0M5a5KYBaw/sMTtoNuZQZKGeNPT76Om+GpLbeo9BcS9TgtjOzzUTgF9tKW0jrd1fz/I6QWBJmdwn2Hhqt19OBVtF4eCY9pwvmP/w45WvIEROFLgcXDu4kO7O9/Gd6/ZhqCKYMFdEkb9Rg3UN]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>308</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1752597240715-efbdb715-d474-498c-8407-a8d042183bd1.jpeg"/>
			<description><![CDATA[<p>The word of the week is 'freakazoid' and we're asking you to share your most iconic girl code moments. We're revisiting 'question of the week' from episodes gone by and finding out what happens when you're on the receiving end of a warning message. We've got besties sharing a therapist, a new friend who's feeling under appreciated (or maybe she wants more?) and a Samantha who has overstepped big time! </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>The word of the week is 'freakazoid' and we're asking you to share your most iconic girl code moments. We're revisiting 'question of the week' from episodes gone by and finding out what happens when you're on the receiving end of a warning message. We've got besties sharing a therapist, a new friend who's feeling under appreciated (or maybe she wants more?) and a Samantha who has overstepped big time! </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: I FOUND him on 'Are we dating the same guy?']]></title>
			<itunes:title><![CDATA[Boy Talk: I FOUND him on 'Are we dating the same guy?']]></itunes:title>
			<pubDate>Tue, 08 Jul 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:16:46</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/686d731dfe0897380ecd12f3/media.mp3" length="150226450" type="audio/mpeg"/>
			<guid isPermaLink="false">686d731dfe0897380ecd12f3</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-i-found-him-on-are-we-dating-the-same-guy</link>
			<acast:episodeId>686d731dfe0897380ecd12f3</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-i-found-him-on-are-we-dating-the-same-guy</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcYcQDJNkjKBOk7tpdw0bgRLyXg/FMIV9vGKdovDWdXZxMGT2YrYX9TvTw2T8lzoLZXubZVucKe/iCiyZII5gnpUs7ATTR1qp7yP8Tn8DGzvxnBa4dhBElWnGJnxAF0TfyLGgqe+UIk7WJ0UHIUsduBPkGLQxaUCarPUhzm7jjIyESMov8DKUnVrhTuenw6wLBdRUAJ9/qoP3GHMhMCWqOZB9naTv5/jwTPB747S2hBSnk85SJy1dRHdkm6SGBxQT8fLwTxxvke7CmtfFEpl5v4]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>307</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1752001321312-20a4eb46-8cb0-46d7-b904-899db26a8a5e.jpeg"/>
			<description><![CDATA[<p>Helloooo Wednesday and hello Zac Efron specifically. We're sharing icky fashion mistakes, asking why men love to show the world their boxers, and informing you all of the Facebook phenomenon 'Are we dating the same guy?' We have a Brian who's more than camera shy and a Sarah who's tired of giving ultimatums...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Helloooo Wednesday and hello Zac Efron specifically. We're sharing icky fashion mistakes, asking why men love to show the world their boxers, and informing you all of the Facebook phenomenon 'Are we dating the same guy?' We have a Brian who's more than camera shy and a Sarah who's tired of giving ultimatums...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: IS HE SLEEPING WITH SPANISH MEN??</title>
			<itunes:title>Girl Talk: IS HE SLEEPING WITH SPANISH MEN??</itunes:title>
			<pubDate>Tue, 01 Jul 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:17:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/686465257aba8e54f8a61365/media.mp3" length="150733469" type="audio/mpeg"/>
			<guid isPermaLink="false">686465257aba8e54f8a61365</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-is-he-sleeping-with-spanish-men</link>
			<acast:episodeId>686465257aba8e54f8a61365</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-is-he-sleeping-with-spanish-men</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdOmFN0G2zXpmuo93TGmJ++KtZYRUGqm5Xb84Bs4TRVtGHUHppU8PI/gKgs4RL3jAO5LiT74FjDQ14YvXHXO0fthLJ9/O/EIMvCQkDrY7rX91GFpab13dgT2d324myRduTmeYQ4qFgY8emN5Kxgg+k3Cy8DkWLn2tQgo26Pvkfh3L1mtw2D2AN8NUsqoWooAvu7ArbA27wKh8ToZsdpDrtNfnpGflA3EhKUjlcE1/Ed2c51ux6mjKfp2qGkPluUnpTq7xEqgwcsStjyNGu3Flh1]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>306</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1751402259258-6d2aa5be-61f1-4edd-9f18-29f58334efc9.jpeg"/>
			<description><![CDATA[<p>The sun's (kinda) still out so we're serving exposed foot and asking when you decided to cut ties with a friend. Cinzia's discovered a blast from the past and we've got a twin who's claiming to have broken every code in the book. Single Sarah is feeling abandoned, while Brian is seeking Spanish Brians. Finally, we're thinking up baby names, delivering another Star of the Week and declaring this the summer of love!!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>The sun's (kinda) still out so we're serving exposed foot and asking when you decided to cut ties with a friend. Cinzia's discovered a blast from the past and we've got a twin who's claiming to have broken every code in the book. Single Sarah is feeling abandoned, while Brian is seeking Spanish Brians. Finally, we're thinking up baby names, delivering another Star of the Week and declaring this the summer of love!!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I’m cheating with my gay bffs!!!</title>
			<itunes:title>Boy Talk: I’m cheating with my gay bffs!!!</itunes:title>
			<pubDate>Tue, 24 Jun 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:10:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/685a89a573e8be408f2ac246/media.mp3" length="137672767" type="audio/mpeg"/>
			<guid isPermaLink="false">685a89a573e8be408f2ac246</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-im-cheating-with-my-gay-bffs</link>
			<acast:episodeId>685a89a573e8be408f2ac246</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-im-cheating-with-my-gay-bffs</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfDpcVhgQ52PVGdZTlcZvAHk7L3ZZs+Q+VFfKFo/UBBew7RCesZrfdr1a6fVR0sVMdGqlbIneZW0rTeu16q7BoKd2D3Tn5nS38mx8btqAIIv3kmGxJroz8CCsy/W6ZLHH5wB+7VvNVKQS5sBvXopM1EUjL3d7UB68UhCRXS8F8FFWGTdh2QUYWZ3wnlb2kb4OQlPocL0dausHXj+cSkem8p0BYM9IrYLyFNHhAHftKPHQcJkD1/A4BBrg8aGtih159peM15uJ7YcaV9Qp4oDZBH]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>305</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1750764424774-f8bff0b8-fab5-497c-898b-f08e7e8aa2eb.jpeg"/>
			<description><![CDATA[<p>It's Wednesday so that means it's time to slide in to a FitFlop and think about your GSCE maths homework. We're sharing not so humblebrags and an unfaithful Sarah has quite the story to share! We have a mum who's delivering unwanted information about her daughter's beau, and a Susan who agrees she isn't to be trusted...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It's Wednesday so that means it's time to slide in to a FitFlop and think about your GSCE maths homework. We're sharing not so humblebrags and an unfaithful Sarah has quite the story to share! We have a mum who's delivering unwanted information about her daughter's beau, and a Susan who agrees she isn't to be trusted...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: She's keeping me under SURVEILLANCE]]></title>
			<itunes:title><![CDATA[Girl Talk: She's keeping me under SURVEILLANCE]]></itunes:title>
			<pubDate>Tue, 17 Jun 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:24:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6851d97ecf39b4f29aa9761d/media.mp3" length="165122673" type="audio/mpeg"/>
			<guid isPermaLink="false">6851d97ecf39b4f29aa9761d</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-shes-keeping-me-under-surveillance</link>
			<acast:episodeId>6851d97ecf39b4f29aa9761d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-shes-keeping-me-under-surveillance</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeu72gzP4NWwpXf+lTi2ZXlQhuKr/aWgWxSaM2bl7udAgIWrh/4z6QoFCvWzFXTrkUXaJvu19MTKGbrw48obxof47ZH/LyPlJuOeiALdg6n+6jwcxpz948K3pM75zLnuEJ4M9afXei16zjinKBwoVayKrD947WLcEe+9dZzFNeWpAiQSKh47ahj/Q/TXWAitFmqNuitzyzCVN9CajFMHtVbE6YaWejtwAas85rEhk60mP0TEvronfGbiSiGrRP6TjuA7Qzuw95Fu7IDDvd1LY6s]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>304</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1750184611049-ea33bcb2-943e-4be4-9d59-4553ecaa82dc.jpeg"/>
			<description><![CDATA[<p>It's Wednesdaaaay!! We're travelling down memory lane to find inspiration for this week's Question of the Week and asking 'Why don't I have a pink sparkly Lamborghini?' Elsewhere we have a Sarah who's living under surveillance, a Brian who doesn't know his Helens from his Hannahs (or does he?) and a mum and dad who want to make their connection the real deal...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It's Wednesdaaaay!! We're travelling down memory lane to find inspiration for this week's Question of the Week and asking 'Why don't I have a pink sparkly Lamborghini?' Elsewhere we have a Sarah who's living under surveillance, a Brian who doesn't know his Helens from his Hannahs (or does he?) and a mum and dad who want to make their connection the real deal...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>X-RATED: He tickles my vagina??!</title>
			<itunes:title>X-RATED: He tickles my vagina??!</itunes:title>
			<pubDate>Tue, 10 Jun 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:07:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68487c8f680b3bd504807ece/media.mp3" length="132451922" type="audio/mpeg"/>
			<guid isPermaLink="false">68487c8f680b3bd504807ece</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/x-rated-he-tickles-my-vagina</link>
			<acast:episodeId>68487c8f680b3bd504807ece</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>x-rated-he-tickles-my-vagina</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdTUyNm+uEaoC8ZEkfdcFqeQZ74bMiCO1U0QwE20zlkmXloGEqoFksOf+ROl8bromFnezlHQd9uVVbyx6FwSfQRRDPcdvJikJpN/nF4PZKkGSCh8CsdKp9wvASBJGvJVEBZfNTg2iyI6bAZ3PS0SaTROqsC2vOOshBIYpj+7aUf94KYqaxY/zAuQKWhLgna0uw0nfqCRnWa9njTKT1ardU1e1UggJRJ4vLNjwbx1y7FqBsm0l8LVCvaVDZpOQb6Nj0J0JebD7fEumFa8MB2YUvy]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>303</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1749591106686-4d15d95f-9cad-42ae-bc70-e909390cc032.jpeg"/>
			<description><![CDATA[<p>We're back back back again with another X-RATED episode!!! We're finding out the not so constructive criticism you've had bestowed upon you and discovering how a baby and a dog have made their way into one listener's bedroom. We've got a boyfriend who's a little tentative around his partner's privates and a Brian who's hygiene is leaving a mark. Elsewhere Sarah is struggling with a very, ahem, generous appendage and we're asking Brian for a little less vanilla and a LOT more ACOTAR...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>We're back back back again with another X-RATED episode!!! We're finding out the not so constructive criticism you've had bestowed upon you and discovering how a baby and a dog have made their way into one listener's bedroom. We've got a boyfriend who's a little tentative around his partner's privates and a Brian who's hygiene is leaving a mark. Elsewhere Sarah is struggling with a very, ahem, generous appendage and we're asking Brian for a little less vanilla and a LOT more ACOTAR...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: We had one WILD date...then he WIFED someone else!!!</title>
			<itunes:title>Boy Talk: We had one WILD date...then he WIFED someone else!!!</itunes:title>
			<pubDate>Tue, 03 Jun 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:07:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/683f7738a113cf02fa59080e/media.mp3" length="131746409" type="audio/mpeg"/>
			<guid isPermaLink="false">683f7738a113cf02fa59080e</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-we-had-one-wild-datethen-he-wifed-someone-else</link>
			<acast:episodeId>683f7738a113cf02fa59080e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-we-had-one-wild-datethen-he-wifed-someone-else</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdeLxE4CQCrpJtJZ3sTETl1QWj/c3MoaGvYZtGbLVCV3s6uJIKcw8Nn3aGluXuWf85Jj/fnnSeCbzw92TJ+olnMAI5T3sHXKFDbtxLOVM7s6vO9FE//dzCZi8+0CkgWpX+QUphWywp2P7H0XzYV1lvuBBLJKFXnRfYSII9pC9iQYg7Fzm3yOrv4/HgNPqTC4R1Q1ap8BTw2lrJAKMlhoMj1J5HzEH+Yl0grHGdsL54Z9RsVmLQUYXqHN/8vWdMFLzwrlDSa3WifReRYSrJJs7Eh]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>302</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1748966466151-cd0bfc2d-e047-4d4f-a415-97179ce1c06f.jpeg"/>
			<description><![CDATA[<p>Merry Wednesday to all!! Cinzia has quite the story about her time in the salon, and we're taking 'babes' mainstream. We're saying 'Bon chance!' to their new partners and are SHOCKED at Brian's quick turnaround from first date to wifed up. We're asking if we should move cities for our boyfriend's ex and wondering why everything goes south after a couple of Aperols...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Merry Wednesday to all!! Cinzia has quite the story about her time in the salon, and we're taking 'babes' mainstream. We're saying 'Bon chance!' to their new partners and are SHOCKED at Brian's quick turnaround from first date to wifed up. We're asking if we should move cities for our boyfriend's ex and wondering why everything goes south after a couple of Aperols...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Eat, Pray, Love</title>
			<itunes:title>Girl Talk: Eat, Pray, Love</itunes:title>
			<pubDate>Tue, 27 May 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:27:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6835fccb2780b226c750d12d/media.mp3" length="171328448" type="audio/mpeg"/>
			<guid isPermaLink="false">6835fccb2780b226c750d12d</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-eat-pray-love</link>
			<acast:episodeId>6835fccb2780b226c750d12d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-eat-pray-love</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf/N2/KzRkDX/+yf00h1qjZ+qUP1319mzcSdLPYPMoPSZ9/7OMXeUaAqTCl5R+0LG+L+AikZP9QKylGbz7CieLV7rfize/GEQU6Al1uMjHj26JWaH+dwIRD8bHqamC0RPhzB3uo/kQ7UsSvU/kTTDUEWRVSp/Hlza8WliyUZFBJPYXZQ1U94J1WVkQfj9ihfM6x+O/u4A4/QXs7D3M5ziwfjzdPnLr11A2hk5i+CSE8Q6XE2okBYCMlKenC30hsKCdKV7IuwH99ebkvC0tJ34ON]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>301</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1748368104281-6c3aeaa1-a0a5-4ef2-a77f-89669246c3cf.jpeg"/>
			<description><![CDATA[<p>Happy Wednesday!!! We're reminiscing about iconic British TV, wondering if we should establish a staff uniform and asking if you've ever been caught stalking someone's socials? We've got a Sarah who feels like she's being watched and a sister who can't stop competing. We're also party planning for some Canadian hens in London and creating a holiday itinerary for a solo Susan. </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Happy Wednesday!!! We're reminiscing about iconic British TV, wondering if we should establish a staff uniform and asking if you've ever been caught stalking someone's socials? We've got a Sarah who feels like she's being watched and a sister who can't stop competing. We're also party planning for some Canadian hens in London and creating a holiday itinerary for a solo Susan. </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>OUR 300TH EPISODE!!!</title>
			<itunes:title>OUR 300TH EPISODE!!!</itunes:title>
			<pubDate>Tue, 20 May 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:25:51</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/682d0723249999325df0f335/media.mp3" length="167773718" type="audio/mpeg"/>
			<guid isPermaLink="false">682d0723249999325df0f335</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/our-300th-episode</link>
			<acast:episodeId>682d0723249999325df0f335</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>our-300th-episode</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdjPRW+giDIkrHyuTkiHQzGo4UdyXs/8mVqAP8GANiGp4wxedtwsRgB7/nGYvmdYLWu1pzi2J0PCh+6atfzLb/zoV3O2982QwR+8w4pOdWPhShZHEfpFSeLc/cE4R0kT2yNIlBSZCSyilAg+5PHTzFL6TdvOox4Q+EJUc5rfg0+lipu5d8LWGATX2JyWeVDh+bemGlokHhMjjKRUYA8UWkuOQo4F/NmuAdMfJ3SZ+ZYhj6VhlZf+sF/zJBIHbWTcY8SDKqMGFdz0m4Kz8/9brp1]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>300</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1747780839715-65088a36-c12f-43d7-90b6-3c921171496f.jpeg"/>
			<description><![CDATA[<p>Woohooo! It's the big three-zero-zero, and we've got the balloons to prove it!! We're investigating the content of your partner's notes app, submitting our premier league predictions and getting an all important update from our utterly remorseful Susan. We have a Sarah who doesn't know what to do about her boyfriend's boyfriend, and we're all hoping we can take this BIG secret to the grave...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Woohooo! It's the big three-zero-zero, and we've got the balloons to prove it!! We're investigating the content of your partner's notes app, submitting our premier league predictions and getting an all important update from our utterly remorseful Susan. We have a Sarah who doesn't know what to do about her boyfriend's boyfriend, and we're all hoping we can take this BIG secret to the grave...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>It’s the X-RATED EPISODE</title>
			<itunes:title>It’s the X-RATED EPISODE</itunes:title>
			<pubDate>Tue, 13 May 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:10:45</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/68236cc014bdee6141754592/media.mp3" length="138429675" type="audio/mpeg"/>
			<guid isPermaLink="false">68236cc014bdee6141754592</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/its-the-x-rated-episode</link>
			<acast:episodeId>68236cc014bdee6141754592</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>its-the-x-rated-episode</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeg9X3UkDwSQ2iggQNm36DvlQLsPyCSRWXPuuPyok4kx+N5p6RTOHuuMxF4Z7wjNZsegrr/Va2C1XQ9M7SbDPrY01nKJ8+/1W/NfB8W9AgiEHQ1nDCDA52LN/DzXLiS185w6PMWwLXQX9mcG19q4aezkA+9fadwEshEgbW1839Eck/weRzFFFdHE5L++WNbfDXAV64PySQgPse4lORzb7uZrxo8Ihlb/fFYdZBKEhsojFNXSbv13kQT2jBCHH0CjAnYHaCahxO1IW4T9lqIaXp6]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>299</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1747148154101-c9b89b37-162c-4492-98e3-498d78071a4d.jpeg"/>
			<description><![CDATA[<p>Welcome to a very special X-rated Girls Bathroom podcast episode!! We've asked you to send in some of your steamiest dilemmas, and boy have you delivered! We're discovering what unusual items have made their way into the bedroom and what advice Zac Efron may or may not have bestowed upon us. We have a Sarah asking if she should share her new found dominatrix adventures with her friends, a Susan who keeps encountering flaccid and afraid appendages and a Brian who might be asking a bit too much of his partner...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to a very special X-rated Girls Bathroom podcast episode!! We've asked you to send in some of your steamiest dilemmas, and boy have you delivered! We're discovering what unusual items have made their way into the bedroom and what advice Zac Efron may or may not have bestowed upon us. We have a Sarah asking if she should share her new found dominatrix adventures with her friends, a Susan who keeps encountering flaccid and afraid appendages and a Brian who might be asking a bit too much of his partner...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Is it me…am I the drama?!</title>
			<itunes:title>Girl Talk: Is it me…am I the drama?!</itunes:title>
			<pubDate>Tue, 06 May 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:11:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/681a90d7609de35278016dfc/media.mp3" length="140891620" type="audio/mpeg"/>
			<guid isPermaLink="false">681a90d7609de35278016dfc</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-is-it-meam-i-the-drama</link>
			<acast:episodeId>681a90d7609de35278016dfc</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-is-it-meam-i-the-drama</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfHglWDlM11d0YAPm1XxMGADjMkYVSHJy0g90D1/BKJhgiSI63b5RMlp5LWuFs1w2WCFxwmUgsFaZLzkd05DU3A7F0NrUpAnfyTiQQJyQdUTEZz3vAhx7xz+uq6pA66bXpxmmYDKzo0NKFTxdjWjpjCco8C+Of8Y86N6INNnKAIToRxwRlO98Akek1UKxCtObvUKjyfo+/7KP8LFpPgbzoB8R+iDqswYX/rlUriELghIyXcCPcdmsIfW2B6CkzrZgrGjwceLUcjKNFgQrEyg6LN]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>298</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1746564821619-695d16fd-68f0-433e-a27e-78177f621127.jpeg"/>
			<description><![CDATA[<p>Congratulations, it's Wednesday! We're introducing a new segment and seeing if you can tell your Aristotles from your Alexander-Arnolds. We're asking for stories of outfits which failed to slay, and our long suffering new mother gives us the third and final update on her godparent drama. Elsewhere we have a lonely Sarah wondering if she might be the problem, and we're asking if Susan is trying to tick everyone off her list...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Congratulations, it's Wednesday! We're introducing a new segment and seeing if you can tell your Aristotles from your Alexander-Arnolds. We're asking for stories of outfits which failed to slay, and our long suffering new mother gives us the third and final update on her godparent drama. Elsewhere we have a lonely Sarah wondering if she might be the problem, and we're asking if Susan is trying to tick everyone off her list...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: He WON'T kiss me because I got LIP FILLER]]></title>
			<itunes:title><![CDATA[Boy Talk: He WON'T kiss me because I got LIP FILLER]]></itunes:title>
			<pubDate>Tue, 29 Apr 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:19:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6811308cf7d552efdcfec940/media.mp3" length="156585624" type="audio/mpeg"/>
			<guid isPermaLink="false">6811308cf7d552efdcfec940</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-wont-kiss-me-because-i-got-lip-filler</link>
			<acast:episodeId>6811308cf7d552efdcfec940</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-wont-kiss-me-because-i-got-lip-filler</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd0Xv+dc5GTAS2Y3QtzAe24Jb7U9/74x025CC8QJPkmLaLD+f4T5qEyNtDCNpOGo7BZ5lDwRKVFteFmJf45H7fGA7eXrYHAPyll46cueTlpCK0rH8mw0KkdssdYIHJgkcd8im3BYBhsm1zL+y+oQN2rpGiQbbEurMnim2bW4gcL49NxvmXeaYiaewBDAXEplLHfrn6wJCwD0glNCgswXYAfPOxYhcL08XzSpQ4CuCSLUjPUqULXdXv6mw60suCHspVFaamUJwtXe7nV4dlrKQnN]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>297</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1745953538261-d0425343-e701-42fd-aadd-70819adc6d9a.jpeg"/>
			<description><![CDATA[<p>Welcome to the News at 7, we're your hosts Sophia and Cinzia and here's the headlines for today. We're planning a party and avoiding tough, grey meat. The notes app is shaking everyone to their core. Cinzia is so hungry she could eat a man, Brian's priorities are all wrong, and Sarah's boyfriend would rather spend money on children's cardboard than bricks and mortar. </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to the News at 7, we're your hosts Sophia and Cinzia and here's the headlines for today. We're planning a party and avoiding tough, grey meat. The notes app is shaking everyone to their core. Cinzia is so hungry she could eat a man, Brian's priorities are all wrong, and Sarah's boyfriend would rather spend money on children's cardboard than bricks and mortar. </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: I'm being punished for being in love...]]></title>
			<itunes:title><![CDATA[Girl Talk: I'm being punished for being in love...]]></itunes:title>
			<pubDate>Tue, 22 Apr 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:14:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6807d0c3d841fa6edc5724af/media.mp3" length="144938196" type="audio/mpeg"/>
			<guid isPermaLink="false">6807d0c3d841fa6edc5724af</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-im-being-punished-for-being-in-love</link>
			<acast:episodeId>6807d0c3d841fa6edc5724af</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-im-being-punished-for-being-in-love</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAi/9jB7rWUfIoAH7zpcxLQjcx0VNp2d90Q9hKFXrBIAYpyTNpa4sMaNbUQkbBj1TXI0h2aMpWg7IJnVOoSdODWSpNeWlUf6ARUZzL4+3yDUgHkYkTwrJybLEhFpqzqxvKCQJcQsJ/Y3wDV5XLpb+D9xIL9CF/4L9MUjcZAB/byKCk5wEN556sUaPtinm3eE3Ggxy2tEg6Z2BPVJRpE8q8iBJIyFA+8I0gaDWGh1haIuc]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>296</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1745342945127-981c6401-2827-4625-a593-9db99525e685.jpeg"/>
			<description><![CDATA[<p>Hey from LA!!! Fresh from Coachella, we're taking the pod worldwide and delivering one of our comfiest episodes yet. We're discovering shocking villain origin stories, Sarah can't stop texting her bestie's bf and there's been a sad and unexpected change in Susan's friendship. We have a WILD update on the overbearing non-godparent and we're asking her 'Parlez-vous français??'</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Hey from LA!!! Fresh from Coachella, we're taking the pod worldwide and delivering one of our comfiest episodes yet. We're discovering shocking villain origin stories, Sarah can't stop texting her bestie's bf and there's been a sad and unexpected change in Susan's friendship. We have a WILD update on the overbearing non-godparent and we're asking her 'Parlez-vous français??'</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He NEVER lets me sleep over, WTF??</title>
			<itunes:title>Boy Talk: He NEVER lets me sleep over, WTF??</itunes:title>
			<pubDate>Tue, 15 Apr 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:13:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67fea0fb66d94e7a629b09af/media.mp3" length="144081443" type="audio/mpeg"/>
			<guid isPermaLink="false">67fea0fb66d94e7a629b09af</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-never-lets-me-sleep-over-wtf</link>
			<acast:episodeId>67fea0fb66d94e7a629b09af</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-never-lets-me-sleep-over-wtf</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCceEvoNVpbgehx2D3miW7AwfbFqgEOJ5GgKN1iraRb/+h0FydoXJ0Ou7dFEMgWbx3Rzy8ahFV6r217IDcer6VOh8v4jPZ6VJoXUIZgKG9jNnZBXnAXqqZhQv28jNdK3fYuRlxQ4rzoB+h1OfLnQe3SG3RPBfzLtC2OTCcBQ7PRdrmx4LqxFlxg/bCNNw3ReV2sisqyGU2+kaAYucppnYV3zv5T0kTOa1UGe2wW5NHvg+twJIZTa7BhaGQl2Z15vTYXsXE3SvdwV+2TcdRSO/2VC]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>295</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1744740947841-e1ed6c97-5640-4b00-9f03-2b680607fa28.jpeg"/>
			<description><![CDATA[<p>Turn your speakers up, it's Wednesday! We're going undercover and sharing codenames, getting horrified by group chats and asking what our initiation process looks like. Brian's bringing Helen to his first date, Sarah's new boyfriend can't get any shut eye and we're all double booked. Finally, we're telling Sarah everything's okay and it's time to move on from Serious Steve...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Turn your speakers up, it's Wednesday! We're going undercover and sharing codenames, getting horrified by group chats and asking what our initiation process looks like. Brian's bringing Helen to his first date, Sarah's new boyfriend can't get any shut eye and we're all double booked. Finally, we're telling Sarah everything's okay and it's time to move on from Serious Steve...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Has my new boyfriend slept with MY SISTER??</title>
			<itunes:title>Girl Talk: Has my new boyfriend slept with MY SISTER??</itunes:title>
			<pubDate>Tue, 08 Apr 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:02:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67f5943159cf07f9c90bde30/media.mp3" length="121604108" type="audio/mpeg"/>
			<guid isPermaLink="false">67f5943159cf07f9c90bde30</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-has-my-new-boyfriend-slept-with-my-sister</link>
			<acast:episodeId>67f5943159cf07f9c90bde30</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-has-my-new-boyfriend-slept-with-my-sister</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcTkbnfR+DEDSljDewSgUrYy2Xy3v5kPvhAk8LaRK6geqq2ecVro3uLD6lxJYU4bT9S9UaKTvQOGtqiplvwjxD3xcw6nfcfY12xd+kp94LmTb0vLGs6ewCxmXKlVwUj+7+HaMRxUEXZNPHUAitvtEHVUn+zssk0NkQEPmqjdQDRDHtHfdwn/yvN8/vRZN6TzjZ3FRyq3HoIM8lk3N2tLx8l2OlubmnTvrX5vkskW3qOFJOrsdKTLO4l3GRQjS037yybchEjPPB3JEsW6j5DqqgM]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>294</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1744150802786-06c03e3f-da5a-4f13-b16b-3c9c3e6988ad.jpeg"/>
			<description><![CDATA[<p>It's Wednesday and we're putting the world to rights by laying out our rules for modern dating. The girls experience a case of mistaken identity, we're shouting out the 2025 and 2026 brides (kinda!), and we're trying to be there for a friend. We're telling Susan to keep a cheating ex in the dark and a special Sarah provides our quote for the episode! </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It's Wednesday and we're putting the world to rights by laying out our rules for modern dating. The girls experience a case of mistaken identity, we're shouting out the 2025 and 2026 brides (kinda!), and we're trying to be there for a friend. We're telling Susan to keep a cheating ex in the dark and a special Sarah provides our quote for the episode! </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: The perfect guy or the perfect LIAR??</title>
			<itunes:title>Boy Talk: The perfect guy or the perfect LIAR??</itunes:title>
			<pubDate>Tue, 01 Apr 2025 23:00:00 GMT</pubDate>
			<itunes:duration>1:11:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67ebfc02d4b40d7b30637b9e/media.mp3" length="140705006" type="audio/mpeg"/>
			<guid isPermaLink="false">67ebfc02d4b40d7b30637b9e</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-the-perfect-guy-or-the-perfect-liar</link>
			<acast:episodeId>67ebfc02d4b40d7b30637b9e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-the-perfect-guy-or-the-perfect-liar</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfkbODmepszliUJcjz5QXHidHAQUXNYSTGEUCpoDPzBZUZbwQj/Y1Pia65klFnYCJ4Ya0NNvyN3EmfAK2gBjTC/lpNBrOJiabsPbL3onB2dlAeX2A5uFtfuk9h97xGdhQ7feErPaMIGTOhnRA9U2VcSSgBFe+6vhyupPF13MrQYc4wVib3MGA7uANtacqPDkF0XiopqykJl0FMQX8rCjJOrPppLXE13GbZX1GW0N7kfAbKQpoMk/00bf02OyShEu7SgYGLU+0VMlVeqfLOAB7cA]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>293</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1743518588894-29aa813a-71fc-47f9-a69f-b2315e351702.jpeg"/>
			<description><![CDATA[<p>Spring has very much sprung and we’re giving all boys everywhere a much needed PSA!! Sarah’s dancing in the kitchen and Susan’s trying out a Bad Boy. We’ve got a Brian who’s “boys trip” is nothing of the sort, and we’re ranking our favourite things about an international athlete.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Spring has very much sprung and we’re giving all boys everywhere a much needed PSA!! Sarah’s dancing in the kitchen and Susan’s trying out a Bad Boy. We’ve got a Brian who’s “boys trip” is nothing of the sort, and we’re ranking our favourite things about an international athlete.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Bad luck or a SISTERLY betrayal??</title>
			<itunes:title>Girl Talk: Bad luck or a SISTERLY betrayal??</itunes:title>
			<pubDate>Wed, 26 Mar 2025 00:00:00 GMT</pubDate>
			<itunes:duration>1:05:31</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67e2c54e62322291cd1af401/media.mp3" length="127937199" type="audio/mpeg"/>
			<guid isPermaLink="false">67e2c54e62322291cd1af401</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-bad-luck-or-a-sisterly-betrayal</link>
			<acast:episodeId>67e2c54e62322291cd1af401</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-bad-luck-or-a-sisterly-betrayal</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe/DnacqniFh9oCVTkfN6cH1sTh4h5KuNSt3cGXI/vNatIwPPRygjb5JCy17afyZKc7TL2RXdqtgNuJz/5An8L1lQYtTjM33yv2FoQzgefVNg3TZ+QW9VDfVWwYIUpNA5o1vYqpMTYlVA9mWCt/YI+F5JBa61E3EuXTpbsdXnLz5Q9vhdPwTr+nW0aCrNahvFupVaJzXTPSVH3W1lmSRyYfmUIeiReZXyyTmHnDjxT87cCOEeP56wDRGPgkr8JsXxQs/m4iVQUcL5KwcrHZZHWO]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>292</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1742914730601-07bd18c8-76f8-424d-8805-ff9cd935d283.jpeg"/>
			<description><![CDATA[<p>Live and direct from The Girls Bathroom studio, it's time to talk Temptation Island and icks you just can't ignore! Sarah's in the middle of a love triangle that's more dramatic than <em>The Summer I Turned Pretty</em> and there's a Brian that's completely oblivious about what's going on behind his back.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Live and direct from The Girls Bathroom studio, it's time to talk Temptation Island and icks you just can't ignore! Sarah's in the middle of a love triangle that's more dramatic than <em>The Summer I Turned Pretty</em> and there's a Brian that's completely oblivious about what's going on behind his back.</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: He left her for me, but he STILL won't commit!!!]]></title>
			<itunes:title><![CDATA[Boy Talk: He left her for me, but he STILL won't commit!!!]]></itunes:title>
			<pubDate>Wed, 19 Mar 2025 00:00:00 GMT</pubDate>
			<itunes:duration>1:24:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67d73a685430fa2ee4147538/media.mp3" length="165745167" type="audio/mpeg"/>
			<guid isPermaLink="false">67d73a685430fa2ee4147538</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-left-her-for-me-but-he-still-wont-commit</link>
			<acast:episodeId>67d73a685430fa2ee4147538</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-left-her-for-me-but-he-still-wont-commit</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf0IrMdokRgfIHGW6Zvq78k+yM+QI9U9B8ysjTxVZFvIBr6fSaE7+lsuBC8RmcZD5hroPniVGpZ54ykOIZEmk/04HufEduYbGqdogWDE77/8gH+SSVThD+t8InlwcYxoHTQKob8Mh5+hPZ0L/y/Biu0tYDvYqoOeV3wfl8je7CpmlICPhD+WsRaFcpN/oEKK/FYZzICVsTtxUkUHMeKELpxTw1XFiolAScotoH4BPsT8lDwKKicyPBgnezWUST5BvDnw/PR0uT35UfO7m0rPl8X]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>291</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1742158518484-a442582a-db19-434a-a745-61de56c67cd5.jpeg"/>
			<description><![CDATA[<p>Back from our travels and reporting live and direct from The Girls Bathroom studio, it's time to talk t-shirt tans and Temptation Island! Cinzia's riding the bus and Sophia's getting stood up. Sarah's losing her mind over her boyfriend's new role, we're inducting another Brian into the bathroom, and some first time listeners are finding out info they wish they hadn't...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Back from our travels and reporting live and direct from The Girls Bathroom studio, it's time to talk t-shirt tans and Temptation Island! Cinzia's riding the bus and Sophia's getting stood up. Sarah's losing her mind over her boyfriend's new role, we're inducting another Brian into the bathroom, and some first time listeners are finding out info they wish they hadn't...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: They BOTH fancy MY MAN!!</title>
			<itunes:title>Girl Talk: They BOTH fancy MY MAN!!</itunes:title>
			<pubDate>Wed, 12 Mar 2025 00:00:00 GMT</pubDate>
			<itunes:duration>1:04:01</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67ced6afd64d9d8e86d6ba73/media.mp3" length="125209211" type="audio/mpeg"/>
			<guid isPermaLink="false">67ced6afd64d9d8e86d6ba73</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-they-both-fancy-my-man</link>
			<acast:episodeId>67ced6afd64d9d8e86d6ba73</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-they-both-fancy-my-man</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeE5YTT7h3FV1A11b/cz4ccNT0aiJgR4p4oNQkcSJPSUbYbwC5p/lRcBq2Ltmmt6BquaSaeSPJo+ux6ykSVs/RJeizuqZgnPXwUZXDL5jDkPxThv4krxCdzZmyOpBrKnz14+5VU2Oc5hpEpMbr/AcLS020dvQEQx/9hKful4axCtf1fLsgWmPORt8XN4t8hxWjJasytT+KyLv8UMUtZDamVEDb7atHJW9dm9xSlGb5VupZk/YrpVQJb6J6a8VjdK4kuyHI4qpd+5CDc1tdpgljr]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>290</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1741611738732-6a1afb35-cf80-4fca-a64e-b4edf3e9b024.jpeg"/>
			<description><![CDATA[<p>Happy Wednesday!! We're back at the TGB HQ to ask if we should be drag queens and share in our regrettable fashion choices. We have a Sarah who's way too concerned about her bestie's boyfriend's height and a Susan's 30th birthday has been all but forgotten. Brian's friends are crushing on him hard (but does he know?) and best contact the authorities, there's a style thief on the loose!!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Happy Wednesday!! We're back at the TGB HQ to ask if we should be drag queens and share in our regrettable fashion choices. We have a Sarah who's way too concerned about her bestie's boyfriend's height and a Susan's 30th birthday has been all but forgotten. Brian's friends are crushing on him hard (but does he know?) and best contact the authorities, there's a style thief on the loose!!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE BOYS BATHROOM feat. CODY SIMPSON</title>
			<itunes:title>THE BOYS BATHROOM feat. CODY SIMPSON</itunes:title>
			<pubDate>Wed, 05 Mar 2025 00:00:00 GMT</pubDate>
			<itunes:duration>58:16</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67c6eadc48f26a4bca937f21/media.mp3" length="113852824" type="audio/mpeg"/>
			<guid isPermaLink="false">67c6eadc48f26a4bca937f21</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/the-boys-bathroom-feat-cody-simpson</link>
			<acast:episodeId>67c6eadc48f26a4bca937f21</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>the-boys-bathroom-feat-cody-simpson</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAnREp3FUnySJb7HnM1xaFcEOIzaYOVBOkRtimYq71CPilr98CBNbulr+V2WLjCCo1kB7Gz5q6RINuer5AceRnKsQiQCYevE7yN0gMSiOkn9axslkAP5unMuWTjZwSIAdkDPYBaICHzyBC/G0aY+2XdSGeAU2DLSokP/4kP75sgGpAx0w+MTgoGNQy7onnLJ2oWHywTzu4ecnRxZtj8uroX/gV3M6xkxFK57LJiamifrs]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>289</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1741095181220-a60e9b60-66c6-4bce-8f29-06c135242978.jpeg"/>
			<description><![CDATA[<p>THIS IS NOT A DRILL!!! THE CODY SIMPSON IS ON THE GIRLS BATHROOM PODCAST!!! Now that we've all collected ourselves, Cody, aka Brian is getting confused by the UK lads, delivering some hard truths to our Sarahs and is also looking to start a musical trio...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>THIS IS NOT A DRILL!!! THE CODY SIMPSON IS ON THE GIRLS BATHROOM PODCAST!!! Now that we've all collected ourselves, Cody, aka Brian is getting confused by the UK lads, delivering some hard truths to our Sarahs and is also looking to start a musical trio...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: He's holding a grudge against MY VIBRATOR]]></title>
			<itunes:title><![CDATA[Boy Talk: He's holding a grudge against MY VIBRATOR]]></itunes:title>
			<pubDate>Wed, 26 Feb 2025 00:00:00 GMT</pubDate>
			<itunes:duration>1:15:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67bdaa85da0308485507562f/media.mp3" length="148064711" type="audio/mpeg"/>
			<guid isPermaLink="false">67bdaa85da0308485507562f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-hes-holding-a-grudge-against-my-vibrator</link>
			<acast:episodeId>67bdaa85da0308485507562f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-hes-holding-a-grudge-against-my-vibrator</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeerGDsn8dpjj2Z6HyydGXtu3gFkmP1Psq/SMblsk9Ec4x9JUsavz5nVz+rosTA02tVUXjftib50spYg2HPQCxluYXdvTNV+KqR2w0Y8QcZsKQanaN1+ADIux4a5XsfGZaAFTDi4Bk7/NvW/TrHSYqHBWqxpZdi+A8TGDOgf5ag9TeNrtS32sOkEI3w3vTyBVe4dhtJjxHv6x6QPwJoaz1pcY3uIdkrR91XrtekenaWHiB3m/OFIT/zFrHISG+y1gKShwHcjojyEFBEc9IAaiec]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>288</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1740507264484-0fa06466-62fb-4ad0-bdce-289b1eb17e36.jpeg"/>
			<description><![CDATA[<p>Bienvenue! We're saying 'Hola' to all the Sarahs and Brians this week, and unfortunately subjecting you to some awful dirty talk. We have a Susan asking if she should risk it all for a hot celeb, a Brian who won't bite the bullet (in more ways than one) and a Sarah wondering if her boyfriend is secretly jealous of her success...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Bienvenue! We're saying 'Hola' to all the Sarahs and Brians this week, and unfortunately subjecting you to some awful dirty talk. We have a Susan asking if she should risk it all for a hot celeb, a Brian who won't bite the bullet (in more ways than one) and a Sarah wondering if her boyfriend is secretly jealous of her success...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: HELP! I've uncovered a secret...and I wish I hadn't]]></title>
			<itunes:title><![CDATA[Girl Talk: HELP! I've uncovered a secret...and I wish I hadn't]]></itunes:title>
			<pubDate>Wed, 19 Feb 2025 00:00:00 GMT</pubDate>
			<itunes:duration>1:11:01</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67af5cb3f7ed8924108bde0b/media.mp3" length="138913789" type="audio/mpeg"/>
			<guid isPermaLink="false">67af5cb3f7ed8924108bde0b</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-help-ive-uncovered-a-secretand-i-wish-i-hadnt</link>
			<acast:episodeId>67af5cb3f7ed8924108bde0b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-help-ive-uncovered-a-secretand-i-wish-i-hadnt</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfu8DCvKnUVHiyrPLOPliEMNl465lM+3iA5eh34cqXxUDyxsKKhW1Uq1hQK6/yDyuOaWa+mYQw8NAa4MVZUt741qozmFbvGvAKUUrFkIO45WPY1XbYTCgLtQg0seuSTJLnL1SiAYICCoK62ZyTXYDX4k+xKBq7JZpeCrvctxVLQLv0aCtJzn/9PlBvNVoZrcfzvk+B3egkxxinQ6khVWuUijV+gh0aTPhl74OI6lbtO2eD5yoUoCeRF9wYHS6BZQzJl6w5ZKGHdQTSiHfh1Lzxo]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>287</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1739891851689-2c32aec2-e57f-4e9d-985b-9931a6ee0bd7.jpeg"/>
			<description><![CDATA[<p>It's Wednesday!!! We're back in our pink palace, some Sarahs are sharing advice and we're asking Eddie if he's walking. We've got a family betrayal, a remorseful bridesmaid and a bestie hiding a secret she wishes she never heard...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It's Wednesday!!! We're back in our pink palace, some Sarahs are sharing advice and we're asking Eddie if he's walking. We've got a family betrayal, a remorseful bridesmaid and a bestie hiding a secret she wishes she never heard...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE BOYS BATHROOM feat. Relatables</title>
			<itunes:title>THE BOYS BATHROOM feat. Relatables</itunes:title>
			<pubDate>Wed, 12 Feb 2025 00:00:00 GMT</pubDate>
			<itunes:duration>1:17:35</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67ab6607c6f97f89d809fa9f/media.mp3" length="151304931" type="audio/mpeg"/>
			<guid isPermaLink="false">67ab6607c6f97f89d809fa9f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/the-boys-bathroom-feat-relatables</link>
			<acast:episodeId>67ab6607c6f97f89d809fa9f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>the-boys-bathroom-feat-relatables</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcKLV00h/+lHzvdxE6Z2oFwfourblRVAn7LReU+Onf3IN6lBhR2i2b1EH8kCrJCW/mEZ54HPpP8vI5yYIrMOnnimBpx1msG5VE8LlZxKiET7sws5BtQ7ueghSjqQdpXUw/6L//RZJSBmhGstbgiX6T+d6ItCGQFugekCFUTbdPsT01TAwMVd0ni37z7jBq+po+1mIYtfmj+ObwLifdEPxd8aHRV+rb6tVaQ2chjD8y/vMidGQXhVXC+AXzFN85n8r6REy3glaLhQUlR/siY5ncE]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>286</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1739285070510-a66b4ccc-b4c8-43e4-bbb1-3a37971f351d.jpeg"/>
			<description><![CDATA[<p>Far out!! There's some Aussie Brians in the bathroom this week, a.k.a. Jake and Ottie from Relatables!! Between singing Cody Simpson and asking 'Why mullets?', we're picking their brains to find out why a UK Brian keeps popping pills, why an Aussie Brian can't put down his phone and why a Canadian Brian is disappearing for 3 weeks...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Far out!! There's some Aussie Brians in the bathroom this week, a.k.a. Jake and Ottie from Relatables!! Between singing Cody Simpson and asking 'Why mullets?', we're picking their brains to find out why a UK Brian keeps popping pills, why an Aussie Brian can't put down his phone and why a Canadian Brian is disappearing for 3 weeks...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: It’s HIS way or the HIGHWAY!!</title>
			<itunes:title>Boy Talk: It’s HIS way or the HIGHWAY!!</itunes:title>
			<pubDate>Wed, 05 Feb 2025 00:00:00 GMT</pubDate>
			<itunes:duration>1:23:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67a254daa7aa51f11539d6a7/media.mp3" length="163000186" type="audio/mpeg"/>
			<guid isPermaLink="false">67a254daa7aa51f11539d6a7</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-its-his-way-or-the-highway</link>
			<acast:episodeId>67a254daa7aa51f11539d6a7</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-its-his-way-or-the-highway</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAlvRNXCl+sQlQbGJamWQ7G7eMv0Z/lIMOBm4lx/jJHKoaykMP1kTKFmyj8d3x7Z6figd3lE7jZOAj67F9IY0aIL+47Q0QL8DF77zoQl6y1j0Y5DOJWjgJy1HlCioVVJmJsH1zAn/e3TB7yE0Aiuy7TiB9vadp5n2hnX4N4RsRaiKZyIvv22sbaHL7UXZuk5YGc3TOHOtlHXtu4IH0TIqUKUNKQgRMq9DFq5FRlCXu7yK]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>285</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1738707301364-192142fd-9da4-497c-8179-9532205e12c4.jpeg"/>
			<description><![CDATA[<p>G'day gals!! We've got THE update to end all updates and we're conducting important research to find out if the Brians are team bush or team bald. Sarah's heading all the way to New Zealand to avoid her mother-in-law and Brian won't get off the bike! </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>G'day gals!! We've got THE update to end all updates and we're conducting important research to find out if the Brians are team bush or team bald. Sarah's heading all the way to New Zealand to avoid her mother-in-law and Brian won't get off the bike! </p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I really regret telling her the truth…</title>
			<itunes:title>Girl Talk: I really regret telling her the truth…</itunes:title>
			<pubDate>Wed, 29 Jan 2025 00:00:00 GMT</pubDate>
			<itunes:duration>1:20:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6798bd6afbf563bda14390ce/media.mp3" length="156725068" type="audio/mpeg"/>
			<guid isPermaLink="false">6798bd6afbf563bda14390ce</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-i-really-regret-telling-her-the-truth</link>
			<acast:episodeId>6798bd6afbf563bda14390ce</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-i-really-regret-telling-her-the-truth</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAlc3WjK0ZjArBuygnqibpKUk2uzFBX2l/T7TEZUEMMWDx0x2YdduWyALHIvu+0yN1EiUftjL4uv2YVrVT29UCvMNzfxWSkiUWN+FB9VpA1/llONpUEhDDIJs9WjGntkVQj0BBo5fTJbIRLcCpI4cCEjUxsIVLsBkNFLcl+z/UljLmX8M9CO82v3ljfK06NKrkmK7WbE2ps+Bc4nTewAu2tDb3NBCIc69YxOSFTBIJ9yh]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>284</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1738106213066-a47248d2-d402-467c-bb08-eae2dec064cd.jpeg"/>
			<description><![CDATA[<p>We're staying in comms and circling back to tell you 'Happy Wednesday!' We're pushing HR's limits, staying on a sofa bed with the groom's dad and Susan's wishing she'd stayed tight-lipped...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>We're staying in comms and circling back to tell you 'Happy Wednesday!' We're pushing HR's limits, staying on a sofa bed with the groom's dad and Susan's wishing she'd stayed tight-lipped...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Her fiancé wrote me a LOVE LETTER?!?</title>
			<itunes:title>Boy Talk: Her fiancé wrote me a LOVE LETTER?!?</itunes:title>
			<pubDate>Wed, 22 Jan 2025 00:00:00 GMT</pubDate>
			<itunes:duration>1:22:10</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/678ff270d186489b148f03dd/media.mp3" length="160760218" type="audio/mpeg"/>
			<guid isPermaLink="false">678ff270d186489b148f03dd</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-her-fiance-wrote-me-a-love-letter</link>
			<acast:episodeId>678ff270d186489b148f03dd</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-her-fiance-wrote-me-a-love-letter</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCei2+StMh9xWNrdQQkO+2Uge4VcYxorzAIP7aYSIwkRIl98BiBKWRbXyTX2n2HXztNneEpYwPRwhkmr9/+V9VDtA5lYzrH2wBhdVnIvlJSBOz5XyiLnfQifAYFaRioi55oYy1brpyNJvJzq0AWeWr/68CIjCLJsJpKJ1J9o5yqcqnYN66/TqH+M3Mq8WcQZG9Np3j2XFiA0jfjk/rm2PRjWAyBMx/PNizQE5QM6sOiG9AeBipbmdpbDkf7YUXUac4v2E/uq8hoSpfTjT0U5AGYe]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>283</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1737483538360-0163d803-21ff-4ce1-8a96-e30d404b7ded.jpeg"/>
			<description><![CDATA[<p>It's Wednesday, and Sarah's man has one HUGE problem. We're finding out what it means to be Love Actually-ed, working out if we're Brian's mum and crossing our fingers that this is all just a big prank...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It's Wednesday, and Sarah's man has one HUGE problem. We're finding out what it means to be Love Actually-ed, working out if we're Brian's mum and crossing our fingers that this is all just a big prank...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: She’s so f**king LOUD!!</title>
			<itunes:title>Girl Talk: She’s so f**king LOUD!!</itunes:title>
			<pubDate>Wed, 15 Jan 2025 00:00:00 GMT</pubDate>
			<itunes:duration>1:24:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6786d5cb45dea7883633c367/media.mp3" length="165121724" type="audio/mpeg"/>
			<guid isPermaLink="false">6786d5cb45dea7883633c367</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-shes-so-fking-loud</link>
			<acast:episodeId>6786d5cb45dea7883633c367</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-shes-so-fking-loud</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd41Ce8JASJFWokH/aIPPoohGOgYSZIQJYZk4sJyyijSXjCG+UOQuPnqikN8tpWdRhFjL+gvkxwerNI1tHaEzcLxXvRuhOT4RVRS301oHB808DBYPhuKD5fOWqb1Uro/66euPCRN2QN4QjIF3AIViZOeA2DJBlHrROZtdpjCupjtr/WH37EOf2AP+pcgdiGsEhXpdvr+JcG7sKX/STIZ3itazMgHi2Fu1fjmP1pVt5rUSaa/z79PGKAK2mjSn6psDmednEGyUMTpzoOds/lA1D2]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>282</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1736889592204-b9bfe71a-df67-4b7a-8712-8e9cee22efed.jpeg"/>
			<description><![CDATA[<p>Helen can you shush please??! Sarah needs to decide if she's going to befriend an enemy, Brian needs to find an 'approved person' and we're imagining what life would have been like had we all been to drama school...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Helen can you shush please??! Sarah needs to decide if she's going to befriend an enemy, Brian needs to find an 'approved person' and we're imagining what life would have been like had we all been to drama school...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: I'm gay but she's IN LOVE with me!!]]></title>
			<itunes:title><![CDATA[Boy Talk: I'm gay but she's IN LOVE with me!!]]></itunes:title>
			<pubDate>Wed, 08 Jan 2025 00:00:33 GMT</pubDate>
			<itunes:duration>1:07:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/677824e377d7a3f73acd536a/media.mp3" length="132244545" type="audio/mpeg"/>
			<guid isPermaLink="false">677824e377d7a3f73acd536a</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-im-gay-but-shes-in-love-with-me</link>
			<acast:episodeId>677824e377d7a3f73acd536a</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-im-gay-but-shes-in-love-with-me</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdKAtPmIF9hPY0GQhwmQBpwNM8I3D3DxbiIidYu+NO5zyA8gVLt/oLU2nH/JtcltfC3r6rNP1MVEgd0B0b6ooefuAO/ySvVgotbDGiXmhZ35tU1x3GNNK6focgcaVbukziWRh3ifUNwRCketrNEYlDD4MAB5hSmi3hVzQVeuLHtHSQlkpZ7iHskIR+Hsn5yWG92/oyQBGkCNrHHMTUTc+dVI5Q5jY3rIMmP8zt7h5V1mRhVcfmHurDUa7yYDOI0CJpkf6ZXStaGc7hU+dDLNaMU]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>281</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1736275315496-7bc9bdad-9b31-49db-8f2c-43433a16bd69.jpeg"/>
			<description><![CDATA[<p>Happy January!!! (And happy birthday Emily) We've got two Brians in the bathroom this week ready to have some difficult convos, we're finding out who requested Rihanna at the school concert, and we fear we'll never look at a photocopier in the same way again...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Happy January!!! (And happy birthday Emily) We've got two Brians in the bathroom this week ready to have some difficult convos, we're finding out who requested Rihanna at the school concert, and we fear we'll never look at a photocopier in the same way again...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>HAPPY NEW YEAR!!</title>
			<itunes:title>HAPPY NEW YEAR!!</itunes:title>
			<pubDate>Wed, 01 Jan 2025 00:00:44 GMT</pubDate>
			<itunes:duration>1:17:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/676b55bd2931d58818802b93/media.mp3" length="152441699" type="audio/mpeg"/>
			<guid isPermaLink="false">676b55bd2931d58818802b93</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/happy-new-year</link>
			<acast:episodeId>676b55bd2931d58818802b93</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>happy-new-year</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdskd0pnGaGR3N7D33w8T3bwwHEki9mMydT9ET00xGmHr7DSbuc8HHbPkw5Tcc6VPWlEQw2PAf0LUFzPYmOAF8Kr1RrZTFRbFzJXOGMt0Jg78KkxsAjIQw0hSzIQv6wksZrn3Lvm9kuCyCXyQKLAwb+B3qFAzlG5yats/916ybe3frF7OKYvBdJM1zrXocjilKmmgax3fKSmLyrQqUmVRfUK06J5ExID0KnQ1QVu0ajBPRc/Ms+D1ZrsBBSdTLeHwCywFY4zU0+PE+UKXoyOkvm]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>280</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1735076296585-d4e22af9-151f-4a07-9c30-6262643d1c9d.jpeg"/>
			<description><![CDATA[<p>Toot toot toot it's 2025!!!! We're manifesting a happy and healthy new year, making big life decisions and telling Sarah she simply CANNOT wear that sash!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Toot toot toot it's 2025!!!! We're manifesting a happy and healthy new year, making big life decisions and telling Sarah she simply CANNOT wear that sash!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>MERRY CHRISTMAS!!!</title>
			<itunes:title>MERRY CHRISTMAS!!!</itunes:title>
			<pubDate>Wed, 25 Dec 2024 00:00:19 GMT</pubDate>
			<itunes:duration>1:17:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/676afdec696ebe74c7e79344/media.mp3" length="151453601" type="audio/mpeg"/>
			<guid isPermaLink="false">676afdec696ebe74c7e79344</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/merry-christmas</link>
			<acast:episodeId>676afdec696ebe74c7e79344</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>merry-christmas</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdOaQgQ+jfGKy6XwBlqt2mlFmimOiclrZlM2geQkB56oCdDphfc0I/nl36QcBUn8vp8psbd3VOm0wHyAB39sTPsmqiaSyX/gXJljTtjsGE0zzvapGI15T41Cq8d52sqc7J3CYOjJSABX55XB3EADPL9bTX/Di8Q3AyAOBlUtvrXw6BTimFpLZ/MluN1tFdkqE9jv7B15cgoTGVk269z3cZrFATrZbmTU4ms8l8QrZ0eJM2D9XPjJMcZw+addJq1prLK1ZK3uEvx76byS859ScqF]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>279</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1735075068264-eb68fb90-1aa2-437d-9d90-1606d4cf1ebb.jpeg"/>
			<description><![CDATA[<p>IT'S CHRISTMAAAASSS!!! Two talking Christmas trees have somehow made their way into The Girls Bathroom to dispense some festive advice. They're keeping Work Brian anonymous, asking New Brian to spend some cash and Sarah is really hoping her parents quit their saucy Christmas Day tradition!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>IT'S CHRISTMAAAASSS!!! Two talking Christmas trees have somehow made their way into The Girls Bathroom to dispense some festive advice. They're keeping Work Brian anonymous, asking New Brian to spend some cash and Sarah is really hoping her parents quit their saucy Christmas Day tradition!</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: It’s going to be an AWKWARD gift swap!!</title>
			<itunes:title>Girl Talk: It’s going to be an AWKWARD gift swap!!</itunes:title>
			<pubDate>Wed, 18 Dec 2024 00:00:12 GMT</pubDate>
			<itunes:duration>1:23:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6761fb2b6ba7599e6445557b/media.mp3" length="162372304" type="audio/mpeg"/>
			<guid isPermaLink="false">6761fb2b6ba7599e6445557b</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-its-going-to-be-an-awkward-gift-swap</link>
			<acast:episodeId>6761fb2b6ba7599e6445557b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-its-going-to-be-an-awkward-gift-swap</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe/6l8cQzYyR3XC6LujHQPvi8aC/kPSd2yJDXhSc7La/Rqqze2Vn9aiuUL7XGByF/z/lCjg3sBmQml1N2Vxbb2rPXiAHEr3SAenOksK7+hNnP9/ME6hw6fxNw4vP2L+N7ZyGoaE860xel16idnwjyqZXFUK7uxQd2H63i3DniVax9u7JzyK1t1BsZlejd28HyolB9iGDvMbplDvlr7QdbINbMdT/OMFwmHXbjcXMIzyUYipndMI7Jb4GgFEswudmLlDmbWK7zb/xDxhw70rmNYl]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>278</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1734473579962-8f097f61-77ce-4d6c-bae9-ace0362a7902.jpeg"/>
			<description><![CDATA[<p>Ho ho ho!! Two Christmas elves have taken a little break from Santa's Workshop to help listeners with their festive dilemmas! They're talking boyfriends, in laws, and how to tell Linda to get stuffed...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Ho ho ho!! Two Christmas elves have taken a little break from Santa's Workshop to help listeners with their festive dilemmas! They're talking boyfriends, in laws, and how to tell Linda to get stuffed...</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He’s having WET DREAMS…I’m not in them</title>
			<itunes:title>Boy Talk: He’s having WET DREAMS…I’m not in them</itunes:title>
			<pubDate>Wed, 11 Dec 2024 00:00:30 GMT</pubDate>
			<itunes:duration>1:05:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67585273c705e4417968f3ea/media.mp3" length="127165830" type="audio/mpeg"/>
			<guid isPermaLink="false">67585273c705e4417968f3ea</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-hes-having-wet-dreamsim-not-in-them</link>
			<acast:episodeId>67585273c705e4417968f3ea</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-hes-having-wet-dreamsim-not-in-them</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcfRfrYNDDWupIA6KPwPQL4XW9PQu+dqWhXWPkmyehGWROM8/utPH0OufVafHMi5kPbyu0WKb3a+WDzgTLDzUN9HwgA9gMUBSyweXTw9aPfzh7OO0rKaFWW8k+ZMWnr2rflNZBAP01tYpXM6w7Q569UhVZogTAjLOORJ4Ptn5RzS316EuQf4Lphtdomuyiriw1kscq140l2CHykgrlJ+CQT0tsbpvBEWPrkOzOgxKXKoeQES7JSEek+8lvb4WndGTtL4+fqVK6rtw21cT84RhYN]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>277</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>It’s the best day of the week!! Happy Wednesday besties!!! We’re joined by a four legged friend, a listener is concerned about her partners nocturnal emissions and we workshop solutions for a boyfriend suffering from squishing…</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>It’s the best day of the week!! Happy Wednesday besties!!! We’re joined by a four legged friend, a listener is concerned about her partners nocturnal emissions and we workshop solutions for a boyfriend suffering from squishing…</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: She's spent HOW MUCH on his xmas presents?!?!]]></title>
			<itunes:title><![CDATA[Girl Talk: She's spent HOW MUCH on his xmas presents?!?!]]></itunes:title>
			<pubDate>Wed, 04 Dec 2024 00:00:50 GMT</pubDate>
			<itunes:duration>1:20:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/674dc15d85ae82730a1ae5dd/media.mp3" length="158318783" type="audio/mpeg"/>
			<guid isPermaLink="false">674dc15d85ae82730a1ae5dd</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-shes-spent-how-much-on-his-xmas-presents</link>
			<acast:episodeId>674dc15d85ae82730a1ae5dd</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-shes-spent-how-much-on-his-xmas-presents</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCespO77kaBSE/G8wmGI+waUN9Dfwrod69Lmcq0ayUFYEnr6OEkgoh27oqKgakZNghy0CvF7vf4WFpP3QpHyLNUoZD9x1cLEKb8LlnFyjoHDn6Yp5Hgoz7aFy0HnwpfzM0usUxb+/VlQu39wjtV/cNFSmQcX58fnlDeKujmIrFhmK9CxpxEbY8oUpKls6Cd5ViVKxGE7K6Z9IC3O2afoVGo3d4RyAWuNxDT/4tejHg8/M2+YDgbYdG3i4spuvPPRPuBnoH+ZWvdl9NeB3MNsskCz]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>276</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1733250415420-bdb4b69d-7dff-4422-a066-f8353665eca5.jpeg"/>
			<description><![CDATA[<p>ITS CHRISTMAS!!!! Happy December besties! We're discovering Christmas traditions, baby names, and a loved up Sarah is on another planet...or is she working for MI5?</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>ITS CHRISTMAS!!!! Happy December besties! We're discovering Christmas traditions, baby names, and a loved up Sarah is on another planet...or is she working for MI5?</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE BOYS BATHROOM</title>
			<itunes:title>THE BOYS BATHROOM</itunes:title>
			<pubDate>Wed, 27 Nov 2024 00:00:30 GMT</pubDate>
			<itunes:duration>1:07:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6745e15478f05cc6cc4b90aa/media.mp3" length="97073686" type="audio/mpeg"/>
			<guid isPermaLink="false">6745e15478f05cc6cc4b90aa</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/the-boys-bathroom</link>
			<acast:episodeId>6745e15478f05cc6cc4b90aa</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>the-boys-bathroom</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdkc7CakrCi279CR+LsLq+K2UjHCGYs+hFlTMoWA21Ikyey8Viz6gjY72RTF8FKBUZwGQssy9IovH8jP2bTMytnEPHiGjbVbK0HaMLA2RHFQb4c24tc9+aSa3kvbsvNXeLjn0p3gksQMXzU/dvTnmT5Lf4iWuEYIyp0j2XXc5R18i+jGWMm0l3nevzgSMtPGmxcsGVgh8WU9KH1hNWzVjpyaB/5d1VIZRwW+u8+MsAPPkhEtWfEhz51q0HY3DF2GF3feCaHniwDYle0a00JoQUy]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>275</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1732637542123-b59bc4b9-26a0-4dae-a44e-09f262d812f0.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: My sister's MAN sent me NUDES...and I LIKED it!]]></title>
			<itunes:title><![CDATA[Boy Talk: My sister's MAN sent me NUDES...and I LIKED it!]]></itunes:title>
			<pubDate>Wed, 20 Nov 2024 00:00:10 GMT</pubDate>
			<itunes:duration>1:14:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/673b4b919ca19fe5b14a2f45/media.mp3" length="144733791" type="audio/mpeg"/>
			<guid isPermaLink="false">673b4b919ca19fe5b14a2f45</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-sisters-man-sent-me-nudesand-i-liked-it</link>
			<acast:episodeId>673b4b919ca19fe5b14a2f45</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-sisters-man-sent-me-nudesand-i-liked-it</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd7Cweq8g/RrpJqF5DfjvLwhOPNHBoDRN7L3tD4PFVmyyO0Dw5g0E6jR8Ns2TCmg3fNNzuRUrvBNm9/xz1AIWJfh+7qvSh3jjt/zGQF5Pa6jng8kL8KgFUj+eWlwSunKYzjhBubVu2SkgiX98NQz1Uf1ATLPA0dUBeRBg0jFUfTCLJ3njn+81SGkOBTs6u3Qs/fJ+BZ7rNiuokG9uX7SNNU6qgmglyodH/S0or37OJO6wYYk9rYskDB1fHgxGe7AlTPyySAHJTIEkg+ExAaPxq4]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>274</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: She’s a SERIAL canceller!!!</title>
			<itunes:title>Girl Talk: She’s a SERIAL canceller!!!</itunes:title>
			<pubDate>Wed, 13 Nov 2024 00:00:42 GMT</pubDate>
			<itunes:duration>1:23:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/673370201c8f0284cfb0d48c/media.mp3" length="162312292" type="audio/mpeg"/>
			<guid isPermaLink="false">673370201c8f0284cfb0d48c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-shes-a-serial-canceller</link>
			<acast:episodeId>673370201c8f0284cfb0d48c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-shes-a-serial-canceller</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAuJd+IUJ2v5rBWvW8v3UTSqSxRkCMSgx2WKMW/+tb7CBxC0ineS0d0CaixNVcU/FMutjeP6v2FCkgfIOgDn3mRLyyNl+80/PKhr6VhBGlU4g7tmB89Y1rYe8FpT4/+4J1QDhebf7gwevMCBFwVwBqgPaZQOjKcg3hKL1jWh2Idd8oZpGuMV0uHSnJUsy5ETSHYnSok9tCdVJfktCC2g6Clw2wFudoMP7VXWIgZBh0RIb]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>273</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: The man I’ve chosen doesn’t WIPE properly…</title>
			<itunes:title>Boy Talk: The man I’ve chosen doesn’t WIPE properly…</itunes:title>
			<pubDate>Wed, 06 Nov 2024 00:00:55 GMT</pubDate>
			<itunes:duration>1:19:46</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6728d0ef580049df8f0307ec/media.mp3" length="155994692" type="audio/mpeg"/>
			<guid isPermaLink="false">6728d0ef580049df8f0307ec</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-the-man-ive-chosen-doesnt-wipe-properly</link>
			<acast:episodeId>6728d0ef580049df8f0307ec</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-the-man-ive-chosen-doesnt-wipe-properly</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdYhA0jTnYuSiJaSDn6aJEKKshEwNzeQ6guUbsVSMRyKxmWx2c2HTfbWy+uldFko1d4UcGuijCzDyr/pPsC/u8GTcrQLL7wlR9lI7uoDoNhaeInu3b/ClfpcaD5JUILcVZvLnVsP6cD2Z4J+SQTq5Y8j+W1aYkKeK1gkQwiSyU4HWNTYgXht1jAsgiQcS6t8Rot0KMeQZlyp9ioJiuJcReo6onGurnI3XgCAJLNeGHFPCcxWdy2TpmGDENjLa2/Btn/cWMMTNwyM1B2swaqATRI]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>272</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: I'm in love with a GHOST!]]></title>
			<itunes:title><![CDATA[Girl Talk: I'm in love with a GHOST!]]></itunes:title>
			<pubDate>Wed, 30 Oct 2024 00:00:59 GMT</pubDate>
			<itunes:duration>1:16:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/67212b152daf1945411dc94b/media.mp3" length="149552181" type="audio/mpeg"/>
			<guid isPermaLink="false">67212b152daf1945411dc94b</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-im-in-love-with-a-ghost</link>
			<acast:episodeId>67212b152daf1945411dc94b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-im-in-love-with-a-ghost</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfwRBtHzr9aLHTnbBirDiNokmO0sawIBGOqrEcmT/riyts2z77OyMcfePcvrqPCeWxrEz1+edh9nPsx5UnwqP2UBPzzWG7z+041OJL56TRTI18IKSoF6z5ME8/xZuUbqFoAVZGFLsUwUc/mWnPXpvSoNvTr0NEsMQzTsjmQ3R3eirb4TV0NUucSJ1oQ6N1eGbmu38cFmDTMPaszVCa3LQsp1dMVqWfpxv/CNkmp5SbZPLDcRh8dIQDYkqosOnQQAcE6rc+ulIZGDBaloUds+j7E]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>271</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1730226850058-a8720c9b-16a2-4b30-b83f-ca5c3e3927c6.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My man NEEDS to eat a banana before sex!!!</title>
			<itunes:title>Boy Talk: My man NEEDS to eat a banana before sex!!!</itunes:title>
			<pubDate>Tue, 22 Oct 2024 23:00:36 GMT</pubDate>
			<itunes:duration>1:14:01</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6718191430187dfb6c8d2dff/media.mp3" length="144718131" type="audio/mpeg"/>
			<guid isPermaLink="false">6718191430187dfb6c8d2dff</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-man-needs-to-eat-a-banana-before-sex</link>
			<acast:episodeId>6718191430187dfb6c8d2dff</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-man-needs-to-eat-a-banana-before-sex</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe5yIEWmH6gsKOKKcbNmGoJTSvyOKmwPKuCEUtAuQStEiEyQVjAOj5LbynwDaoQ/m6gMVuGxxd8exOeOPgFer24HGpcXxetEXRbq/XTq62s4E3fnD3hvPUloAv94UKk8CAkmSSL++g9Wlm9afsERn1KUBMd/BBPtkPzK/z7Hmv7UayVMu9Uo1hVCcl/ENN9WC5PGon5+UId5I9WTp0kFygJ3xjeqzXkwmTROiAMaBZEsMUW37+PK8Xuk5DvWbFmyYAUyjK6LRlFq0uUVkaMDjkg]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>270</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Am I just not getting the message???</title>
			<itunes:title>Girl Talk: Am I just not getting the message???</itunes:title>
			<pubDate>Tue, 15 Oct 2024 23:00:58 GMT</pubDate>
			<itunes:duration>1:17:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/670ea8367b5979efddaf7452/media.mp3" length="152203723" type="audio/mpeg"/>
			<guid isPermaLink="false">670ea8367b5979efddaf7452</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-am-i-just-not-getting-the-message</link>
			<acast:episodeId>670ea8367b5979efddaf7452</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-am-i-just-not-getting-the-message</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe2/IJJvHsdmx5YnZnApoIXDS5UlqgbmCc7knl0WTnvc62ug/iiaR9I1rRQKz0iwpT2WWixDGHLfQnne6liWpwZnVpTi4DaFSZMUCAkns9IE1Nr9ertW4Xcx4Y4Z4GCmj4EzXibR95bemhWEArKvhtNwfFydzFJxrLLsiPoWXKSIq+LiI2H+KlKaFZDIbns7M3u3bybxGo4hXqE26EPduiiGF66DOpuCXASatZ/+xIDYkfXzBkskCGxix5zNw1iywgmbjKPn4wERE+E4EwuG0So]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>269</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: He doesn't even know I have three holes...]]></title>
			<itunes:title><![CDATA[Boy Talk: He doesn't even know I have three holes...]]></itunes:title>
			<pubDate>Tue, 08 Oct 2024 23:00:33 GMT</pubDate>
			<itunes:duration>1:19:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/670555baed8ff5205eeced5d/media.mp3" length="156288094" type="audio/mpeg"/>
			<guid isPermaLink="false">670555baed8ff5205eeced5d</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-doesnt-even-know-i-have-three-holes</link>
			<acast:episodeId>670555baed8ff5205eeced5d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-doesnt-even-know-i-have-three-holes</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcHxboZWgh2iFLDaljg7o0ZQJ8DEHr04j5quQyCnUDzRsP2+200lB4dbv7vRcndpBLwHLgtBKYNE+HBGpamw6Llx4LUgs7zM7vyk/WWTF8+HA4D8L5BMLNzI2xoWbCUWjDXrrCiQZ3UWOSw2MLgcT7/KWGzVNM8joNNusPo9wFtKQ2wXLv2LBGiEEayCWrFIoiRPrj0fdaMCG+JYygFuk/6NR8qQG8ea+j6iZZOrpZIjBTnnC11D1OJu85589y45T2fBrHBumR1nR+6hOjbhgAN]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>268</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I’m thinking about plastic surgery…</title>
			<itunes:title>Girl Talk: I’m thinking about plastic surgery…</itunes:title>
			<pubDate>Tue, 01 Oct 2024 23:00:47 GMT</pubDate>
			<itunes:duration>1:06:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66fbf8e2cb6b8e9ccc30a6ca/media.mp3" length="130158148" type="audio/mpeg"/>
			<guid isPermaLink="false">66fbf8e2cb6b8e9ccc30a6ca</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-im-thinking-about-plastic-surgery</link>
			<acast:episodeId>66fbf8e2cb6b8e9ccc30a6ca</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-im-thinking-about-plastic-surgery</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcxQ3TZOqfTG84YO6fbrwArLUau2CZIiweUsaxWWi7jj91x+vsLOaoyEnlrRfo4k3nFhwmoeapQSA/5SqHTn/aJKXsJjLOEeJew6Fhv+hpzfryAOfiikGUeTmZO/EndrdT5MGsqgfaMzjZeVzv0jOGGqygq34948P4wlMoUJ3Icw5NrkXGpI0AIvk7+HEB1Qn04exizo9fS9uzoUbSNEs2N/Y/7SfMhlgVCAMYUm4X6vXe3cSvYBedAu+gjk11GgymPjX7S3h8MdvlYvryh6mka]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>267</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He says he’s on “semen retention”, huh??</title>
			<itunes:title>Boy Talk: He says he’s on “semen retention”, huh??</itunes:title>
			<pubDate>Tue, 24 Sep 2024 23:00:20 GMT</pubDate>
			<itunes:duration>1:02:25</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66f2f990edf5e82f6058f64b/media.mp3" length="122082700" type="audio/mpeg"/>
			<guid isPermaLink="false">66f2f990edf5e82f6058f64b</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-says-hes-on-semen-retention-huh</link>
			<acast:episodeId>66f2f990edf5e82f6058f64b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-says-hes-on-semen-retention-huh</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAnZTIul+hn3pG00ji/9ha2setBb6Dc/OBRMiZWpRAYS+uCo7LU/fihRvGb7olGM8vs8RLQvA+899eaY3NBchw5zJLFUbekycIQWfUA5A2wNV5ZLZ7et5fDWckQSA1/Os2icjiJY4PSSH+rcqywosvXAJCk0QArUlZR3m/tHt39zaBFfZH5KTSFL9wf/DlsqXCX9uvFzSqM9ef1Am27V6FwPOxLBW7daaOAdokU42lwWx]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>266</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Australia and New Zealand Tour tickets here: https://www.tegdainty.com/tour/thegirlsbathroom/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: How do I stop all the self sabotage??</title>
			<itunes:title>Girl Talk: How do I stop all the self sabotage??</itunes:title>
			<pubDate>Tue, 17 Sep 2024 23:00:59 GMT</pubDate>
			<itunes:duration>1:06:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66e9de924ea065d8505de39c/media.mp3" length="129606290" type="audio/mpeg"/>
			<guid isPermaLink="false">66e9de924ea065d8505de39c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-how-do-i-stop-all-the-self-sabotage</link>
			<acast:episodeId>66e9de924ea065d8505de39c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-how-do-i-stop-all-the-self-sabotage</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAvjATrdq+e9K9k2qou0V6GLBgC8Q4SqwjDDs/xKndsvPhpHoj3uGNN70ZLVX0R5wHWrhpPmd+iBGmVTGEfRob8p/m97I1cOhMRgJrmSj/w+/w5bOWzYG4K/izqRuaa4lNEKb/g08ZPDW1CkQg4ByjXb1ilhZ2GbimF6kLwCm/UOpwQ6XYtNEDjVjPOD3MhY9Q/K9svg1RxD8Uw/pYFrlvjmP7jBsGyBVy9xfNtxVKi4D]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>265</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: He doesn't go down there...]]></title>
			<itunes:title><![CDATA[Boy Talk: He doesn't go down there...]]></itunes:title>
			<pubDate>Tue, 10 Sep 2024 23:00:57 GMT</pubDate>
			<itunes:duration>1:14:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66e08792f684e0b75949e664/media.mp3" length="144778446" type="audio/mpeg"/>
			<guid isPermaLink="false">66e08792f684e0b75949e664</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-doesnt-go-down-there</link>
			<acast:episodeId>66e08792f684e0b75949e664</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-doesnt-go-down-there</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfMsYn0SDzaxMfPXz0yHUnERRW8BfKX7cr6uoZUXN9IsMZSDzPzP8HhzhCM6lm5oGTb9ylQALDipb/mxOTZv0M3FLJQrVzS4pzeYzTPCs/PuBfN+CnlkyJ72dInFhtMA4BfjxLnDnwK6d784CEGgfqC20GV7Ebn0GWLfINkedcEZBphNrrcMk//AHKeotGnTJWXWK3607Us3vlcS4yrHTKXhqMhW56+c6Wjw9K5KEokZz8NDLBi5AsVeN3KAVa3WyJRIyZJaDQfMssWJwEOVYCD]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>264</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Is his REBOUND my new bestie??</title>
			<itunes:title>Girl Talk: Is his REBOUND my new bestie??</itunes:title>
			<pubDate>Tue, 03 Sep 2024 23:00:14 GMT</pubDate>
			<itunes:duration>1:00:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66d72b0091ae4d209b2e693c/media.mp3" length="118308281" type="audio/mpeg"/>
			<guid isPermaLink="false">66d72b0091ae4d209b2e693c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-is-his-rebound-my-new-bestie</link>
			<acast:episodeId>66d72b0091ae4d209b2e693c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-is-his-rebound-my-new-bestie</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfptY0be/qo6Ol1y3rBR2i3Rkt2TuWCwXekxjrLSuelRT2HFji7/wcN0EFov7SEKxw+Q+6dvMZN9V7iS1vsPWIHP6ml1QNCOFnnMEEaOadG5VYMS/POn44h5ep2tvPR8rBe87Zm184+khU8jywfHPUfdM4L5tkwhZCD3z2sM2i+/UfJFLIhSmHIzgL9EIrSpjp9PmfzifWzH0JhUqQhtOVEY894pdENeNT659a3/EDq5P7sK7rruxE7i8zjOGH+f30gPbjINsM6lOaxVD5XjUiP]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>263</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My new neighbour is MY EX! Yikes!!</title>
			<itunes:title>Boy Talk: My new neighbour is MY EX! Yikes!!</itunes:title>
			<pubDate>Tue, 27 Aug 2024 23:00:44 GMT</pubDate>
			<itunes:duration>1:18:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66ce2d9dbcb96610c589d9ce/media.mp3" length="154134706" type="audio/mpeg"/>
			<guid isPermaLink="false">66ce2d9dbcb96610c589d9ce</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-new-neighbour-is-my-ex-yikes</link>
			<acast:episodeId>66ce2d9dbcb96610c589d9ce</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-new-neighbour-is-my-ex-yikes</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAqgxiHqOuBdMgatF3MgbXMtERHQFiylt8BO9f6rNVUwUoJlKG7RtR+9Ejdc08xo3kqvz98qdktoT9Atbl8IHSQWTGW0fa1zbIvo96Q91pLVFwrtn6B85eHu7kpkz9t46VWUN6eg7gBrZdFyYyxjQW6rDvnzDxNnWSP4YOCCekC9EUZO5qcVGqG6YCylsSzEVX8P5KodoqE7XMUQDGVTFZF4Z/1Z4ddJTSr4eOXfTDD9A]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>262</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: She put WHAT up her bum??!</title>
			<itunes:title>Girl Talk: She put WHAT up her bum??!</itunes:title>
			<pubDate>Tue, 20 Aug 2024 23:00:01 GMT</pubDate>
			<itunes:duration>58:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66c508ecb6f1efc262cd9827/media.mp3" length="115290405" type="audio/mpeg"/>
			<guid isPermaLink="false">66c508ecb6f1efc262cd9827</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-she-put-what-up-her-bum</link>
			<acast:episodeId>66c508ecb6f1efc262cd9827</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-she-put-what-up-her-bum</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe2/OdGOXe3KxemtHzstMYD+6Av9DNPMTVkg/4ZA1DcNAmE2oyymr/naag2Vy2yEphAjGW1L8cztHYIN0/v6MuN/oGZwoVkkAWc5k3OWvh4ue6BL/50zRJ73901yQ2Yj1doXz0dSF20O836goppyEjawiCMYlhQQ4585KJ0FwTRiWUWORxWaSmL1oPirE1nCz31jispfPfXLIQcUXfyb9gMVcgorXfLCwGBqfMi0y5aYGwgXGR5jpFySfAFAH54cD+wIjC6V4007WbP3SptBPzU]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>261</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Help I Stumbled Into The Girls Bathroom</title>
			<itunes:title>Help I Stumbled Into The Girls Bathroom</itunes:title>
			<pubDate>Thu, 15 Aug 2024 04:00:05 GMT</pubDate>
			<itunes:duration>51:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66bcb1ade861ebb52b1f7c30/media.mp3" length="73676390" type="audio/mpeg"/>
			<guid isPermaLink="false">66bcb1ade861ebb52b1f7c30</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/help-i-stumbled-into-the-girls-bathroom</link>
			<acast:episodeId>66bcb1ade861ebb52b1f7c30</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>help-i-stumbled-into-the-girls-bathroom</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf3k/xFwq257L8nAH4JIchjj+d08C/T9vTYAhlCbCBk+nBrU09hSFofcnUX0jdxhT6Vw4I62t9qxEh5zJdQojPqe1hYh0kdjCRjt7JwlLQKOj8RByHPAYqQ7zkSItZXPnXi6LMXixMi8mm3w/Ef2iNLKXLHFuMyRKIseBaXZdwbEoXyqxSsDaViZHJ9Fb85Y2/ixncEUgSegAUeEtqju+u0O4pBN5JfDPbyRuM0ECm2/L2U21+WaBPVxG3Y5HpVLuC3GLFNer0axxOVhZpbezaA]]></acast:settings>
			<itunes:episodeType>bonus</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>260</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1723631076820-e31ae2d4-84f4-4762-b923-1a4941bb5d57.jpeg"/>
			<description><![CDATA[<p>Welcome to our first ever crossover episode!!! We had the pleasure of joining William Hanson and Jordan North from Help I Sexted My Boss to create a special collab episode for you guys! We're chatting about returning engagement rings, flirty phone messages and unexpected poolside arousal...</p><br><p>If you'd like to hear more from Help I Sexted My Boss head to: https://audioalways.lnk.to/sextedmybossSN!TGB</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to our first ever crossover episode!!! We had the pleasure of joining William Hanson and Jordan North from Help I Sexted My Boss to create a special collab episode for you guys! We're chatting about returning engagement rings, flirty phone messages and unexpected poolside arousal...</p><br><p>If you'd like to hear more from Help I Sexted My Boss head to: https://audioalways.lnk.to/sextedmybossSN!TGB</p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Who am I meant to marry??</title>
			<itunes:title>Boy Talk: Who am I meant to marry??</itunes:title>
			<pubDate>Tue, 13 Aug 2024 23:00:15 GMT</pubDate>
			<itunes:duration>1:17:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66bb39e1a7f4fbb991ea0bf4/media.mp3" length="151937237" type="audio/mpeg"/>
			<guid isPermaLink="false">66bb39e1a7f4fbb991ea0bf4</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-who-am-i-meant-to-marry</link>
			<acast:episodeId>66bb39e1a7f4fbb991ea0bf4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-who-am-i-meant-to-marry</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf28Wr4SWkC/+tNgzTlRwfYVltjSysDjtTzKfnuYFwxNEPp09fX/p4i2iGUaCyVP4QKMeDoci3AnLgAwVJSEEUgd18YVUV/rYoNBFrevlV9nIEhD9jxhfVP9cfTC7/rQYR6W3jmF3IVLG8iB1XKD/bEirvijq7V3NOYe4KMniyF7n6JT3fi40caNU49H8iDzQIvi77AUVYplGJeJ8rF2YmnMk7URjes53bW9Srs0qQRnj8wUq1h+M9MXCKbEX0oVpOdvhdmqzcn3nbxm3o8pqom]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>259</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Girls are warning me about him...</title>
			<itunes:title>Girl Talk: Girls are warning me about him...</itunes:title>
			<pubDate>Tue, 06 Aug 2024 23:00:44 GMT</pubDate>
			<itunes:duration>1:19:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66b223b25063c053df50c0af/media.mp3" length="155525149" type="audio/mpeg"/>
			<guid isPermaLink="false">66b223b25063c053df50c0af</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-girls-are-warning-me-about-him</link>
			<acast:episodeId>66b223b25063c053df50c0af</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-girls-are-warning-me-about-him</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf6pC86abrUKbDJWZa89m0vK3o9XNjNcuiqgCXE06FPKXNr7BYgj4KjI84loOM+DiB0GcujdX4h5MB3/fht06pUxM9zVZy8J1Hh61/yaXmccr5KjqL5BHqjym41LgVV0BWo6gb90OzcyVIwYXXuDezuSOfHXpuCNTVgZSrqsz73vJvUi0WjIqTFDo9HXIqAAMrIW3kkcUPCbE6eTMI1E6h5io5xHg4nTAUZdykjHBCbB/YdIXxK1casbPzrj7TKNUpWqMrpqmsmCwdinvx+1PBY]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>258</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He broke my heart, stole our business and LEFT the country! </title>
			<itunes:title>Boy Talk: He broke my heart, stole our business and LEFT the country! </itunes:title>
			<pubDate>Tue, 30 Jul 2024 23:00:04 GMT</pubDate>
			<itunes:duration>1:07:29</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66a773d7d334bfcbc496654f/media.mp3" length="132234943" type="audio/mpeg"/>
			<guid isPermaLink="false">66a773d7d334bfcbc496654f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-broke-my-heart-stole-our-business-and-left-the-c</link>
			<acast:episodeId>66a773d7d334bfcbc496654f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-broke-my-heart-stole-our-business-and-left-the-c</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdcBm25KeU05hL0You+nT42a6XBQct3d1D66RRa0MOgElPJrJ5DGSKpFaWRQsD6p20RYDF21eJ2W9kWRQhyHy/xUudedqP3bgwAq5VsHTykjTAeLwQwK1dSiT5ow96d9v2cQrBZwCZr5sDvTfUMp2XcvKc8kWw/kpVKS67l87soC4BXFzZQmsXO3y4tIksu+BKJpWZJV3aooo8r39Gc2x5It32lzAGs4rnKpuf1KWnZPYxCER3vKWxvPRuRuh2t7ZM+OFwxkq1xUiaT/GjezBDi]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>257</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: She WON'T STOP touching me!!!]]></title>
			<itunes:title><![CDATA[Girl Talk: She WON'T STOP touching me!!!]]></itunes:title>
			<pubDate>Tue, 23 Jul 2024 23:00:38 GMT</pubDate>
			<itunes:duration>1:21:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/669e47d93847f8c1a59b9819/media.mp3" length="160350016" type="audio/mpeg"/>
			<guid isPermaLink="false">669e47d93847f8c1a59b9819</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-she-wont-stop-touching-me</link>
			<acast:episodeId>669e47d93847f8c1a59b9819</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-she-wont-stop-touching-me</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdz5QuCaj9LaTsOTipZuuwxt5IrGX78vGvxHB5cHW4NJTcat/xwPVB0FY/BmT2XrvGlbTo6dQ5LxC8PJNNO5j2+BOELktrgxGzKBRz58e+5IzuZg4Ze8oZipnnE91Wrljuwf5RQroxtUFFEJtVBRcYYRavQpP23tm9jkBGck1Y5LnILyVekGdy37cDCj7nQIAGn+iaDyrSuadMzfGQTiux9bvDsONDJiErIouGiWlMkjq6lPQ+Z5LImuT1oE9UWny9ZBwy9NBjntXLOoGvdyPa8]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>256</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He HOARDS PHOTOS of his ex!!</title>
			<itunes:title>Boy Talk: He HOARDS PHOTOS of his ex!!</itunes:title>
			<pubDate>Tue, 16 Jul 2024 23:00:24 GMT</pubDate>
			<itunes:duration>1:18:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6696c0d213ea555fe357f3f0/media.mp3" length="153428781" type="audio/mpeg"/>
			<guid isPermaLink="false">6696c0d213ea555fe357f3f0</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-hoards-photos-of-his-ex</link>
			<acast:episodeId>6696c0d213ea555fe357f3f0</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-hoards-photos-of-his-ex</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeFXlPqSZkBrL+6R+2XxMDnwBlt/pJyMcrmETNQ7LkWwu8+J8dWDhA/ZpO/bBEI3M3lgcgno358Nf/RJsWuE1dSp5FQZhm88A5BqWUh7IHoUTtvhSjQA0d0DI+US44YEbd3h/sCAZiAw4oiGZkjxHTM0/D1bvUxIgVer+KtEGyJGUekQjsC9V0FfCvuXw1e4EEqq0vnslP/XpYKKbRoJy/1n+qjbzE4AOJd8N9ulAYM8CRjR5+0mte941pwXdPP99A+cALc00ecxD6KNMGjYkC6]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>255</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: She’s BETTING on my downfall!!!</title>
			<itunes:title>Girl Talk: She’s BETTING on my downfall!!!</itunes:title>
			<pubDate>Tue, 09 Jul 2024 23:00:11 GMT</pubDate>
			<itunes:duration>1:14:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/668bc01919ce290b0b02fbc6/media.mp3" length="146422616" type="audio/mpeg"/>
			<guid isPermaLink="false">668bc01919ce290b0b02fbc6</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-shes-betting-on-my-downfall</link>
			<acast:episodeId>668bc01919ce290b0b02fbc6</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-shes-betting-on-my-downfall</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCettsixZYCa0fp21uqTH4Gp1X3UTl3Ggmx+133sBgG1HS8Nqhooeaaph5pzOQdTFQAFnEhCe0jFlI2fWb1o3ZQRHKTGsCJ3Jjz/U0ZqkjOQma6uyHa1CIwlpSRVW1pBFMYV4zlZ2bIQHle8NmFRHP+QK4/4lMEa4fVDJvSISplSpymaoUpB04SW0+BcOkV4OdJEKDqBlNCin9PMz0f5CFP8hToiLLcqFDxYPGES6UfAytClJfL/RkpqDlT8lMXXn9PTyco9ek77+JUgJ9Czo+ap]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>254</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He WON’T stop watching TV during the deed!!</title>
			<itunes:title>Boy Talk: He WON’T stop watching TV during the deed!!</itunes:title>
			<pubDate>Tue, 02 Jul 2024 23:00:15 GMT</pubDate>
			<itunes:duration>54:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6683da309249f596b7fb312f/media.mp3" length="106601190" type="audio/mpeg"/>
			<guid isPermaLink="false">6683da309249f596b7fb312f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-wont-stop-watching-tv-during-the-deed</link>
			<acast:episodeId>6683da309249f596b7fb312f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-wont-stop-watching-tv-during-the-deed</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcYLSIiHB4LD29xviiO1Dg7M6T5eDp6q1Rhvw8LfO83BwO82u5HK2yKBYenJojsKRjXe7mTDzSVXjqtTE9WBeQ0ZH2At2yIY3ZI/kc8ajmkMCKfD8zqODIF8sqvE7/ruwEvEm5DdlGYNE/nmqwuJwl2qh36ygdnZK68PwgYyfAVbzbM7PBPc43FhLVtRdlgjAjNy2ndBDznvKgwfSeNuOP1oetOFgL9Nn+4kpH3Fx6Yo2uQJLDhXGAmXTHzpuZsKTuUa44y4zv0r2qvfasLTOYA]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>253</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Can I snitch on her? SOS!!!</title>
			<itunes:title>Girl Talk: Can I snitch on her? SOS!!!</itunes:title>
			<pubDate>Tue, 25 Jun 2024 23:00:05 GMT</pubDate>
			<itunes:duration>1:05:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/667b04c41436b9f0bc58021d/media.mp3" length="127809711" type="audio/mpeg"/>
			<guid isPermaLink="false">667b04c41436b9f0bc58021d</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-can-i-snitch-on-her-sos</link>
			<acast:episodeId>667b04c41436b9f0bc58021d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-can-i-snitch-on-her-sos</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd0OrX8betBPZnq1GLutDHEsYZTp7UrQN2LFC4gNDRlTqR+5u4cGzwERD0c02VAor7y99qkKR0kySdpVpmXd15A4t788WtF3SoiQ+Vap4EfoS1ON282nlNvseh/64gX/qN8MCjNJI16oPmoyfelZBE2xgWlv6odLBd+S9ZtN+/DXG5D2RCRmlsBR8tSbUPxk5JzuufLfWdwGMJQEFbYSeodnnamTqxEumQzTrbwEokNVDVI6avbqbsZogaG95s3ZnXiDVxJLBptHs3wJ5kyD1kr]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>252</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: She set us up, but now she wants HIM!</title>
			<itunes:title>Boy Talk: She set us up, but now she wants HIM!</itunes:title>
			<pubDate>Tue, 18 Jun 2024 23:00:53 GMT</pubDate>
			<itunes:duration>1:22:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6671be21aaaf802da84e0c18/media.mp3" length="162510641" type="audio/mpeg"/>
			<guid isPermaLink="false">6671be21aaaf802da84e0c18</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-she-set-us-up-but-now-she-wants-him</link>
			<acast:episodeId>6671be21aaaf802da84e0c18</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-she-set-us-up-but-now-she-wants-him</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfqDV1L0fWOYHaJsExuAPjaXJfFIUkdzJEr9CD+3etPUTwl2YatsxPueCT+mBhBi67r8NljnVeC0HyViYdRG+g352aQgI5J2MiyIWdv5C91/T/2XNkKPy7rd9/ErhD+SMy1TcdNAq6K9fwUX6icO1lDclA4IcZ9j+aYWcMTJxiJhkIQwg7XQRbWAw/vnAgn+hp5jze4wa00mr4nSUqCjXMBCPoLmGGYPXwyOI233Er88o+AC2DcEGPEzUMW31N1j/lLdA70tWiEAOzFNWFOojnP]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>251</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Help me make the first move on my sexy coffee crush!!</title>
			<itunes:title>Girl Talk: Help me make the first move on my sexy coffee crush!!</itunes:title>
			<pubDate>Tue, 11 Jun 2024 23:00:04 GMT</pubDate>
			<itunes:duration>1:18:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6666ebc0b831220011405066/media.mp3" length="154751724" type="audio/mpeg"/>
			<guid isPermaLink="false">6666ebc0b831220011405066</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-help-me-make-the-first-move-on-my-sexy-coffee-crus</link>
			<acast:episodeId>6666ebc0b831220011405066</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-help-me-make-the-first-move-on-my-sexy-coffee-crus</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdbxO0zQQSFfr02eH52Bm/pM4yEHnd7LOyltogheCwTKL7k5OJYbpXg19xQ9nncOornovoBUuAgyjWhoGrpGHlqeBJ28D4k8oN20RRpgxo0YksoZHC2a5gVrgHlBEVpIuHwh/x2S8vW+C+li7RSIFADV23QyIFUlOuhthuUYNlFQZHbfSn36eF20K21UE8qo8Y9rAaFwER2KOnEon7yZCbaOyx2LD742ngBE9GPKfbdBSThJ/YggFiDiLfxUVyuKxlLhN9Uie+6yRIdRBKkH4b6]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>250</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He GROWLS at me during sex…</title>
			<itunes:title>Boy Talk: He GROWLS at me during sex…</itunes:title>
			<pubDate>Tue, 04 Jun 2024 23:00:23 GMT</pubDate>
			<itunes:duration>1:03:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6659df87f95ef10011b1bd18/media.mp3" length="125333945" type="audio/mpeg"/>
			<guid isPermaLink="false">6659df87f95ef10011b1bd18</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-growls-at-me-during-sex</link>
			<acast:episodeId>6659df87f95ef10011b1bd18</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-growls-at-me-during-sex</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfZr1hi9VC/BDu9DBW67EQHrTbHuiHM4uehREGsQE68SrTYpmht/SB+wE2/vtYr7LFbCm2ybd/l6oE7BxQNS8YdFaj2wkezZOG7ys+1mgnb5Ld+36Adx0BWP7IAG49o+y/Zl5Y9Q02RieIqeu6uoE5frUsnN/53SbhMzwbRVmL5J7832YcLRgjQIoo+EM9CKjpMN1KqURNZFjZuwTRSjjrviCjRh7emfN3eN9JYJYL+h9e4LnAiDB7SRYeequQypqV9qQrcMNEqXj5u3oDjcaF5]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>249</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Hate that I feel like my SISTER is a threat…</title>
			<itunes:title>Girl Talk: Hate that I feel like my SISTER is a threat…</itunes:title>
			<pubDate>Tue, 28 May 2024 23:00:38 GMT</pubDate>
			<itunes:duration>1:18:10</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6655c26505d9ed00120577f2/media.mp3" length="153170168" type="audio/mpeg"/>
			<guid isPermaLink="false">6655c26505d9ed00120577f2</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-hate-that-i-feel-like-my-sister-is-a-threat</link>
			<acast:episodeId>6655c26505d9ed00120577f2</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-hate-that-i-feel-like-my-sister-is-a-threat</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfA1QTcq7xz6jNVKmGmw7aXCPT48KemtpX5ymAj5GEGvTjbcExvN2tyHTTIS+k3gvRwTuiXTOaj3D6fwNfmN53n2rjY6LdukA7eFwjhhNv/Kmmu+DopLIkXRG+YUTRuTanNh46U7C1m3ZKXwPZkG+q4JYm4fGHu0x1wPQWhUVR2jqz9x1/Gt5G+pu1bCUVx2XDGTe8n0PdgTvLR1if9yVhHdVqZW28ss44W8jED+t44jojxOAl+KdwRJ/M+7/fSw3VP6IAGeqwrNYwoLVclzoNA]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>248</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Is my boyfriend STEALING CASH from my purse??!</title>
			<itunes:title>Boy Talk: Is my boyfriend STEALING CASH from my purse??!</itunes:title>
			<pubDate>Tue, 21 May 2024 23:00:11 GMT</pubDate>
			<itunes:duration>1:18:11</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/664b238b2e12a80012126556/media.mp3" length="153287796" type="audio/mpeg"/>
			<guid isPermaLink="false">664b238b2e12a80012126556</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-is-my-boyfriend-stealing-cash-from-my-purse</link>
			<acast:episodeId>664b238b2e12a80012126556</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-is-my-boyfriend-stealing-cash-from-my-purse</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeoGNWfdQL+02C+CPBCV995nE/qzpIq4psj1I/D+xZrx+82Usum631YTXJ4zBFHGbH0ykvdM/bm4cA8KueiOU9ErQ/F5RjAukHppmdqVvNdZlaICFKIsOpLfvanzhsQiTrhi7HfMoU9yzG0mgQ9Gbx4W4b8rDgwzDG4pLY7tJ7CH3mwlUamJi6yGpyO/xCNFUnmpOu38NZZ/n6qoE1Hs3e/x5tmruUaQRmWjrXV9e+u+QHCYi4wZK/totuaO8MM6Pzdh4g8IifDUvFlzAwj6NCF]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>247</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>﻿Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>﻿Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Is history repeating itself??</title>
			<itunes:title>Girl Talk: Is history repeating itself??</itunes:title>
			<pubDate>Tue, 14 May 2024 23:00:47 GMT</pubDate>
			<itunes:duration>1:01:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/664367c4bc0a57001246d2eb/media.mp3" length="120696552" type="audio/mpeg"/>
			<guid isPermaLink="false">664367c4bc0a57001246d2eb</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-she-stole-my-wedding-dress-and-wore-it-first</link>
			<acast:episodeId>664367c4bc0a57001246d2eb</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-she-stole-my-wedding-dress-and-wore-it-first</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdBKKT32OsVPrNTi2i5iPWz5J1NV9nyxvZXsvZB/h9ou3r32sqxFSF3yCmY5m9dXcKMyTGrwwCPaBq4EpuynCCpHh/8wDIAB+jI01Dox0E94hElnm+tmn6qRAbdoKadHXoD8eagSkRzsYHx7qVJVaosnNKgEYXZq8sPNO7jPx2a9gAkk60IjTeWH4razaxLOuCrVVLCn/N1lGfkNZLXpCyXu1l9PUxsD2lUzthwLR0W1YTqeYGYzDsO1EID5qsi8ZGgt2ITMBXivgBcKYEXq3eH]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>246</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: A love letter from a ghost?!</title>
			<itunes:title>Boy Talk: A love letter from a ghost?!</itunes:title>
			<pubDate>Tue, 07 May 2024 23:00:21 GMT</pubDate>
			<itunes:duration>55:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/663a8b5a1a65230012c91460/media.mp3" length="80535434" type="audio/mpeg"/>
			<guid isPermaLink="false">663a8b5a1a65230012c91460</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-a-love-letter-from-a-ghost</link>
			<acast:episodeId>663a8b5a1a65230012c91460</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-a-love-letter-from-a-ghost</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCew8zghPeQ+CiQBirJllOGibLFQFctONQGjrCy51tG406PE4i82q4vintbCzY2MYlCtF7Z2FiAZRYmU+3X5ftSwMxH77Gto9PYOL9hUd2hDMNz/UWVmwwq+5mPGo9ZgqTK/XTF4YIcmR2PVXYJ9H9tlFH87PHGD/bg/uWIAUlxhZDQai7toXyRxl+I4/c2NNn8ugNoBg77N0Z+ITDhQc2qw+OrPlzw5Ok765Dw19gsebxFK7LOa43XYuSgfFlgM9LlVxHF6eq4okuUjx4q2lkDN]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>245</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl talk: Am I her enemy or her friend??</title>
			<itunes:title>Girl talk: Am I her enemy or her friend??</itunes:title>
			<pubDate>Tue, 30 Apr 2024 23:00:00 GMT</pubDate>
			<itunes:duration>1:13:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/662d044c3bcafa00120c5f7e/media.mp3" length="105226965" type="audio/mpeg"/>
			<guid isPermaLink="false">662d044c3bcafa00120c5f7e</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-am-i-her-enemy-or-her-friend</link>
			<acast:episodeId>662d044c3bcafa00120c5f7e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-am-i-her-enemy-or-her-friend</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCce4RMBpS49/DXakZo+EPROt4Z90qiQq4kC2upzfN62vh/FpIMR3JRbVoKzypzaS4DUBCptpAakWcoKYpVahc4HZgu1JnSneGBa+eCD1sP0NMbBArE0arLTWl5kHSIZ/NWqtS2I+L5bKd7pXMk8vHtMiTWkmlx8LA9PL+257gq8gelzo4RkSSGhKqYG7ii1TZljfQrKPD+h1u+F3C/wY73VHUAPfhRxX3P8oAe7SAlenLNtFNXW59UVwkcoqFbaaXHevnUvCOETg/XmTgj9H+/P]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>244</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/ 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: His WHAT was in my mouth!?!</title>
			<itunes:title>Boy Talk: His WHAT was in my mouth!?!</itunes:title>
			<pubDate>Tue, 23 Apr 2024 23:00:39 GMT</pubDate>
			<itunes:duration>1:19:10</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66266e6d9d2d8d0012139985/media.mp3" length="155032994" type="audio/mpeg"/>
			<guid isPermaLink="false">66266e6d9d2d8d0012139985</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-his-what-was-in-my-mouth</link>
			<acast:episodeId>66266e6d9d2d8d0012139985</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-his-what-was-in-my-mouth</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCc3i/dmEeQPHIwhKway19kTuBCvVH/kuaQs/k7Kx41EgzKv5B2UQpxJtJYS5j7bDXoIlP8up915HhM4hl7K68AYLx/IK+efAEiBEJhOog5HDixpi0tlNr1+/EzmqZWYjw8LtF1JUxEIvzkChPEYOCyVEd9tr9eDgQIxGjadpaDnCiOF5wJr6NRSOHElKFGunTDlcaQ6jGLSi6odWRZOROQzu3lGm7fojlL6tWEz5MXhgTSGMkXazcL7FF/CEyQdW38gF8ILpn6+ES9fPHhe8sZn]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>242</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: She’s turned everyone against me!</title>
			<itunes:title>Girl Talk: She’s turned everyone against me!</itunes:title>
			<pubDate>Tue, 16 Apr 2024 23:00:18 GMT</pubDate>
			<itunes:duration>1:17:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/661598ef2178ca0016a35589/media.mp3" length="111049985" type="audio/mpeg"/>
			<guid isPermaLink="false">661598ef2178ca0016a35589</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-shes-turned-everyone-against-me</link>
			<acast:episodeId>661598ef2178ca0016a35589</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-shes-turned-everyone-against-me</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCftvNuVXEciD+5NI6jWS/Kz1X8RucQtiPBonKx/cdHVu3BDhM0rIFQTUUSvDpSmrnWE0a46kqkc70zWGyxEBPnH0a3SZUbK6ESP3+g0wtLhohM27stMnZXz2TEFQ8W5xBVvg4haxOzCPXIdDMbZ1vPltCgad1MUmIfimYMLs4fj9WukySYQZufiOiy4BxVpMXv3VxSy8s7aU9ltaMPdtpQKX/L0obsgRJOVlZGaKa8XK4DOxT8PGlBFC3qY5XvbSD4hVnVkQQCXBAB7FkGud775]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>241</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Hate that I loved the chemistry…</title>
			<itunes:title>Boy Talk: Hate that I loved the chemistry…</itunes:title>
			<pubDate>Tue, 09 Apr 2024 23:00:22 GMT</pubDate>
			<itunes:duration>1:12:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/66156ecdecab3b001615c815/media.mp3" length="104971773" type="audio/mpeg"/>
			<guid isPermaLink="false">66156ecdecab3b001615c815</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-hate-that-i-loved-the-chemistry</link>
			<acast:episodeId>66156ecdecab3b001615c815</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-hate-that-i-loved-the-chemistry</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCc38TzOD7Tx9ayt9E9RrzOdVFAel4ctLwAROjBmgd1XN7nFCSHXdg0G3hJpnUkMsvjBuHUoD0BXTwTGeJZ6BgnLLK+pqmU4rZW9ZUhvp0KG5/4j+6ZPeoK++h4QF09apXITG3n++TIZ2q2F+7mLnkzuLSyph43V1cu+XyMPzVc+u3kTa5kbP5+7mmwOrTasOKjIyN4JeXKZEqN5hEAspacu5rDLUK8pPInzxxN5PXOSofk7uNbsNcsfCXz9AVZCLs+t8y1KoO/jrcdgUkAp4LSz]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>240</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I gave her money, but I want it back!!</title>
			<itunes:title>Girl Talk: I gave her money, but I want it back!!</itunes:title>
			<pubDate>Tue, 02 Apr 2024 23:00:34 GMT</pubDate>
			<itunes:duration>1:24:29</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/660c147109a48d00160bacab/media.mp3" length="165253430" type="audio/mpeg"/>
			<guid isPermaLink="false">660c147109a48d00160bacab</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-i-gave-her-money-but-i-want-it-back</link>
			<acast:episodeId>660c147109a48d00160bacab</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-i-gave-her-money-but-i-want-it-back</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe7OMca9wMYxZ3WrJJ79u/kkrbj2b+f84t/DmC7kRyi9ViOckh7yXyWeM65j/jnYvXsBT63NB9I1tWvK7eJTOia/8N80BCSCrI0d66CHrZ0+O5PFNF/mwX27J9J/XxwnkgE8/TzoZLX5jIwE1p1khaUhNUrBBs2oIzv/t+YVqjCC4ALtwIBcQQ+gjCmou8kUfpn2tX3b14HWX99RHRb7uhJV2Ixf3gM6iBVMPcsp0DzdTLsAIfREeTJ1EXntPmmuDVrgAp7Ed41Pac8oGdG0zYZ]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>239</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My man tickles his friends…WTF?! </title>
			<itunes:title>Boy Talk: My man tickles his friends…WTF?! </itunes:title>
			<pubDate>Wed, 27 Mar 2024 00:00:23 GMT</pubDate>
			<itunes:duration>1:20:39</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6602b167bd54ca00166fba11/media.mp3" length="116156963" type="audio/mpeg"/>
			<guid isPermaLink="false">6602b167bd54ca00166fba11</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-man-tickles-his-friendswtf</link>
			<acast:episodeId>6602b167bd54ca00166fba11</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-man-tickles-his-friendswtf</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCehmgDauHumIFBBoHFb+gwTPnAcQ73DGF14zJmKnU0Zpd6zcUVk88aemaxkxRTDaAeHal50WllaPYlGt8wAB9fBV11qv0yfICO26jILdPke9o5Svy6xznic7AZkT5F36edCmND2quJials0BkGeh8LH/JII0/TSZlKK8XSKmpvsbnPLIEQhrzl/mmWtd0xGgp8Nqs5PESn1RlAF/ZUQDXyKGQkds48PmuF89n1xGi1agPyeIiYwVA/umGSfrzpjW+0ttCL9ung1DpLFJWCm7N8Z]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>238</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I want to look like his ex…</title>
			<itunes:title>Boy Talk: I want to look like his ex…</itunes:title>
			<pubDate>Wed, 20 Mar 2024 00:00:18 GMT</pubDate>
			<itunes:duration>1:20:46</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65f84112d0f3e000169207cb/media.mp3" length="157882166" type="audio/mpeg"/>
			<guid isPermaLink="false">65f84112d0f3e000169207cb</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-i-want-to-look-like-his-ex</link>
			<acast:episodeId>65f84112d0f3e000169207cb</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-i-want-to-look-like-his-ex</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdT1UxH5MGaXMNQU8OvB7XiLKlZjjJjTsB/yf+VtfPlXNq+6JR60nclUNUKo0mHEEzsvQg41xrZZOKXh8WZIWkBwOa5ZihPAtnzhP9B/BXqs1w8aVCfUWYTD6a4iBR6Hq4DIOIOXH0QVsmEdLAw/H4HGipvQhB90OcbJWZG+yTmCy4s0WbiRZmHqv6oKo0JKqbtVX2qIUw6yZaSqEk+ImO+3Fc8uGSKRTI6L6FIFSZHmK+YU0fKLpCsP01PTRL/NrDyhyCdainfPy08I8Ee0wc0]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>237</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: She says she’ll LEAVE me if I get lip filler! </title>
			<itunes:title>Girl Talk: She says she’ll LEAVE me if I get lip filler! </itunes:title>
			<pubDate>Wed, 13 Mar 2024 00:00:50 GMT</pubDate>
			<itunes:duration>1:22:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65e71a36d6ce1000176628e1/media.mp3" length="118765673" type="audio/mpeg"/>
			<guid isPermaLink="false">65e71a36d6ce1000176628e1</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-she-says-shell-leave-me-if-i-get-lip-filler</link>
			<acast:episodeId>65e71a36d6ce1000176628e1</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-she-says-shell-leave-me-if-i-get-lip-filler</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfrs3wbRdEac0shHiaoyj/2ZS/iCaw8jW75nT+N13O9vU1SZ6vfZX8IN/CotsaftJ+pFWtrJkh8QeEqufmBmD7s3enDRY0z/lsO+CpvlsagSa1XdHlpqMbmL1oxnOjBwNEinrArE+3TdhFWQeCWYFCxHG6CT1yUSRjshqH6joZwb5Zm3QM6Fa8jxx3GOrM68o1RogRW/cvOoWU7fAvTx3GJhwfGH7fMTa8jK9LmADUS0SGW/fuwYY9o4Uhea/uMLEfWOV+8kQtYDjPAGgfLAWFx]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>236</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He BLANKED my NUDES!!!</title>
			<itunes:title>Boy Talk: He BLANKED my NUDES!!!</itunes:title>
			<pubDate>Wed, 06 Mar 2024 00:00:23 GMT</pubDate>
			<itunes:duration>1:21:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65ddebad5422320015e2cca7/media.mp3" length="159928980" type="audio/mpeg"/>
			<guid isPermaLink="false">65ddebad5422320015e2cca7</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-blanked-my-nudes</link>
			<acast:episodeId>65ddebad5422320015e2cca7</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-blanked-my-nudes</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCflysLkvY1KF8s0EzpVTW6WeZwKbEuXcCJuS+prplRF3+m2wzfBTWt5gpZalr4a3Pb2X3LTseNdk2sWiQDa1r6ajhrdhEhlJ2LTAbynklzy4PaTq7Skj+vdj+wj+pBUIsxI3+OhiONBBdM7iRZllqLKkNkROcH8JYN+k1x9uHIMY6WpEMxD6ZqfO5e358AmDbYnylBGMrL1TETDpp8Hhr+zPxyRGb9wukn31ajjIK0hsMkTRPhbXqs+MNvnOLaWS7Cyees13DNOh0cRLU1e2HcA]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>235</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: We NEED to un-invite her from her OWN birthday!</title>
			<itunes:title>Girl Talk: We NEED to un-invite her from her OWN birthday!</itunes:title>
			<pubDate>Wed, 28 Feb 2024 00:00:04 GMT</pubDate>
			<itunes:duration>1:28:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65dc8e94f73d47001601549c/media.mp3" length="172267942" type="audio/mpeg"/>
			<guid isPermaLink="false">65dc8e94f73d47001601549c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-we-need-to-un-invite-her-from-her-own-birthday</link>
			<acast:episodeId>65dc8e94f73d47001601549c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-we-need-to-un-invite-her-from-her-own-birthday</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeklzJiJ/cqMlbaGLWXvPsjhqk/NqUiR8Og+Ui14sOF803JFx1FWFu1AN0qEoOk5HfeqBmxNOCsrFiCXXMgs5oVkzyuFtGLUhqpcodoD1jYzEpI4NHpWD8w6+mtgnZosQHmKxwjPnPI9GxXLQtwfLN/qJi/SpHKajU6sp4bQJv7ifMDfFKU/KEKeHUT/086ep3lPcQvAsG5ABPoscHCiAxkpCYXufCvPs8f93Um2NNv9VnOh6oYQh1ZybWJjcNSO1RxKHpHubr4XJAsPykKApg9]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>234</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He’s spending a FORTUNE on his girl bestie…should I be worried??</title>
			<itunes:title>Boy Talk: He’s spending a FORTUNE on his girl bestie…should I be worried??</itunes:title>
			<pubDate>Wed, 21 Feb 2024 00:00:47 GMT</pubDate>
			<itunes:duration>1:19:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65d33978884f850016e33a4b/media.mp3" length="154905227" type="audio/mpeg"/>
			<guid isPermaLink="false">65d33978884f850016e33a4b</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-hes-spending-a-fortune-on-his-girl-bestieshould-i-b</link>
			<acast:episodeId>65d33978884f850016e33a4b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-hes-spending-a-fortune-on-his-girl-bestieshould-i-b</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeVgxlEiQPoZn/5L59NbhcgOPLi2LwuQUUDCiM7abAbkAa8rK+zcNLRlK0y6+yF2kZvh1EzSTXvIIxVyK7u5/psuoJjilTTZULoEMfwXeu0qlUUvRIgml2si8H/idDhNY2ixNu/vUTIEk+5VAsSmPh1qRtGG1+Z/VSnilVPxH/ZHFw0pw5gc6J+Z8cfncuA41doXXUt6JNnWFNypcsdr1NXJ1RfowFgRA6yfqROGjmtfCFaKrZy+999KXE7i6sQyYDVP01wlCKs+QoqkZEzn//h]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>233</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Tour tickets here: <a href="https://protect-eu.mimecast.com/s/kdwJC0RjyCg0Zn1twh6i6?domain=tegeurope.com/" rel="noopener noreferrer" target="_blank">https://www.tegeurope.com/events/the-girls-bathroom-planet-tour/</a> 💓💓💓</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: He’s SO anti Valentines Day, WTF?</title>
			<itunes:title>Girl Talk: He’s SO anti Valentines Day, WTF?</itunes:title>
			<pubDate>Wed, 14 Feb 2024 00:00:21 GMT</pubDate>
			<itunes:duration>1:16:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65ca02822cea4f00176b8c25/media.mp3" length="149613745" type="audio/mpeg"/>
			<guid isPermaLink="false">65ca02822cea4f00176b8c25</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-hes-so-anti-valentines-day-wtf</link>
			<acast:episodeId>65ca02822cea4f00176b8c25</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-hes-so-anti-valentines-day-wtf</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcs9KfESleuZ3TbEwCOXFy14j1sHKTXcGl0bvxS22E/EiZV+qxW2q/K1v0XNP+dOLWIL9xKrZgMjrExo4MSY+mwCCam3vZbhsdpXDj14iVS2XE/QZaeYXkoUZoTcIYbr9pBWhyQ7PS8T8UOwZO6xg7sQeZ4LPckNnvP++7TYUkzsHluQsKKxmZRJP4swFCyaYvTfX7h1HmTPrMWM7h253SEmgIKx9ewvyXZ9Xjd/fmvf/sqTzW0JvvzNtxupltnytxNK3pxwZzSzkKYEQCGr3FG]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>232</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1707919496553-b1153ae14bd01e9f469f5ab392dbc5c1.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Did my boyfriend buy my bff LINGERIE??!</title>
			<itunes:title>Boy Talk: Did my boyfriend buy my bff LINGERIE??!</itunes:title>
			<pubDate>Wed, 07 Feb 2024 00:00:33 GMT</pubDate>
			<itunes:duration>1:24:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65bb7d74b0413400161fc9b6/media.mp3" length="165220274" type="audio/mpeg"/>
			<guid isPermaLink="false">65bb7d74b0413400161fc9b6</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-did-my-boyfriend-buy-my-bff-lingerie</link>
			<acast:episodeId>65bb7d74b0413400161fc9b6</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-did-my-boyfriend-buy-my-bff-lingerie</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcoykI+oGF/AxmLiTa0K0VERcEk/KAi+lSZe0EnKsQy20WQt8YmBW6hxIYqkApYvqmGXolMtBd2GB3X94UnNcOAuG7JDdeCbAmGrMeQbS8udw/2C9TpFaT+Nt5Y33HyasBcAXW3zDac2oqrVFSqJFh1fTLZzS9BRylxRXvDul927nelRP48FN8xCVAheQgeBhUIV6inj7Y/psoHc+JaIiZra8O2MiRA0ZfsQubFU6NohCOLHUo95SWwlC1dsnacUljbTdaUM3jmrATqbJJvr3X2]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>231</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: His best friend told me she’ll always be number 1...</title>
			<itunes:title>Girl Talk: His best friend told me she’ll always be number 1...</itunes:title>
			<pubDate>Wed, 31 Jan 2024 00:00:06 GMT</pubDate>
			<itunes:duration>1:29:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65b3d4caa2246e00173c56bb/media.mp3" length="175228219" type="audio/mpeg"/>
			<guid isPermaLink="false">65b3d4caa2246e00173c56bb</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-his-best-friend-told-me-shell-always-be-number-1</link>
			<acast:episodeId>65b3d4caa2246e00173c56bb</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-his-best-friend-told-me-shell-always-be-number-1</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfqnYrCpLPP3jNB1OhxCrm3GyxIgDEIb6Cmce0oSoyvbbnMhLyZuEwd2q5vbA+RpvEJsYaFMlj+NT0008gF4obDDug01yI7xfgcNn0F/sTNMpLn+G0DxXq62j7wMPRyEEUvut0Yc9EJCyx+AVTj+vl9MSYJ2jvR8Cip+h46mhTNPU8Ohhk1nTBuYYuQ1JoMdLNGNVO3TUGq22EzsB1Uw79hwecfKuKNC0gUFzSf4GTg11fsWlBtwkHzJgdDwPqClOjMBfKHaFq+epUwVmGHM8zq]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>230</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He’s cast a spell on me!!!</title>
			<itunes:title>Boy Talk: He’s cast a spell on me!!!</itunes:title>
			<pubDate>Wed, 24 Jan 2024 00:00:41 GMT</pubDate>
			<itunes:duration>1:35:29</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65ae710d6476120015b4821c/media.mp3" length="187029596" type="audio/mpeg"/>
			<guid isPermaLink="false">65ae710d6476120015b4821c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-hes-cast-a-spell-on-me</link>
			<acast:episodeId>65ae710d6476120015b4821c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-hes-cast-a-spell-on-me</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCceXZjc6Sogyg3ATQXsv9ZQfvfvFFvhLEoNVIFuL/i2z8EDFAAEXCDoEnR1PU4aHQEZRoR/21WfxwLfbo1i9EQmipfrkzqLJ08tQCT62si4Vd7z1J8EHUUIowWxWqHoUY5Sh4XqRRB9NDSNW9m6r/LKAJjU+0IknlztizlCreEj2ZsKT5AqwyF6l1c3n/BKwyQztBzJXhJ21/RHjQ12+bR2xm7e2cB+KhXMrUxqVyPFHm0FBZAu3rt4IxR1P9ra7KmBvu+dLNTkZ3Jn+ltBp6sl]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>229</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My sister in law is STEALING from me! </title>
			<itunes:title>Girl Talk: My sister in law is STEALING from me! </itunes:title>
			<pubDate>Wed, 17 Jan 2024 00:00:50 GMT</pubDate>
			<itunes:duration>1:12:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65a0603c74a39d0016b23156/media.mp3" length="141913790" type="audio/mpeg"/>
			<guid isPermaLink="false">65a0603c74a39d0016b23156</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-sister-in-law-is-stealing-from-me</link>
			<acast:episodeId>65a0603c74a39d0016b23156</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-sister-in-law-is-stealing-from-me</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd3tpt7GLMXS9tqLL8UWsOhWEK6NXTNo+Jr1AcSm0aM3G1caoUA9s6/HJtKYbcv91wf2VfpDbNX9lIFuGUaiv5paT3dkCKf7zRRaUI/kIjL39Y0i/+/E5U683AHPAkjkp/z1zgeknP7QWNYkPF1PAHd02nvzyRpoRLMWcqbtKPqILuYAEkz+sT2IygPHY+TbZFeBaVNk3X03eyqVJtpR31jFogvwTkmpFhmc467KwG8R4yz7wcv+LVn/g+Ju2fVaXxxEjRWh0a1SQvIBla/Siag]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>228</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Two guys, two proposals, too many options!</title>
			<itunes:title>Boy Talk: Two guys, two proposals, too many options!</itunes:title>
			<pubDate>Wed, 10 Jan 2024 00:00:07 GMT</pubDate>
			<itunes:duration>1:14:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/659bde350fbb890017e92a4e/media.mp3" length="107491437" type="audio/mpeg"/>
			<guid isPermaLink="false">659bde350fbb890017e92a4e</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-two-guys-two-proposals-too-many-options</link>
			<acast:episodeId>659bde350fbb890017e92a4e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-two-guys-two-proposals-too-many-options</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfTNXEf6ccLccKIotON6Xq2QukaBzj0DVr2BKr6hcjX8ITYZ7bMkNo0VIzWRHph3NVSVSIheNakJw3krIAdB8qDHx9WG9A8/53ovK96T2K3dc43WuzSlgJ7YN4p4ec3WmCxZGUXc5jaRdHwUVw82lAGKVRpskev4ik46kMxwsxi7GKe31diAVldr33L7me0pFU7c+jntkKrFHoHFGGjGqhUcialAhpuu4+HTnPXCbkc7XsLNkNwTubgMGfF74O6eacnyYXVVUeBFlBxrNbTDDKM]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>227</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: New year, new man!!!</title>
			<itunes:title>Girl Talk: New year, new man!!!</itunes:title>
			<pubDate>Wed, 03 Jan 2024 00:00:47 GMT</pubDate>
			<itunes:duration>1:13:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6593e9c0dcc46e00160cb003/media.mp3" length="105599342" type="audio/mpeg"/>
			<guid isPermaLink="false">6593e9c0dcc46e00160cb003</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-new-year-new-man</link>
			<acast:episodeId>6593e9c0dcc46e00160cb003</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-new-year-new-man</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcRiwu7wQ2bYhr+yEzmEyA8okZHSQ2xJMHx9Upv8rvPdMBWdoiZbHUAPRRBngOdsB5iMj71x8gZZLR74z8brUc33nFgqf6bDZ+9wHx7U0ydeAW26xte+En0LAxELCo/GnD+TJ5ydG2Ftmn/sbpnsk54wfvBM/73UPOOd7HP73lV9dadGoqI01u1imywN+/BEGZDXwva/TSd26A4o6DQaeW74WZOf+9NfHGXmme9nKHkv2c1sEoEjmKdf0Qi3Brfkkvd9fjlqCc72WMhsX06LCGZ]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>226</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Should I spend NYE with my besties or my Brian?!?</title>
			<itunes:title>Boy Talk: Should I spend NYE with my besties or my Brian?!?</itunes:title>
			<pubDate>Wed, 27 Dec 2023 00:00:51 GMT</pubDate>
			<itunes:duration>56:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6581a945f619370017cab5a4/media.mp3" length="111158591" type="audio/mpeg"/>
			<guid isPermaLink="false">6581a945f619370017cab5a4</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-should-i-spend-nye-with-my-besties-or-my-brian</link>
			<acast:episodeId>6581a945f619370017cab5a4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-should-i-spend-nye-with-my-besties-or-my-brian</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeVQeMnFeVy1RiWNg9WTGk7e9UKz5jGe14dop8rzsKgiwXmlWZ8/lqclTsAKtaTdylF+/xJk74cRKnIcAoRyn53wxxtaaXD+pmTg1uHGQFBqQrlrhTNbUsUf9ALqU5PjCjG+V/s2drUh4nYxNYXlAs1dH6eD0nOlrjx/69m9QbMV7iAMT8zI1qInlWhEovboXO5sO7oOyOf2vevMWvkYs9AwieHDh6j4Ky7DxVR/675QY69DrLMwfjeSG0JW0r9hi0fQ7KXxQTpUjJxpxMy5QNQ]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>225</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: It ALWAYS has to be Christmas at his! </title>
			<itunes:title>Girl Talk: It ALWAYS has to be Christmas at his! </itunes:title>
			<pubDate>Wed, 20 Dec 2023 00:00:23 GMT</pubDate>
			<itunes:duration>1:20:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6580319147124c001662d8b4/media.mp3" length="115792077" type="audio/mpeg"/>
			<guid isPermaLink="false">6580319147124c001662d8b4</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-it-always-has-to-be-christmas-at-his</link>
			<acast:episodeId>6580319147124c001662d8b4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-it-always-has-to-be-christmas-at-his</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeS1IeqHmH2iXM7Cw36LD2q+qiqy73kHedOAENGyL8eKrdbwoPOcGTFRCCjdiN6glbwdcTzOqUIgJb93ct72IlxxfoYo3YiwtmFIMlR7gUrKg+2S5cZoKhFsSf68ztfcMfTxz9glKB5kIr7tnDFd5XVjU0UrgmDai0vl+BgPj7allP8SDMEpqTTRqRLsAfGO4xE/1Kf8BO34NV9intMf7udlvFN7g+rd1hPIDjSgJTE09cEIUS6U83nZMIxqaAcO2SgGZOX4Q0iLYtOPCi+o4gW]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>224</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My Mother-in-Law is THE GRINCH!</title>
			<itunes:title>Boy Talk: My Mother-in-Law is THE GRINCH!</itunes:title>
			<pubDate>Wed, 13 Dec 2023 00:00:05 GMT</pubDate>
			<itunes:duration>1:10:45</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/657876b2cd374a0012c6d6ef/media.mp3" length="101910398" type="audio/mpeg"/>
			<guid isPermaLink="false">657876b2cd374a0012c6d6ef</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-mother-in-law-is-the-grinch</link>
			<acast:episodeId>657876b2cd374a0012c6d6ef</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-mother-in-law-is-the-grinch</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCceYcsX94tWIbY7SrwPK9S+XUeHG3xy8XQbT5pR1Gp25MsmUUl0FypAuHgBkURHNzHiOGdpq4xR8yQF0o40MUTIONDYiyPYdaZwZTCd1dWTWBQYWEUC5zjCDsVWH5c4q+6ft/X07GX194Xp3i7OVq84NOPveom554kXB5SAb3UK076Z7NJXge7V7oxC6aERMs4EDvio3sJ8++RCdodldfDFz+l3T23pEYgnwoPC8klAAK5vp3tA632pJ8E2HETK16KLYFsMMqsRUwtLB2Wc1JIQ]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>223</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Find My Friends says she’s LYING!</title>
			<itunes:title>Girl Talk: Find My Friends says she’s LYING!</itunes:title>
			<pubDate>Wed, 06 Dec 2023 00:00:19 GMT</pubDate>
			<itunes:duration>1:29:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65673f813beb5400123c1c16/media.mp3" length="128648121" type="audio/mpeg"/>
			<guid isPermaLink="false">65673f813beb5400123c1c16</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-find-my-friends-says-shes-lying</link>
			<acast:episodeId>65673f813beb5400123c1c16</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-find-my-friends-says-shes-lying</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfWq377yrFjz/MXBMu2CtJVuV8/lIlbSFr9jDCKd1xlvrVuTDpFDPM2rG0PIY4P0hmK0z1djvSI7g4p9N6Py1xgftq2G/CJbFaB2DM4uKLb65yLHgoAIM3yNHqS0C55cEKgMndK9weQXrhpmpdFTpDL8+vFf/8zP36Pv2z43TJ2NSoJu9SETBB9QRaAXeRgOkYp6rD46Opqcg5+uVlCC76u3yCEqyW4xwX7F1Crr8o4kqlTKrZhulI0uqT1pT0/i1wd8dGEi6hOW6xG9R6eyWRv]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>222</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: He's CELIBATE for winter...]]></title>
			<itunes:title><![CDATA[Boy Talk: He's CELIBATE for winter...]]></itunes:title>
			<pubDate>Wed, 29 Nov 2023 00:00:51 GMT</pubDate>
			<itunes:duration>1:30:18</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/655f4c7e254b680011d24655/media.mp3" length="176727126" type="audio/mpeg"/>
			<guid isPermaLink="false">655f4c7e254b680011d24655</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-hes-celibate-for-winter</link>
			<acast:episodeId>655f4c7e254b680011d24655</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-hes-celibate-for-winter</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdbYHJrPKCxVJe6pcapo9rccfCz7H5OBSaH2o8HmgCG4Lf5zMQqLUAAwRxmQEfjDD/FXyS9JRmCYVeYSmUpQBxAlKTGEo8efHOTvAKTfRmmsNTqRD9n0uiCNUAzA3pE7IpVfYB+MBliZLdsnLsxHgfrtwVGsqgfL31DXBnOBgk27Z5uGTYUN5FywHREY+TFVI2XKh7gTNC+UnnTU5dPzkPNfwiIXvCdPGls4UB582ZT8D8xDbbFFq5WR4s/T4BJXzEAEcmWHjsXjfzsTI6g7Cth]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>221</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: The foot fetish is out of control!!!</title>
			<itunes:title>Girl Talk: The foot fetish is out of control!!!</itunes:title>
			<pubDate>Wed, 22 Nov 2023 00:00:28 GMT</pubDate>
			<itunes:duration>1:21:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/655b427d4c0cfb0012a520fa/media.mp3" length="160093392" type="audio/mpeg"/>
			<guid isPermaLink="false">655b427d4c0cfb0012a520fa</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-the-foot-fetish-is-out-of-control</link>
			<acast:episodeId>655b427d4c0cfb0012a520fa</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-the-foot-fetish-is-out-of-control</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfdFoWdfdApMEAm8lFeI6r2LZq0vRaY6iP+mjyuDfkDKKssRtc+8fC4oenhh5vy/wyox2X9nwxtHUDDlpKm3I82oJ7q9mnnEQdS+H+1TI5eaNrRw/BfzsCju6yQX4oHV+o7hMdhuDAJKx5KmdWfFZ35xzRY9ykh9VmkTNfh6fpQLv6uoO5jqraSUg2Qpg+sSMuSiqvSI7WQWRmY+JaVAk6L6ojCUqO6Agpu6nEggiMd8XTeVyZdQPcenPddR7lwPmY+RjmIRqY7PCYMkxbXWoWS]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>220</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My boyfriend wants me to quit my job...WTF?!</title>
			<itunes:title>Boy Talk: My boyfriend wants me to quit my job...WTF?!</itunes:title>
			<pubDate>Wed, 15 Nov 2023 00:00:51 GMT</pubDate>
			<itunes:duration>1:07:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/655203e3bea4e6001119081a/media.mp3" length="131425458" type="audio/mpeg"/>
			<guid isPermaLink="false">655203e3bea4e6001119081a</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-boyfriend-wants-me-to-quit-my-jobwtf</link>
			<acast:episodeId>655203e3bea4e6001119081a</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-boyfriend-wants-me-to-quit-my-jobwtf</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfySzdIvA0d7oC+drQX/YWUPvHTv+DCTPn7r4L4x2tDMiLDzxit+rt0kzGfqi6epb0PNiG+javJd51szJPtUXvjqW7kHTUrRsWQoM8X7D6T3YMln1L7HXcEWZb6pxRsnw4WLnvBhQhEPWMlhDVw93eN0ZZ3feVJmhrW2E2jL19KOB4fq+0BYezHTv0NyFyM9bPDlbwe/vCj4x+VColrntQz0uF8nSRPlooJ0KPUO+7hyFXR9+8Uyl6gJM3FZ30I9y+N2J94KXbMuvln7AxeYbgG]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>219</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My TWIN wants my MAN!!</title>
			<itunes:title>Girl Talk: My TWIN wants my MAN!!</itunes:title>
			<pubDate>Wed, 08 Nov 2023 00:00:18 GMT</pubDate>
			<itunes:duration>1:14:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/654a73ddebb4400012177e57/media.mp3" length="107304716" type="audio/mpeg"/>
			<guid isPermaLink="false">654a73ddebb4400012177e57</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-twin-wants-my-man</link>
			<acast:episodeId>654a73ddebb4400012177e57</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-twin-wants-my-man</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcBh3LmI5Zw0AHtxsWoXjQetqPDQxDl6L7/YsfmTLIvpt4oxyLyfwqDEmxCfq6i1A/58TbN0PA49UOGKwLx9tSMX2494m3jYulJXXsCH1iOO+Cj6PGADDKeq8ddBeI+6EjZnViLrnpyimhpKoYONdWct1l75bdpKFS6CeBxCnMYKEedV8cx0bFjYU3X+9BWa72sEzKbeHl8FZkoAuKIc/pZ0ev91QePL4WK7lIz5TzLUEKbKIOz33QL4uWQY9OpEq+gDHJ5vafk60VARIVOxqOq]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>218</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: My Bestie's lock screen is my EX!!!]]></title>
			<itunes:title><![CDATA[Boy Talk: My Bestie's lock screen is my EX!!!]]></itunes:title>
			<pubDate>Wed, 01 Nov 2023 00:00:54 GMT</pubDate>
			<itunes:duration>1:12:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65412cbe88ac5400126178a6/media.mp3" length="141709523" type="audio/mpeg"/>
			<guid isPermaLink="false">65412cbe88ac5400126178a6</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-besties-lock-screen-is-my-ex</link>
			<acast:episodeId>65412cbe88ac5400126178a6</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-besties-lock-screen-is-my-ex</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdaty/mG5MokP9FMDXWzgBc7c9J6UqcG9x5+il8ElPR1FExh8WV0t96uFSZFTCjhztJ3g2Q6ayqi6HvxEsRncLiuzHbtn+b4+ytWDhtzvXIh7bfqKs5yp3B6aawQWpOzmcRm3O3q3Ku5vYTPksd2BEL2TEINswu9DwX3Y6zhRU79gjqCS8bhpRAJoTgLNsRF7vO5/8c2bN9fX9aAtW2AimF4D/NAIFdvZHxS1SItHtDeYqKJxnAcXaM1rSZk/MXfehe/8fU774bjIKb87T2VGO5]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>217</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I caught my BOYF in bed with a MAN!! </title>
			<itunes:title>Girl Talk: I caught my BOYF in bed with a MAN!! </itunes:title>
			<pubDate>Tue, 24 Oct 2023 23:00:15 GMT</pubDate>
			<itunes:duration>1:10:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/653643f6cabe910012f24154/media.mp3" length="100988387" type="audio/mpeg"/>
			<guid isPermaLink="false">653643f6cabe910012f24154</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-i-caught-my-boyf-in-bed-with-a-man</link>
			<acast:episodeId>653643f6cabe910012f24154</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-i-caught-my-boyf-in-bed-with-a-man</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfm5UpzwGSwHCam8ubbWvID3BYM8zKX8TpInxPOJQRY20OS2w3Gb79YBLU0iNdHtHX+Fcr894GpA9fKJHlPrYTA23wIIN62B2/8lgAisOAxtWBIbx+A0rhMbYGpsPrpZqT0xJYJBRidAaLW6bJ+S85WwV+YTwifKB8QAS+DeRI9bdPGLP/b35qW6bRi4fzv/RtAZrDTU3ZPY3QWDfTtrbXLuX57KAfYP3e3tlKOKEFvvY+i5nrMBB6j7e0aoByBnlQcq/5nWuDhW0RSFDcqdxyb]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>216</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: He's dating a GHOST...]]></title>
			<itunes:title><![CDATA[Boy Talk: He's dating a GHOST...]]></itunes:title>
			<pubDate>Tue, 17 Oct 2023 23:00:04 GMT</pubDate>
			<itunes:duration>1:12:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/652d3a74bf84120012c7e86c/media.mp3" length="142693025" type="audio/mpeg"/>
			<guid isPermaLink="false">652d3a74bf84120012c7e86c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-hes-dating-a-ghost</link>
			<acast:episodeId>652d3a74bf84120012c7e86c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-hes-dating-a-ghost</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeSo80XyTXQBhuw5wUnS+nyjM8xbzAprUeCigCX7MlOeYqS8jZZFpKSuFqJQ3Oh46HqDsIfK76Bi3cjweXQ/2gJ+j4n2ZYA7zTEs0tZ3G4q16UmEG43kfEfu8ajIxVRfVkQxUYrwmou/rCOknrhPd5jugL2K0ernv3gloMGbp/xBz81Y/xuNstesozdC0m+nw/jO1hp7BkvG0xwH5keflupFQZi0Zjk8gmGsmEQzQ5jTIluFZv+A5wvd8pEPptUaok=]]></acast:settings>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>215</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: My boyfriend vandalised my bestie's car!!!]]></title>
			<itunes:title><![CDATA[Girl Talk: My boyfriend vandalised my bestie's car!!!]]></itunes:title>
			<pubDate>Tue, 10 Oct 2023 23:00:55 GMT</pubDate>
			<itunes:duration>1:20:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65240077cc56a90012e9495d/media.mp3" length="116008586" type="audio/mpeg"/>
			<guid isPermaLink="false">65240077cc56a90012e9495d</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-boyfriend-vandalised-my-besties-car</link>
			<acast:episodeId>65240077cc56a90012e9495d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-boyfriend-vandalised-my-besties-car</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd8Pj3MQmc/yuPVyUInF6xnFEKiaF5V8kwRkZSGNoaGL2kLcWNm116RiVf6Iy8gwtf0UlA1U9CpJFJpHr+h6SkiGXaySNCu4X8RgLLD0JN4bh1gWxSw2PfByCnrDgaBAZE2v48j3QBKVk7qMm3kfsZtgvTq5Pw+J2DET0bejATCSGlpiSwGpburJnIbbEwQGTI6T3aaRT/bZZleZutNTw6uafiMOZEklod6YRPF+Q+gh2svW/DUx9Kn1nJkWS1qPRxykAJdj+bu5MtDRfSveU4Q]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>214</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: Sophia got ditched on a date. Text read: "Can't".]]></title>
			<itunes:title><![CDATA[Boy Talk: Sophia got ditched on a date. Text read: "Can't".]]></itunes:title>
			<pubDate>Tue, 03 Oct 2023 23:01:34 GMT</pubDate>
			<itunes:duration>1:07:54</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65198b7f936e07001149fd4f/media.mp3" length="133033822" type="audio/mpeg"/>
			<guid isPermaLink="false">65198b7f936e07001149fd4f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-sophia-got-ditched-on-a-date-text-read-cant</link>
			<acast:episodeId>65198b7f936e07001149fd4f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-sophia-got-ditched-on-a-date-text-read-cant</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAg8wGn2EQcM6iWP0BAcw8i7rsnFeETOhVSfhKOAxdClB0D6YwtBmGU5xdm2MnnH5wvjlNRb2wYeJdj3BRcMJ1msS96ZovgthIWhkfPwFU7o70xTsFUF9oF2ZbLPWv9KYYe3mCrmFsbRxK4goPT5L+ZnJGJ8mwpWGC3y9jci5CT1020J7Bp24zQHGtV+lxzpOJIv5sESyZhIFtufZoxeFOlM=]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I betrayed my sister but IDGAF! yikes</title>
			<itunes:title>Girl Talk: I betrayed my sister but IDGAF! yikes</itunes:title>
			<pubDate>Tue, 26 Sep 2023 23:01:40 GMT</pubDate>
			<itunes:duration>1:11:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/65134f2d745cfa00116b0f61/media.mp3" length="105880752" type="audio/mpeg"/>
			<guid isPermaLink="false">65134f2d745cfa00116b0f61</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-i-betrayed-my-sister-but-idgaf-yikes</link>
			<acast:episodeId>65134f2d745cfa00116b0f61</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-i-betrayed-my-sister-but-idgaf-yikes</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdpJ09dot+WmHLEhAcRHhdgm0OaR3ksmyQF7GzbKCkJbkMxBvEIk2mPsL6kwmT9tKqGM1FWOxFq/4TNLL+F5iKVaTjN7HRyLBuvgExmj5Dz0hjiE5b5jdkSWgzR+QPxVTAiAN9D36dPj1rD9G48+CeR2/HVPDa6PdvsKIsCmTOhfPgO3YWVTd6iX58a8Mky9lIKiLE9hxLfZFtPPVIyngWttIUohdhyXAaSUSLzGbFf/8CssjJhvZ+8/ASJYbs9x58=]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>212</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: MY HUSBAND IS BEGGING ME TO CHEAT ON HIM!!!</title>
			<itunes:title>Boy Talk: MY HUSBAND IS BEGGING ME TO CHEAT ON HIM!!!</itunes:title>
			<pubDate>Tue, 19 Sep 2023 23:24:50 GMT</pubDate>
			<itunes:duration>1:21:11</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/650a2bdb848fdc00111189f0/media.mp3" length="120912025" type="audio/mpeg"/>
			<guid isPermaLink="false">650a2bdb848fdc00111189f0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-husband-is-begging-me-to-cheat-on-him</link>
			<acast:episodeId>650a2bdb848fdc00111189f0</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-husband-is-begging-me-to-cheat-on-him</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeFWOVcg1XwMZrJdez6gU57HpwKGGIZ6qM33co0bQ3ozRg4d+wzlVCm8uy0s+X0Dj8jhkRAjlipKfxSFWgHigpVfJ0IttO+Sm91iX/jYoQOFvmzjWQ3OvaqnKNbUK0vD/hmNaPFRy8VT8LtDqgH4MDIPnTeuRxmlNv8AXWa1LWWvq7R9MrKCVzaBQuDe2erQA1VGu3O6QNezLSrnmcmQLUREHy6YtWMAlHTSsaaZX2kpxvURnIwqkicVcyL/CMPsRU=]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>211</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: BFF falling for my FWB!</title>
			<itunes:title>Girl Talk: BFF falling for my FWB!</itunes:title>
			<pubDate>Tue, 12 Sep 2023 23:01:14 GMT</pubDate>
			<itunes:duration>1:12:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6500ea0fbaff9f0011cc29e4/media.mp3" length="108451494" type="audio/mpeg"/>
			<guid isPermaLink="false">6500ea0fbaff9f0011cc29e4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-bff-falling-for-my-fwb</link>
			<acast:episodeId>6500ea0fbaff9f0011cc29e4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-bff-falling-for-my-fwb</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcQdTIhy9piz+RAJCNcJkw0rwiGwQ9THFyiN2mjcWVv+MBMqJONoOtcHNbn6bCPkW+3PituC1d9U+oxzfr40H8RyldvWDtgeedyzxzA2xNEvHjE/wQIQo3J7LKwvZmvA+jjW41A5DeZBM0iF6DYKzIXg+dcdPhT9Ygkjpdc+ynpF4UyI8qhx7Furw6I3ylmLgMcwFwrRHKU454QHab2J6bbpLV55ONcRJWC1mcvXEr/U38akCG+SLLTufkaoxAqgz8=]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>210</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: His girl bestie crashed our FIRST DATE!!!</title>
			<itunes:title>Boy Talk: His girl bestie crashed our FIRST DATE!!!</itunes:title>
			<pubDate>Tue, 05 Sep 2023 23:01:29 GMT</pubDate>
			<itunes:duration>1:23:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64f787c8a608b50011f78336/media.mp3" length="162377868" type="audio/mpeg"/>
			<guid isPermaLink="false">64f787c8a608b50011f78336</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-his-girl-bestie-crashed-our-first-date</link>
			<acast:episodeId>64f787c8a608b50011f78336</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-his-girl-bestie-crashed-our-first-date</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdbgcNOUJZ1pmZPD6lLv6CHRpeNQfPoBo53/flxaTBEgx7H8sT59tPD94nXnRQ/oCMQzxYLmx+a++W2bO7aw2mHuY2yZQwvG69djXjNeF1qF975WdXvfyRZPYkGCQMSS2oczM0TRFhbA75vmB4jz5m5LmTQ9fAwqwB1boTWIZPxnF8WIjlmYXMdzGb0qE+/zuaHJN9rCZJTObVJboTKYZO9O0v2wMZdAi9RfsLN0VffAkMBPYl1kHF/5UW+2OdRlCPO4e0sHDzBXIj0WkBlIZt1]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>209</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Partners being added to the Group Chat!!! pls no</title>
			<itunes:title>Girl Talk: Partners being added to the Group Chat!!! pls no</itunes:title>
			<pubDate>Tue, 29 Aug 2023 23:01:54 GMT</pubDate>
			<itunes:duration>1:01:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64ee4b9af7146700111b8676/media.mp3" length="118983440" type="audio/mpeg"/>
			<guid isPermaLink="false">64ee4b9af7146700111b8676</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://www.britishpodcastawards.com/voting</link>
			<acast:episodeId>64ee4b9af7146700111b8676</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-partners-being-added-to-the-group-chat-pls-no</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCda/e84zlgi9r2+QGk5L3LZhkIqaDZXjp/Er5QezG/8BRyk1xeEle/7nbsNJpVgajlcJcDB10jFhTYtfVjtyEfqHMdqbWVJxMZX1eTn1yst8k0+/W2jmr1emedupChWXR8gyNOFAN3lo1er1gdF2boh91VG8Q/1PwPJCay4qhDUvVdApNPdkjMUxeoidUR4GLIuHLyDqViaZaXtsCy5JPq2jBnj6W0TwDegjpzzoiUxq2/yUsO7NfERyW4lQnnxQ6UZH28pAfi8PMFQ2sa206iK]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>208</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Vote Here: <a href="https://www.britishpodcastawards.com/voting" rel="noopener noreferrer" target="_blank">https://www.britishpodcastawards.com/voting</a></p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Vote Here: <a href="https://www.britishpodcastawards.com/voting" rel="noopener noreferrer" target="_blank">https://www.britishpodcastawards.com/voting</a></p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My man DOESN’T think I’m a 10! wtf?!</title>
			<itunes:title>Boy Talk: My man DOESN’T think I’m a 10! wtf?!</itunes:title>
			<pubDate>Tue, 22 Aug 2023 23:01:34 GMT</pubDate>
			<itunes:duration>1:10:18</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64e52c5715575f00111fd659/media.mp3" length="104723208" type="audio/mpeg"/>
			<guid isPermaLink="false">64e52c5715575f00111fd659</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-man-doesnt-think-im-a-10-wtf</link>
			<acast:episodeId>64e52c5715575f00111fd659</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-man-doesnt-think-im-a-10-wtf</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdEaW5AOBLnP5tk8lRSWX+zQXQ3lkRypAIURfnNUITSSXHrdqV652pRzhjhHFLVsxIxbzpgsSU8p88Ttdt589ZkpCIp62hx2I6ttF875Bhl3oHBhCSTlRKtAFrdvliHga8sQj7ql8vrLN9GpeqSZYRtLYLXfVbhtYW2E0QG3TOCB9mvIOuERsF+hGc3X4jf9FPSr5jkSKevAcvW5POGSsocTN3x0ZMhsFeeVbEHPY3aRQolsTCXE1PZ3PCoXiHOuHfOws0Kql7vvSqCUDoqbqlS]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>207</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Vote Here <a href="https://www.britishpodcastawards.com/voting" rel="noopener noreferrer" target="_blank">https://www.britishpodcastawards.com/voting</a></p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Vote Here <a href="https://www.britishpodcastawards.com/voting" rel="noopener noreferrer" target="_blank">https://www.britishpodcastawards.com/voting</a></p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: WHERE IS MY HYPE!?</title>
			<itunes:title>Girl Talk: WHERE IS MY HYPE!?</itunes:title>
			<pubDate>Tue, 15 Aug 2023 23:01:37 GMT</pubDate>
			<itunes:duration>1:27:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64dbf9662000030011c4f4de/media.mp3" length="130117892" type="audio/mpeg"/>
			<guid isPermaLink="false">64dbf9662000030011c4f4de</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-where-is-my-hype</link>
			<acast:episodeId>64dbf9662000030011c4f4de</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-where-is-my-hype</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdwWJFA0hA3TQp91+NBE9yzfFgsKyHDMxuDdrYfym49QL5EhZ2CIgogosIKSIArXFt/hudEaSXlZUu3se448/0/+lWpOmoLB2agMnOpSEqqe6g1StwyVjK5UQSk0u3YtwL5AHUHpUwcXy+kAxsAGNyA0Sx8U2xMOYcsMZddf/pB3zAX5tLOt/OavhOlZ5pvGbx+cOYZe2ekJ6UY+TsFEmR/cCM2CRQUrsZsu39eplhMFKu7IO2ad8MQNj3jNab+1GGCwA2Ff2fp1RZ3holLf0dd]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>206</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Vote Here <a href="https://www.britishpodcastawards.com/voting" rel="noopener noreferrer" target="_blank">https://www.britishpodcastawards.com/voting</a></p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Vote Here <a href="https://www.britishpodcastawards.com/voting" rel="noopener noreferrer" target="_blank">https://www.britishpodcastawards.com/voting</a></p><br><p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I got his name tatted… FFS!</title>
			<itunes:title>Boy Talk: I got his name tatted… FFS!</itunes:title>
			<pubDate>Tue, 08 Aug 2023 23:01:22 GMT</pubDate>
			<itunes:duration>1:14:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64d2b4b8dcbd5d0011909ab9/media.mp3" length="110681266" type="audio/mpeg"/>
			<guid isPermaLink="false">64d2b4b8dcbd5d0011909ab9</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-i-got-his-name-tatted-ffs</link>
			<acast:episodeId>64d2b4b8dcbd5d0011909ab9</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-i-got-his-name-tatted-ffs</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAq7gJoge29cqT0Z9CJKNP7VLNR3V0WqjPVbw/TvfV9dL1/ccJ8/EQrnnOtc8yKLvyKmSwDkP7zMiAS5EH6BXKFeMtgwcJrxBMmwvF5NoRux9sbt9f/5QAFzBRlYXFS9xCW2eOOlITwi8MWGWXACmRHJqFdMaTisavFf8XYFyGxCcDZiebyGMATCpVwk6SFEZjEVkgjePlsbtNl5JhSfFLZ2PAVVvAYpSo8WSdHtpL9D7]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>205</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Ex BFF is now my BOSS!! ffs</title>
			<itunes:title>Girl Talk: Ex BFF is now my BOSS!! ffs</itunes:title>
			<pubDate>Tue, 01 Aug 2023 23:01:58 GMT</pubDate>
			<itunes:duration>1:17:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64c98c5b90f1880011d02e42/media.mp3" length="115586559" type="audio/mpeg"/>
			<guid isPermaLink="false">64c98c5b90f1880011d02e42</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-ex-bff-is-now-my-boss-ffs</link>
			<acast:episodeId>64c98c5b90f1880011d02e42</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-ex-bff-is-now-my-boss-ffs</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdRv7r2XeEiNHU9daMvriyGOPHtWifVKAyc17nlj0XINiiJc9EJLdl1D01a5lH3bEDnMEcbDuyp6bBZA+h7Dt7RUgFXZ9708jNeyboRE8Pf2JdiFSKSSs0hUBSrmvGm80GmgQyYro16W1geOwDLttHn4lLcocI3PTYDzb90OE7gHxd72E23TibJPHpVPLASqmbEuIatWsQTNRL5rcpNo949/nJ/Qgop3dzVdRsKeihmZn0AUUf8Vyrro8xlYX8ZTF4Gm1OwHIyB0IFGegg2gQqi]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>204</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Me vs Baby Mama</title>
			<itunes:title>Boy Talk: Me vs Baby Mama</itunes:title>
			<pubDate>Tue, 25 Jul 2023 23:01:36 GMT</pubDate>
			<itunes:duration>1:19:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64c04ad58ab13d001268515e/media.mp3" length="118607203" type="audio/mpeg"/>
			<guid isPermaLink="false">64c04ad58ab13d001268515e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-me-vs-baby-mama</link>
			<acast:episodeId>64c04ad58ab13d001268515e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-me-vs-baby-mama</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfERIewTlVD7ogFXpjetOQTPDdGjnPjwghneFJ7CA4gdYLH0l12lPoPrcOvCfZIQP4vMQZ4rfp3jkEmOzpizh4gW5XvQh5nmDKzINILg5LP85PVuwYlhr5gIJzf2dseIDACeellKB746LWT5ZBRqNKmHoJCzvlNTA4Y00OSsxtXlJILLqCZ25AzXGH7QymPr1h75OCh7rvq+txdWP8I+PAk/ZRLfbvKcD/6tK0nVpYfgWge0wytpP5cHlyDGgypg6bXcTqeZ7lhfzn4/rmUntJm]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>203</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: A Crush is just a lack of information!!! </title>
			<itunes:title>Girl Talk: A Crush is just a lack of information!!! </itunes:title>
			<pubDate>Tue, 18 Jul 2023 23:09:02 GMT</pubDate>
			<itunes:duration>1:06:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64b71b8e80e4280011a6888d/media.mp3" length="99266058" type="audio/mpeg"/>
			<guid isPermaLink="false">64b71b8e80e4280011a6888d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-a-crush-is-just-a-lack-of-information</link>
			<acast:episodeId>64b71b8e80e4280011a6888d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-a-crush-is-just-a-lack-of-information</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcIq30p/kLsFl6TOlVOeo6/kmnJ0TZ26Z/ivQmsYkDrV3i6/egBeuPGcQo9KdTc1A1KAUDD3u7EU9NdvvxzG9E/owg3GH73PYceHGLO12MXcQ1BRN8YAYQQYNwAPGtXGRlayRxB0zeF2IEsnYnvYG2+snTxJbG1LYoxVCtmlp4CsAwtvH2IVTXNQlxe/7MmphAdEtbK+kIEE44LF8zI78PhStlHH/pZgzj5IBMFzeZJlOGA8oZGHJfbZgoZ4qxAUP0EVKNl/RnR2CSHBJdTrYuS]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>202</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: The real reason he won’t let you meet his female friends feat. ShxtsnGigs </title>
			<itunes:title>Boy Talk: The real reason he won’t let you meet his female friends feat. ShxtsnGigs </itunes:title>
			<pubDate>Tue, 11 Jul 2023 23:01:17 GMT</pubDate>
			<itunes:duration>1:01:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64abfd39d593820011ab5a2f/media.mp3" length="119254281" type="audio/mpeg"/>
			<guid isPermaLink="false">64abfd39d593820011ab5a2f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://www.patreon.com/TheGirlsBathroom</link>
			<acast:episodeId>64abfd39d593820011ab5a2f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-the-real-reason-he-wont-let-you-meet-his-female-fri</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeqTPsfc0lnIyEf3PFKL6r+feNDNyKz5RCKHTvPqRc4H0N91/iDiSWQhsOGMOD9cTPj+m8Hx/+KTNQZjDuQJ+GMYV6UJAUTsQgmK6f+Eq95VT/MyzW6/aQhXXWec+wqr0AsXOHNgfuY+ETZ4YEGMsm4HwWIjJ/HVaAdLhOHfS0dtXU2u9D5zjfpWH8+Hoikxm4X7qx4A5c47YrcReNTx554Ohw6yMhFfw8etU4SSS6YzeN3nB3lX3vUXc9gyhUvRr94ObQWgnz+sl6NcFZwXa4r]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>201</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1762879505937-6fe0d472-59d8-4cf8-abd3-deff0c27d224.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: He’s ONLY friends with girls!</title>
			<itunes:title>Girl Talk: He’s ONLY friends with girls!</itunes:title>
			<pubDate>Wed, 05 Jul 2023 01:02:33 GMT</pubDate>
			<itunes:duration>1:09:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64a4b0641b96b90011bcae01/media.mp3" length="135347395" type="audio/mpeg"/>
			<guid isPermaLink="false">64a4b0641b96b90011bcae01</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://www.patreon.com/TheGirlsBathroom</link>
			<acast:episodeId>64a4b0641b96b90011bcae01</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-hes-only-friends-with-girls</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdrLA8I6WB+y0ER25ylERuhDiQO6H2uc6pOa2sHGNho9V+iH62XYXk4l6VfDuGJeS76w2cpfujqK4ORUgAsebRrCREg6oVxa7HK4jnmga4CM80sNKB/k8Mv5PjFp8DNh+vf6cSld7pCbOeVxvIYBDR/7yOpDy1dqIfKZ7IZqchzAQw1YWkE7XXcSIP18xFByV6JNbbn8oxfxrvf6IxtV7cHZJNs99ihbUkiy24UBlXZBTzANvoHnne6+yDDEUEeAl6d+xyC71/TN3mKoWgk+thE]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>200</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Join us on Patreon for an extra ep every week!! https://www.patreon.com/TheGirlsBathroom</p><br><p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He pocket dialled me and RUINED everything!</title>
			<itunes:title>Boy Talk: He pocket dialled me and RUINED everything!</itunes:title>
			<pubDate>Tue, 27 Jun 2023 23:11:27 GMT</pubDate>
			<itunes:duration>1:09:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/649b16d405c5ef00110be663/media.mp3" length="103925289" type="audio/mpeg"/>
			<guid isPermaLink="false">649b16d405c5ef00110be663</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/temppp</link>
			<acast:episodeId>649b16d405c5ef00110be663</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>temppp</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAgOjHYWhtp0ogmfUNct39WwzU0Hw3/EYYKngpnR5I/J6ChqCtgOGJmEnT/Uo855xZ6yu5dKYgG0HR5e8YOIwqNPp/KlwKp9vUw9CxGMQ/meSmBuIATIDYulBBP0+9php1UT6/Q+28yyS0KuT1d0LPjUXeXTC68n+N3ZLnGL5zcQvB8aY2qc0MeCYO6nOllNV47sOB/f3DU5fmrXmXDGcYsQg66Z6def2kWc0Nv6Y8hbG]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>199</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Should I draw a line with the girls at work?</title>
			<itunes:title>Girl Talk: Should I draw a line with the girls at work?</itunes:title>
			<pubDate>Tue, 20 Jun 2023 23:01:29 GMT</pubDate>
			<itunes:duration>1:35:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6491f6178be1af001148b027/media.mp3" length="141657864" type="audio/mpeg"/>
			<guid isPermaLink="false">6491f6178be1af001148b027</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-should-i-draw-a-line-with-the-girls-at-work</link>
			<acast:episodeId>6491f6178be1af001148b027</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-should-i-draw-a-line-with-the-girls-at-work</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdST50AwwhdjEdiyVnloOZSkD5PlLUo45KSOk3LUBPUlb89QHWYEygBxW3SDLYbBtq+nQh12avo8sgUrLwCk37eqEBIFvCI97zRaOg9kHrE3s5NG+fg3ehN2R4dfFmzRsCFzTofMLGJnnqcxmBDx43IHD/MEYhXfcgwFQYc1UgxuyoRnQBr4+s30SmYB1MFERTzimZo5LbZml2PoXLjF/vi5B9ZE4EndrRiFD5+hX9laydXXFC9vkCRZIUUkZjjsiosnpAuCuPQLbKAbanb9XqO]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>198</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: All his mates are CHEATS!</title>
			<itunes:title>Boy Talk: All his mates are CHEATS!</itunes:title>
			<pubDate>Tue, 13 Jun 2023 23:01:31 GMT</pubDate>
			<itunes:duration>1:12:44</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6488e8fa00007800114e837f/media.mp3" length="107950518" type="audio/mpeg"/>
			<guid isPermaLink="false">6488e8fa00007800114e837f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-all-his-mates-are-cheats</link>
			<acast:episodeId>6488e8fa00007800114e837f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-all-his-mates-are-cheats</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeW/K+afNhYS+ibN27eXAFD3X73yTwxFxROxff96mXt7GivSa6mNygGJWGjPdWt5jp2CTOHdcNvKuOqqOCbQGCiCm5i1Kh82mskahYryyHLVI/ze63AjzqmlFO3BHK6xGT+9u4n72jA8+aR6eOH3vIezxwZXoOB1LpFd8kTBKYVhQZDC83ba/HK+mrSf5ivc+XlxLuXk37waJlJPLFBsEdQzVmkMmzh4WEafRCzyaIg7J3UwgSI2h59zdFoxjakPtTrPFU7vA2ljSwcWp633Nac]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>197</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Entanglement with my Brother-In-Law…</title>
			<itunes:title>Girl Talk: Entanglement with my Brother-In-Law…</itunes:title>
			<pubDate>Tue, 06 Jun 2023 23:15:47 GMT</pubDate>
			<itunes:duration>1:22:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/647fbe2312ea910010ee735b/media.mp3" length="122024083" type="audio/mpeg"/>
			<guid isPermaLink="false">647fbe2312ea910010ee735b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-entanglement-with-my-brother-in-law</link>
			<acast:episodeId>647fbe2312ea910010ee735b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-entanglement-with-my-brother-in-law</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdUwJHte7ok+qbESzG65ny+lwZGze5KDezwOVMbkUuVZ59I6+6UxNtTt2wagH2JKz1heJ3If2+ZGbgkeSaPVPqLDDQXqGeYtkaxDyxVaZQhuyjyo44Oa1ujnS+bZknWmNHoBbcE4vrYvrwIzHsXCpxpjPR0N9NtG8ROUz2kV/+aaz+CfwqdYwx0gwgWfa7TOB8x5QfJtXYkX5ileczlo57XJFts4laod+cd2WL2F6Zvo0DcCCcg//qjGDalxKkiX44o7TNK8ta+yOXe8yIEGsf+]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>196</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I’m drunk texting other guys!!! Help!</title>
			<itunes:title>Boy Talk: I’m drunk texting other guys!!! Help!</itunes:title>
			<pubDate>Tue, 30 May 2023 23:01:26 GMT</pubDate>
			<itunes:duration>1:12:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/647661d780d2d500100826d7/media.mp3" length="108172220" type="audio/mpeg"/>
			<guid isPermaLink="false">647661d780d2d500100826d7</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-im-drunk-texting-other-guys-help</link>
			<acast:episodeId>647661d780d2d500100826d7</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-im-drunk-texting-other-guys-help</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcs1Hs7F5uM73xghr6FKVxCRC23ZPJFmbKRiZpICw615Rq7et5nPnSKvUTkziTkWzTjUzm5/itBUo/OAf43dm6TgnEKCSOCF1/UfQrR8zOagEaVGOSu6UN3PKDyi2AVuNU66DSHDepF91W6RF25vP9ZjQWfJs2k/wF2c4+OQRIT0ixvi+3Z6pKRjPim0mzXnbnt6GDa0ipA3tcdM+ay0C7ftXg0myYrSRel4b6ZbxFW7WYNHOkzU0/XdMFNNT4n7LwtLrV1GSPSccnrawHrc4xm]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>195</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I’m in love with a Vicar!!!</title>
			<itunes:title>Girl Talk: I’m in love with a Vicar!!!</itunes:title>
			<pubDate>Tue, 23 May 2023 23:01:43 GMT</pubDate>
			<itunes:duration>52:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/646d267bbcb3130011c725ff/media.mp3" length="77309706" type="audio/mpeg"/>
			<guid isPermaLink="false">646d267bbcb3130011c725ff</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-im-in-love-with-a-vicar</link>
			<acast:episodeId>646d267bbcb3130011c725ff</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-im-in-love-with-a-vicar</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf+oPUIIWkgye4t8WEaQYI+zPaDCc8WNhAhvhCS3bSRaXuUZrUgpwPgBesu4WnzqaDpSEWIj820AvafYVysr3CpltFr7CNri2rncGu+U2HybF15yyY6MhAeY/RRY/klTp2YUwbiFpfzj+YUTvfU5Pk/EQCIxhwrn7+iKOFp4cpRt4qJ/5ncGlV/EufSel2p3e4jraeyeQ2oIGG5p45E87YlZ4AfeGhCClA3LcRGV4iQElZX7DU5Yp3TUTdk8fb34o4TF1+6Fb/FdjOA85yc15Tz]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>194</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: His mum tries to tempt him with other girls</title>
			<itunes:title>Boy Talk: His mum tries to tempt him with other girls</itunes:title>
			<pubDate>Tue, 16 May 2023 23:01:17 GMT</pubDate>
			<itunes:duration>1:16:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/646404d21595ad0011876c97/media.mp3" length="113277236" type="audio/mpeg"/>
			<guid isPermaLink="false">646404d21595ad0011876c97</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-his-mum-tries-to-tempt-him-with-other-girls</link>
			<acast:episodeId>646404d21595ad0011876c97</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-his-mum-tries-to-tempt-him-with-other-girls</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdxtegI+i7Sx7COLRGKerK2SVfnLYINhwq04ramNI3BFWTIzVMkJN0D7LCcD1h3off+gJQSMTy5iWE8EfxsE2hV34Hb99H5nPDu5bk3O3HsqxqlEs5R/tVAm/P5XH0CeZmT7hNofSAvocVgByygOEFCU3PnOROzqxnIReaqjnRZevwIQhoGNr071ltTsw03TrfNL66WjbjRl6yjqobS9ydx0NiV4Q1lb9z+UiAps9sIJth1/Mji8wChaOF1DaV+tpz21rWVTw9p+66rJTnRr+mo]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>193</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: She’s stealing my stuff!!!</title>
			<itunes:title>Girl Talk: She’s stealing my stuff!!!</itunes:title>
			<pubDate>Tue, 09 May 2023 23:01:32 GMT</pubDate>
			<itunes:duration>1:11:16</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/645ac44bc7168c001147e1ae/media.mp3" length="106317797" type="audio/mpeg"/>
			<guid isPermaLink="false">645ac44bc7168c001147e1ae</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-shes-stealing-my-stuff</link>
			<acast:episodeId>645ac44bc7168c001147e1ae</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-shes-stealing-my-stuff</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCerKGdjiNc6Ozgaq6IQ3KTQMqDfFEQ6MEk+RVlW7mls2UN+FNjxFPWvqJt9VMepYobpEuNBFVU3TR850tI7RluviRLTh1khtnZG5hNW1MU2FU/XvTRMn9H+SCILA1puCZ+/V/dmEEnqvCXO4XJh671RX5jUkHjxlUSnnlURzRBLkrtHLkRgM+fc25nIiLBxbyn6Mkp9bVF7eazsOAK/NOr0pXlogqDwPRxdH9VdfoYdDFdXLf4S4OSuV72EqLsvB3teHyzK6lBGwk2ZK08QaUwn]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>192</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My boyfriend brought a girl back!!!</title>
			<itunes:title>Boy Talk: My boyfriend brought a girl back!!!</itunes:title>
			<pubDate>Tue, 02 May 2023 23:01:35 GMT</pubDate>
			<itunes:duration>1:10:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64518cbc796e0700112c2a7c/media.mp3" length="104812491" type="audio/mpeg"/>
			<guid isPermaLink="false">64518cbc796e0700112c2a7c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-boyfriend-brought-a-girl-back</link>
			<acast:episodeId>64518cbc796e0700112c2a7c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-boyfriend-brought-a-girl-back</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdkNe88SsTb8EDA2cQyJJTxD1TLCle56KKs7XLbexmdp7dsf4k62HBZSiQer3s5bQcazxbuVJG7PIwIxrCyuFhPAjbWRnVgCzCWIxEDaKrNnBPt6CgkZJdWaqroLqauZrM7KPOwLoewOYvk95m71hAAbDZGJcJzDqH0RmyQPuK40W4p2PU3Wb2NlTnJ9bkw0NnzQyWXfw+4oILORVKnpya4tRBKie1Eh/zugocpCxJptNVElAP0kFKYZXzETdT5W/zRXRjHJu7FuJuAwtsxN5AA]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>191</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I’m not telling my friends I’m getting married!</title>
			<itunes:title>Girl Talk: I’m not telling my friends I’m getting married!</itunes:title>
			<pubDate>Tue, 25 Apr 2023 23:13:54 GMT</pubDate>
			<itunes:duration>1:06:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64485eb3f904a30010bb5060/media.mp3" length="98694260" type="audio/mpeg"/>
			<guid isPermaLink="false">64485eb3f904a30010bb5060</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-im-not-telling-my-friends-im-getting-married</link>
			<acast:episodeId>64485eb3f904a30010bb5060</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-im-not-telling-my-friends-im-getting-married</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeWUy1znHhAZ/X1uzB2AuQU3iKA2hrhPbf+FjS7qC65bxJI1szIgjUfDsKytikTWvq7jHaH05nq6GlEh8ubml2CgQYEhG/UBnVlsacrsLeXfT8inX9vg5b5BwZ0d4UlDIoHpqtxG5ej3uP1y4NwRR0S6chZdVnMP+E+miqA7+v1mD1wlY9lODlRwZW0BO1jI4oc4HHRNEGd0N364VyjBXM8yQ2XdkMQRod7XW0MaCK7KzxPAIHGSMMUDj5fjOdl/VWWLBw9c3rA7y4BYhyfmiDo]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>190</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He found another boys jumper at mine! Oops</title>
			<itunes:title>Boy Talk: He found another boys jumper at mine! Oops</itunes:title>
			<pubDate>Tue, 18 Apr 2023 23:01:23 GMT</pubDate>
			<itunes:duration>58:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/643eb366996c170011b60561/media.mp3" length="86388361" type="audio/mpeg"/>
			<guid isPermaLink="false">643eb366996c170011b60561</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/ep</link>
			<acast:episodeId>643eb366996c170011b60561</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>ep</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PArAcwFE8cYmz9x6cXZUkA/4BQ+euYyGW3JC5HDnHFMT3g7kinj0kx0Phsbxu5ZdtTw42Z6AWSBQaKcOk7Th+Vnt5WuEOToaBVS6kYTtfxuhuTuCbR+wV+nrTxMYo/OxDAH/mr155fHYsOfWGHjvyc7JGKkvCmlPUF4ii+/CmiFfpMgOE4cgoTOcUvYR84qo7vd7U7dLms+HqOtCJ9qPhLIxlEmsWj8A67Ido6tVF+w5U]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>189</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Am I allowed to kick her out???</title>
			<itunes:title>Girl Talk: Am I allowed to kick her out???</itunes:title>
			<pubDate>Tue, 11 Apr 2023 23:06:11 GMT</pubDate>
			<itunes:duration>1:00:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6435e7e3960db800114a3f91/media.mp3" length="89287390" type="audio/mpeg"/>
			<guid isPermaLink="false">6435e7e3960db800114a3f91</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-am-i-allowed-to-kick-her-out</link>
			<acast:episodeId>6435e7e3960db800114a3f91</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-am-i-allowed-to-kick-her-out</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeWfF6QTko2b1TnAkzAmpOZo3JKOOcyCgkJz1vSyFD/QZtDGEE2DAlX7ubJf1RRGvlwxJ3YHXYL4WBJuU7r4ckPDWsnfMHL9ltlUqCoO9s74LPulZLTX2BQj6XdUbAsbpvypURvixd5BSKEEbtcMxf8iF9Tae1gzZ5p7To7Cz08NcosIDPxRfFsNguZGXAKRS1rLrnmlIiCVLM0jnlpLB+zttweVFydkvywdOaSqTPd/+uGX0hPtgzb6aO5Ya/NMq2euHsNlqWjxiR+4QdbsmrS]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>188</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My BF said he dreams of other girls… wtf?</title>
			<itunes:title>Boy Talk: My BF said he dreams of other girls… wtf?</itunes:title>
			<pubDate>Tue, 04 Apr 2023 23:01:22 GMT</pubDate>
			<itunes:duration>1:28:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/642c946abe84080011396228/media.mp3" length="130729593" type="audio/mpeg"/>
			<guid isPermaLink="false">642c946abe84080011396228</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-bf-said-he-dreams-of-other-girls-wtf</link>
			<acast:episodeId>642c946abe84080011396228</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-bf-said-he-dreams-of-other-girls-wtf</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdgLXTtCSwk5Ium/ZfbfWSxA2YSV8Nmj154GT3BFC6fy8W1cj4gNR4lJS+UxXeWUENZErw9sdmPSP6+SVK5+5X2bdqdG5+GTo2rDMKDrQmkJjjEyyqamVpHBIhaI+J5q3uSt4BxI74PRzSlT17w6dvex6w/n6G2pgpqZybl6QYMlEvP713R9cSQQ+G62TIHrVV1kwa8hCBb88CE1/vyjBZiixW7tMcKfg89YNMWnEQEW6bvv36aQ6xhvFQChONKHTao9RB4uy0ERg3JnFlNsyab]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>187</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: She sabotaged my dream job!!! WTF?!</title>
			<itunes:title>Girl Talk: She sabotaged my dream job!!! WTF?!</itunes:title>
			<pubDate>Wed, 29 Mar 2023 00:01:54 GMT</pubDate>
			<itunes:duration>1:01:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64237e8830476000117fcdb6/media.mp3" length="90996585" type="audio/mpeg"/>
			<guid isPermaLink="false">64237e8830476000117fcdb6</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-she-sabotaged-my-dream-job-wtf</link>
			<acast:episodeId>64237e8830476000117fcdb6</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-she-sabotaged-my-dream-job-wtf</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdDb82IOKxaKinA6jT273cB8PdnSYPpxCQ85pcBYOy2aUep0DVutm8GTP0ogJx18/+x2+wvOXpcAnkcqSxSbqQqY7bxFCNsN6zA4ok1oUs/g85JDxiXgpQ94G4lfDMy1y9IzG7i+n2Xl4+u5fPtYqGU9T6wl+tUkAwtZPy2eOqkLCUXFeNuAVsxPov71PGM9uk/ktrG92vr03braBGS1rDhTwU/GkLnCkXRU/3gb5fQ5V1+9uF2JzNU2f/7jmG7SmBGkZMOFQVhLOGROtC5JTJr]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>186</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Having an affair with the dad I babysit for!!!</title>
			<itunes:title>Boy Talk: Having an affair with the dad I babysit for!!!</itunes:title>
			<pubDate>Wed, 22 Mar 2023 00:10:27 GMT</pubDate>
			<itunes:duration>1:19:22</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/641a47735b5da900118a6899/media.mp3" length="118000476" type="audio/mpeg"/>
			<guid isPermaLink="false">641a47735b5da900118a6899</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-having-an-affair-with-the-dad-i-babysit-for</link>
			<acast:episodeId>641a47735b5da900118a6899</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-having-an-affair-with-the-dad-i-babysit-for</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCer4PQQyD0aeh0w/AeyFaSMNJ6RdHdZUXF8AqPBMWcXT/69BX5otP0rtzp836KXehThp2fhauYz62KPBbQ63OzNdhn/NOLs7df+WP0c51kyrP9B10TNV/ZEDRqmR9RFc7mEfN5SK1PMoGUDbS6B1xVTIvmZwvcbhP68+unbupW79Udn/r/qcNOkhV0Nj8bnTXlOlYjbmTSkiC3Q12dIqAdK8AgrAhJimqe5tslDgtNg65UQ1oa3MU+kh1QqSqvMPHFOAAbPUjUKCZoaocLymk6r]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>185</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Am I a bad girlfriend???</title>
			<itunes:title>Girl Talk: Am I a bad girlfriend???</itunes:title>
			<pubDate>Wed, 15 Mar 2023 00:01:08 GMT</pubDate>
			<itunes:duration>1:10:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6410d9ff0a4f690011b3c9b0/media.mp3" length="105094911" type="audio/mpeg"/>
			<guid isPermaLink="false">6410d9ff0a4f690011b3c9b0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-am-i-a-bad-girlfriend</link>
			<acast:episodeId>6410d9ff0a4f690011b3c9b0</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-am-i-a-bad-girlfriend</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCffFJb8IjSp4akw1FTm4pKp5TF3dZKcaaEt6JYgqx+jPIh59ER4LJllZikq/ttlc7rkAhxLBui6RZ+znaZOxwvNxBCiEdmQf/F05jKUZxBiGS9Cir6fDCGFq7uKHYWVtwXpOI5lGH8Qzw7nE6L0OSlL5VUojAG6foDJjDaEKNnkYlV3rPcM1LylVN3dfb7MevE13p4BkwW5ETGhbzlOlY6AxJmdSG9d8vydGxThcSyfufo0M2d5XGLnNILfccPaSWkXVRXN0dnra91muE55sTsU]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>184</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He spent the night in another girls bed!!!</title>
			<itunes:title>Boy Talk: He spent the night in another girls bed!!!</itunes:title>
			<pubDate>Wed, 08 Mar 2023 00:01:07 GMT</pubDate>
			<itunes:duration>55:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/64070f6433893a0011931a27/media.mp3" length="81913479" type="audio/mpeg"/>
			<guid isPermaLink="false">64070f6433893a0011931a27</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-spent-the-night-in-another-girls-bed</link>
			<acast:episodeId>64070f6433893a0011931a27</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-spent-the-night-in-another-girls-bed</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcqGgkwu8YPy/T9Bey2GqRmmzHYApuSBDKKqSuiN64CqOy6jih/6N2MeRlT5OMQEHWVIjxB4iDiNhxruPkR5zb9f6ZvNA2EEEYMAMembcLckXM1pwAXQViEOkNWzjmL3Uo7QWSwysPe7TlXMuVgKNNdyli3Ln0buitLgd4SQtcebDODg+NPp62pifmmUTn88mjWi2MW5Mowo9pmGTHQJV1j7EEkpSPk7wMdu2HOFBjZLz3oGxvDErJBJ4LuZxeXlOizuVHkFDb29kSJ+Dm5VhOt]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>183</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I can’t afford to be her bridesmaid…</title>
			<itunes:title>Girl Talk: I can’t afford to be her bridesmaid…</itunes:title>
			<pubDate>Wed, 01 Mar 2023 00:04:40 GMT</pubDate>
			<itunes:duration>1:01:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63fe9699550f2a0012235cba/media.mp3" length="90484708" type="audio/mpeg"/>
			<guid isPermaLink="false">63fe9699550f2a0012235cba</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-i-cant-afford-to-be-her-bridesmaid</link>
			<acast:episodeId>63fe9699550f2a0012235cba</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-i-cant-afford-to-be-her-bridesmaid</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeIiUussL2AOmreh2+HtynEUZubLTEiADl37hZ3l/qd0ITZ31Hfhz73R8hVrHI3hwqQMweRrTeOyS6rOVPsV59Ego2f5t4YGYcvpAfGXAs44URFArUF6wy32jnvPQIeJaizDh5UcYHgdgmoFvqAc0F5smYXviCXdNyPnvaNTXa30XGeAtJckM9pG9PVnZhrXNbeGE6L6n5+8EZu88m32+zxFY1IRvY1KaP8vHFFwMPZimQQOMIGOXnFEHLmrwTeNH2S18EuwB9hXgIQ/8wWSCeJ]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>182</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Married but falling in love with my Sugar Daddy!</title>
			<itunes:title>Boy Talk: Married but falling in love with my Sugar Daddy!</itunes:title>
			<pubDate>Wed, 22 Feb 2023 00:14:53 GMT</pubDate>
			<itunes:duration>1:18:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63f55e7ecef8ec001172d456/media.mp3" length="116214958" type="audio/mpeg"/>
			<guid isPermaLink="false">63f55e7ecef8ec001172d456</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-married-but-falling-in-love-with-my-sugar-daddy</link>
			<acast:episodeId>63f55e7ecef8ec001172d456</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-married-but-falling-in-love-with-my-sugar-daddy</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdYktAzRrwtuWM42F3vefrL782ovHawOFP+gFblku/jycdWff0wfKrlhu+BVRvevnxxIhAe3ojuNFYqWxvapHrtKz7/Ko5ycYc2GR7F0lud/tOKgxUBTsmvCFP+68XwQrbWP88IuxEVlBdYfXjVflNgJhQpXqC6z9ux5IorMOMzmbSFaftMDZlcjwjKzBYBzlZhKLucpZp/Fg90ey78U2vY/cS4wADInHVQ2jBwY4JA7bo8pwCj/5qPScperYbagFjfXneTZ79PLwAZYj3zkKoW]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>181</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: She won’t give me my money!!!</title>
			<itunes:title>Girl Talk: She won’t give me my money!!!</itunes:title>
			<pubDate>Wed, 15 Feb 2023 00:01:38 GMT</pubDate>
			<itunes:duration>1:10:35</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63ec14e2d524830011e116bd/media.mp3" length="104975674" type="audio/mpeg"/>
			<guid isPermaLink="false">63ec14e2d524830011e116bd</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-she-wont-give-me-my-money</link>
			<acast:episodeId>63ec14e2d524830011e116bd</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-she-wont-give-me-my-money</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PApJO7S3aFPDoSB+M1j7qli/1YDLzIBJi+h97icRSnVkxJC5Zqi8jp8OOywI47Hv2GNf1uEbetmz3x6wNTMNNXwWR5PgxpnfigM+Fr86HlMh1DQcvdwlrBu6QBly18H5iUBCQ4fHzL3bTzKQ50oTRHr9oN009P/D6Dp30WVjJY3JnUVNFqKyPoLo7uEoSJh25i/tX2M/uKmlUfcvrpcOXBkISmEq7qcIrMGoe7YeHP8XJ]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>180</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I slept with my boyfs mate before we got together! HELP!</title>
			<itunes:title>Boy Talk: I slept with my boyfs mate before we got together! HELP!</itunes:title>
			<pubDate>Wed, 08 Feb 2023 00:01:45 GMT</pubDate>
			<itunes:duration>1:11:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63e28b52436c36001127db0d/media.mp3" length="106613692" type="audio/mpeg"/>
			<guid isPermaLink="false">63e28b52436c36001127db0d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-i-slept-with-my-boyfs-mate-before-we-got-together-h</link>
			<acast:episodeId>63e28b52436c36001127db0d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-i-slept-with-my-boyfs-mate-before-we-got-together-h</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcBsN0ZND8Lxe9EWgaKwI7PVrCp6LiqYvkJR2suoYoL6FneWtFo7s4ghJovcUqibjn/kwHFTox+zeK24i7OVjwsh6lBQx4/btulAwomqjZonmu6Mzb984nsaNee/1XTeb2Qvm28A1WoNdcbfxWx54GUGmN65iZCHl3fJf5H7xvis9lKikK/mErUZkCQBLb8Kg6Afaxur23mTmNd0ObBYxPHp8UBaDc4cqD7m3EY9ix6YFpUs2O+h70JtdWXvHu93GixVHHYrrW7a0HJktZtfmPf]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>179</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I saw my friends man on a date with someone else!!!</title>
			<itunes:title>Girl Talk: I saw my friends man on a date with someone else!!!</itunes:title>
			<pubDate>Wed, 01 Feb 2023 00:01:10 GMT</pubDate>
			<itunes:duration>1:06:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63d9a494ac9a1400120c44fa/media.mp3" length="130114147" type="audio/mpeg"/>
			<guid isPermaLink="false">63d9a494ac9a1400120c44fa</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-i-saw-my-friends-man-on-a-date-with-someone-else</link>
			<acast:episodeId>63d9a494ac9a1400120c44fa</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-i-saw-my-friends-man-on-a-date-with-someone-else</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeFtf8ZJktdeTLbulAkMPgTq76PDDh6D48V8gIutsvZCkhXLETjSeVPl5FPTRAnLI6Mp26gZoA7Rovoq5zRy4tOByj3fnoSwIN57JJfWsm8zrfuncb4Gb4K9sRnCBrhwIx3W2xCm2wse5xkMjZWkh8nkEER6WOSJKG6rYY5QXoQy+VoJuYVlK9xspJn9wD7PfGidjTNRWXGcAR7I8EB9CyDWa4jBB/3s8ksJx8FOCr/mwM60wxR8XTXFkAUq5pEwp9LqW9xiMTRu2g21xtLzW++]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>178</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Paying for my proposal…</title>
			<itunes:title>Boy Talk: Paying for my proposal…</itunes:title>
			<pubDate>Wed, 25 Jan 2023 00:01:25 GMT</pubDate>
			<itunes:duration>1:04:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63d06774ce644900102f677b/media.mp3" length="125941728" type="audio/mpeg"/>
			<guid isPermaLink="false">63d06774ce644900102f677b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-paying-for-my-proposal</link>
			<acast:episodeId>63d06774ce644900102f677b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-paying-for-my-proposal</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcZCKV1Je4oSj37uUCUOj06Rsid6fbjqDqwitpnwm0+yZ3Y2frkL3dQnhlVjpEgys8d8hBHAxpYWl9VFKzvM7bOReK4shiZGUIbJBKfPygRfjHk+fnBEATEYCbqnLaYQpuwMgKZWdPrDGOaqEifXIaEFaUlpFLAOxZ3V6YnO+FF/BKboTwwH7IB8nSefF6Kqlt5fj8lHtovNbVe1soHDHdexbhA7VrlJSK2XCki69Lxj2/uM4fHAsdjanwuXz4WWpByLQfMMttC94jrqofCsajp]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>177</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Magic Mike vs Strip Club</title>
			<itunes:title>Girl Talk: Magic Mike vs Strip Club</itunes:title>
			<pubDate>Wed, 18 Jan 2023 00:01:40 GMT</pubDate>
			<itunes:duration>1:06:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63c7165a2c9e41001188e550/media.mp3" length="98798200" type="audio/mpeg"/>
			<guid isPermaLink="false">63c7165a2c9e41001188e550</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-magic-mike-vs-strip-club</link>
			<acast:episodeId>63c7165a2c9e41001188e550</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-magic-mike-vs-strip-club</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf8yGoYJVNVI3P8vzMJhFR6WPA2K9UOwCz01S7Gn8I13ZEnKk86S1Avomlhajxuj6cFw5BuQvlK7bXos+Ixazmj+58OPrJt8thKITVCcZFKkRvh9PRK6QqCJxskNWXpGWIRIonjQnOMxc600iFSFc+yMwOmP5rXrdgsmWv+75W4Ld9YlpiccM+Cgb9f5kGUtnJKJmw+yfL5CT6HS8b7NBDZ/p8PBiOhPDvT1b9AltOxVwsVCHW+q25jwnSAQvAGIfwiezskIih4l4uIZUQMeFGR]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>176</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I want my man to sleep with someone else…</title>
			<itunes:title>Boy Talk: I want my man to sleep with someone else…</itunes:title>
			<pubDate>Wed, 11 Jan 2023 00:01:20 GMT</pubDate>
			<itunes:duration>1:08:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63bdd0519fe97a0011683f04/media.mp3" length="101108441" type="audio/mpeg"/>
			<guid isPermaLink="false">63bdd0519fe97a0011683f04</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-i-want-my-man-to-sleep-with-someone-else</link>
			<acast:episodeId>63bdd0519fe97a0011683f04</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-i-want-my-man-to-sleep-with-someone-else</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfqXCWAi0G4JIYxEB9aMHA7OaemlcMnYrRFtokpmUXKAy7qAb+LMF6cJ+FfU0wNMl0aA0tIXEAXqz4649ryZxqhkGphX8ltEID3XDm3upA8JFYLLruzWohlQMfceKFEkweTzSxaAeE5D48B37bviylkkDmYZ4kp6tKsX2Ggv9rLvlV9q9JH4Mx0sNxqh7jIxHVnxkOmEKxoImNCVPmTd3lptUOzRzty/ukqco+4ptt6OjXye7AMg2e+UWOgrkMZl0SmtuduBRgUh62TbBNnaV5R]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>175</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My boss broke up with me…</title>
			<itunes:title>Girl Talk: My boss broke up with me…</itunes:title>
			<pubDate>Wed, 04 Jan 2023 00:01:03 GMT</pubDate>
			<itunes:duration>1:07:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63b4a739f4c10f0011dec3c0/media.mp3" length="99624800" type="audio/mpeg"/>
			<guid isPermaLink="false">63b4a739f4c10f0011dec3c0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-boss-broke-up-with-me</link>
			<acast:episodeId>63b4a739f4c10f0011dec3c0</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-boss-broke-up-with-me</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfzBcPhEa0Yffk9kQtdQx8pe9yXW4OC7lHJrqZR3ET0QtOXF+TgHeFxezCEaPCYmOwnIG3OBzyL9lQKJn2nW2hvp923GnUlpxFNQ8xx9SjvV4waAZKRRhUlT0O96MVaZpnCltPx+pyfoYV8r+t9/sshNAz3IixzyO6XgA/Frh3I2I/6MC7NiOaj+5PcTmwZtVy5CDfGUD7LMZkNyLE4qi4PeXUiuinhylXAJ9Q0QJcQYrArPyqFJdLJH2zNoF7bk6YUoAs0OGcBAeS14h9SptiF]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>174</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783649346-c6d8ad30f7980c59961ebd4e1659a125.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He doesn’t want to spend NYE with me</title>
			<itunes:title>Boy Talk: He doesn’t want to spend NYE with me</itunes:title>
			<pubDate>Wed, 28 Dec 2022 00:01:34 GMT</pubDate>
			<itunes:duration>1:00:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63a7540068bed100124c47f8/media.mp3" length="89431572" type="audio/mpeg"/>
			<guid isPermaLink="false">63a7540068bed100124c47f8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/tempp</link>
			<acast:episodeId>63a7540068bed100124c47f8</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>tempp</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcoLANt/2qGMzUeqwDGyspjL+nJz/kShdXOHVMMxC6Og8SgMDZvQ246qHTol5BP/GuA65N6CwrLhEigGjSz5zugKa3lH6pa9ScCMNkLLbepJgVTi0k6l2xzBUO+yWuDO7b2GNSyHWJu449+GYHZ6tt1Qt0+/BKwnoRp1uNOlkh9rLrIsoT2ieFacY1fL8GSqE3gWhvLpDlytH+5UI1YejBzvon/L2i5azHYU98g/PhSPzz3EOjBzlp5x6CN2Hqx//RqvfPkfIPVLH0dFfIb0NYp]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>173</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I’ve been uninvited from his family Christmas!</title>
			<itunes:title>Girl Talk: I’ve been uninvited from his family Christmas!</itunes:title>
			<pubDate>Wed, 21 Dec 2022 00:01:33 GMT</pubDate>
			<itunes:duration>1:04:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63a2307a48642f001085dd0c/media.mp3" length="95651308" type="audio/mpeg"/>
			<guid isPermaLink="false">63a2307a48642f001085dd0c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/draft-temp</link>
			<acast:episodeId>63a2307a48642f001085dd0c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>draft-temp</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcaO7ZwSp53Sa/ldiqrvoOIdQYclzjmk9Qi3UWnpojKvBEUYUMACoX52AgsHl3Vboe546J8AStJQ91+mm4yDEzFP3nhbpp9bm2h3RuIQRnhqbudoifjaEv8qMkBYeXc/4uGuqZDFPdVFT0cGS7Bac2qbh5I0C6Uf42tdhyenFOBLXEEGxhyNdt4ye8zNvzUgEpZtkNI3+AQOM0uNflpF1RaRBM5ACP77Oiav0hJppIXTI0iFhhxfDfge/nM40zby0SD9k/7GzVj1dOsul5mGThn]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>172</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Tinder verification code on my boyfriends phone…</title>
			<itunes:title>Boy Talk: Tinder verification code on my boyfriends phone…</itunes:title>
			<pubDate>Wed, 14 Dec 2022 00:01:18 GMT</pubDate>
			<itunes:duration>58:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6398608535ac700012160c4b/media.mp3" length="86248377" type="audio/mpeg"/>
			<guid isPermaLink="false">6398608535ac700012160c4b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-tinder-verification-code-on-my-boyfriends-phone</link>
			<acast:episodeId>6398608535ac700012160c4b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-tinder-verification-code-on-my-boyfriends-phone</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCckW3yLkI+guF+V2GtWZLRQuW6cZ1smupdAsPiNYUI0l8WA9/ZdU9NRl3DAEOX4husjXo5wv/v8P73WEgovcPU/2fsIaCjcovD3fysVA5w9wyXjEyMk5BhLcFrNNrT1t+x/y6MCXxijrhOXMD75EM/u+T6vO31ziBcGiztZ2ZOsK2Va6DNaR0pw9qnDnsSe3BXWQqpbb/YKxYJ1T1U+RG8MtaULqoTU8zUuXSywYPo/WgSiXSrse8NqSaCNh0cKVxtcgjXd2UUa4jzfAOoVitZX]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>171</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Do I need my BFFs permission to try for a baby?</title>
			<itunes:title>Girl Talk: Do I need my BFFs permission to try for a baby?</itunes:title>
			<pubDate>Wed, 07 Dec 2022 00:01:09 GMT</pubDate>
			<itunes:duration>57:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/638f8c641a770900116d4468/media.mp3" length="85925624" type="audio/mpeg"/>
			<guid isPermaLink="false">638f8c641a770900116d4468</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-do-i-need-my-bffs-permission-to-try-for-a-baby</link>
			<acast:episodeId>638f8c641a770900116d4468</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-do-i-need-my-bffs-permission-to-try-for-a-baby</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAqOdHbrn+ZRGddS1fpxy31l9kOl5Q1JtXdXmLn2Kxl7H73P8MZkz0OXWeQ1QPthuv5JihmkjBI5XEbJWWIJpURFFDd7PhQkjsTohFbqU1oItKWX2izLOynwpEYrpoU5AbsY9GXnGG58buFkFfx6WT+VCdH8OAYUKjTMqNKoadmZp+Vldb3TP5nB2RwvLXBsvta6MaurbhuEjFlT+n2zOCErTOlvUs+P/EnqpZgh8w2a2]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>170</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I went through his phone whilst he was in jail…</title>
			<itunes:title>Boy Talk: I went through his phone whilst he was in jail…</itunes:title>
			<pubDate>Wed, 30 Nov 2022 00:01:51 GMT</pubDate>
			<itunes:duration>55:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63866fdc4fbb340011e71c05/media.mp3" length="82607755" type="audio/mpeg"/>
			<guid isPermaLink="false">63866fdc4fbb340011e71c05</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-i-went-through-his-phone-whilst-he-was-in-jail</link>
			<acast:episodeId>63866fdc4fbb340011e71c05</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-i-went-through-his-phone-whilst-he-was-in-jail</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfszIUhbdrQiyVCvo1IIKIA5wARUc3QUoHKz/LLqK/scRdmZidayHATmy7qK2socJZpmz2wpLP1p6OHo8QT9spjSwhVRCq5WsA0Ax8xHFCGqumsFdUa7sEJUriDvWo+pjTMz7Hoc+3jYBejVFkBSvWoDOomTb7lxUN49Ypf8s8z2PCxCAJT0NMcd5J2ayv/+0hSoI+3OinTKUN6nL7wmPe4taJrg34f5Ww5nrsNnQl4m0qxYFqmG4XDhkd56HOhgfR6Ptb9nWgk0BeyXOZa1AzQ]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>169</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: They always come back…</title>
			<itunes:title>Girl Talk: They always come back…</itunes:title>
			<pubDate>Wed, 23 Nov 2022 00:01:50 GMT</pubDate>
			<itunes:duration>50:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/637d615a0f0e8b001045e0d3/media.mp3" length="75531619" type="audio/mpeg"/>
			<guid isPermaLink="false">637d615a0f0e8b001045e0d3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-they-always-come-back</link>
			<acast:episodeId>637d615a0f0e8b001045e0d3</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-they-always-come-back</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCes+yd5L92hcZvaNiMkpsm6VZaMaWp8wTlxYt2PG6pGLE0SO3ROaCIxZOvIKPa8jscKSKVHdC68LZtMuz+0avIOqLfg5qPSJ/a0A1QpbY9CzQqHa8Uza+yR9XgIOOJIA7nZGlGIdWQNwqBu0VXFFalCTNIWxdU4rinNzoZfcZA6c7R6RklTt2fkegM73990VjxHLoiGJhc6kRwrqfKd93En0qHMfpouZhR60RyTHCe1EgEQ/ZQLt2e9jS3Pzks+ucgkbVjTa6k/MhaIgMOk+ecP]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>168</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Do I need to tell his wife?</title>
			<itunes:title>Boy Talk: Do I need to tell his wife?</itunes:title>
			<pubDate>Wed, 16 Nov 2022 00:02:58 GMT</pubDate>
			<itunes:duration>1:04:35</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6373f98a1a14ef00110299ff/media.mp3" length="95303495" type="audio/mpeg"/>
			<guid isPermaLink="false">6373f98a1a14ef00110299ff</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-do-i-need-to-tell-his-wife</link>
			<acast:episodeId>6373f98a1a14ef00110299ff</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-do-i-need-to-tell-his-wife</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeB7AY/DpBhA8Sgp3OjQlhcavKr/iBYE9NZBd82m5X3ZPukyQOe7ml8nzsZbzEpTjy14fSaW0xzejl+v+X9V70Dar7kxi3iEuDFOwUrqdX3Yn+2IYVVz4/p9yW28uLkZQsA1ZKsY5ijt6O4/2EG1hT5QXJov1pBI34pwzKG5L1kf91vQcI6jKGyF92U3sd8fzhhP5TYpa6KCt/oCVDI/gkqhUL2a8iicZfGBHRzv4MP+uLNBtkBn5pUvwSiW1oRjBtWmzG69BO/+HQywTAjGG8e]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>167</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Married BFF wants my man! WTF!</title>
			<itunes:title>Girl Talk: Married BFF wants my man! WTF!</itunes:title>
			<pubDate>Wed, 09 Nov 2022 00:01:42 GMT</pubDate>
			<itunes:duration>1:04:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/636ae3deade52c0012ca82e4/media.mp3" length="96419570" type="audio/mpeg"/>
			<guid isPermaLink="false">636ae3deade52c0012ca82e4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-married-bff-wants-my-man-wtf</link>
			<acast:episodeId>636ae3deade52c0012ca82e4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-married-bff-wants-my-man-wtf</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdHlHqBn1eE0KaXLoEZzn+CPL+Hsmer+MoT5nvPuXve25K7p7SIWeeZbRb6T3aa0l9ipAN+NC9U2JP+msn9HULecFedpreH+yo+KNXcCbWzZjZ6v2SwIGtzpJMq9K4VxM0oxOUK1A+DbGEng6h0O8p2cij1+UxDmTnI04IVef0lkeCfV1pGAYSf8ZcD9naWMPcCa4lrH7uQmh1TDikVGvW8p1lzr5Q7x0YXHwv4ZteztBjuxUsNuO8UfeQPa2h9YHmRngo8lQf27iIpKtO98vZ4]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>166</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He asked me to move out…</title>
			<itunes:title>Boy Talk: He asked me to move out…</itunes:title>
			<pubDate>Wed, 02 Nov 2022 00:02:46 GMT</pubDate>
			<itunes:duration>54:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6361b1d5a539070011646f12/media.mp3" length="81296660" type="audio/mpeg"/>
			<guid isPermaLink="false">6361b1d5a539070011646f12</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-asked-me-to-move-out</link>
			<acast:episodeId>6361b1d5a539070011646f12</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-asked-me-to-move-out</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAhycaJbRKIA21m7K4S37KhAFHZBhHJBnqjiSxP64MrbPBPOj22k15l0KATIggcnOawNOwrGihHaGvxLdjqpT/KZvbRXXL6qclXtljre6nVJ489iOAqH8vpkJqPy6aOh/8Zra8YAiac39iYen7UZ4jhAEBJIl/ntIwke8oYcWBC2n2mI/WEU/uDbrLpfvYlePDPTnKl3WP12V2wJgN0CBV/5jvtNUAv1N/NFr0E5xaNbN]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>165</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My ex is buying my house…</title>
			<itunes:title>Girl Talk: My ex is buying my house…</itunes:title>
			<pubDate>Tue, 25 Oct 2022 23:01:04 GMT</pubDate>
			<itunes:duration>1:02:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63581b04c4525f00132a0a5b/media.mp3" length="92031984" type="audio/mpeg"/>
			<guid isPermaLink="false">63581b04c4525f00132a0a5b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-ex-is-buying-my-house</link>
			<acast:episodeId>63581b04c4525f00132a0a5b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-ex-is-buying-my-house</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcroJlO9sJTI37thV/Ql1Ooijk0KHK+hHw3KQaQ5rPgfFwDKWt3y25AZop+tEgT1mbyu0vTCAvE/nzVtopVRgq/RNkMZukK0RclP7o0t4j/ulymRUIQbp0ukxCrUXXB/b8/HlZQMwX8cSUduy8LxnJlvOwGBklk9I2iNPBUxYpdc04LNj+WDC/brFKt9OfJnbQLanHWoqd5r/KfzVeLiXSM8Sx0H+TUD99sUmI7YVj9fzl13NZeRHKGsPNNco3OZhYGyzV0KCHlbijONmjX5xLG]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>164</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: How do I tell him my deepest secret?</title>
			<itunes:title>Boy Talk: How do I tell him my deepest secret?</itunes:title>
			<pubDate>Tue, 18 Oct 2022 23:01:28 GMT</pubDate>
			<itunes:duration>58:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/634f183cce0a930011e04b99/media.mp3" length="86238422" type="audio/mpeg"/>
			<guid isPermaLink="false">634f183cce0a930011e04b99</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-how-do-i-tell-him-my-deepest-secret</link>
			<acast:episodeId>634f183cce0a930011e04b99</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-how-do-i-tell-him-my-deepest-secret</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdXJWRZqRwgQmWzs+BK717xq506b/tglsC+VF0vT7duf1H79Rp3DgnUiwLrax4bXtmQ2bX6Vdt4QS3rtTpFy+NhhFETVbC+dShD4ohHLStyCFEQQORWvk9KyOWV0SEGTCMDmSHWqvYDeBRBX9nZTynHOWgJahmKNcQSOqbmu5ZMI2s8f1BZcIlS+VqZpmzydJo73rUCHFtEHgyVhWBBU/9ehFPnGGEaNfLn0jAR/kx5MD8aEdM8CKm/E3+kCSNQcGL/gbGaQ+AjiQP7Hz6Ls/Rb]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>163</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Do I need a life away from my boyfriend?</title>
			<itunes:title>Girl Talk: Do I need a life away from my boyfriend?</itunes:title>
			<pubDate>Tue, 11 Oct 2022 23:01:59 GMT</pubDate>
			<itunes:duration>1:05:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63455b952fcde90012e6167a/media.mp3" length="95904006" type="audio/mpeg"/>
			<guid isPermaLink="false">63455b952fcde90012e6167a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-do-i-need-a-life-away-from-my-boyfriend</link>
			<acast:episodeId>63455b952fcde90012e6167a</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-do-i-need-a-life-away-from-my-boyfriend</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcAS9FBzygB9XeWYOGIldwse3G4NemylVNs3o/CpDVHPdhGAkmv+oxrGI+6MFC67a07tLv9gk5sy2cSoiuQSa2ijQY6iVNJGTQjDCPAIsznNaEgc0WrSlXLGsp2+HmzgGsiRxFCKdJezy3WegCMZEsH0sat9ADZ8qorqmHtXGZLNyWrb/9q8p1Gmv2QbPkeEXpQFMV3IbkROeH8sik9ZK55erEsbIQLput8dSLnK/CnEA+YMs0KFrLb1UrbvrMQWMDyBrM933ZJSOXxmrh8Z1Ah]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>162</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: How to know when to call it quits or keep fighting?</title>
			<itunes:title>Boy Talk: How to know when to call it quits or keep fighting?</itunes:title>
			<pubDate>Tue, 04 Oct 2022 23:01:22 GMT</pubDate>
			<itunes:duration>1:05:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/633c2fed36e1e800132b0e9a/media.mp3" length="97337367" type="audio/mpeg"/>
			<guid isPermaLink="false">633c2fed36e1e800132b0e9a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-how-to-know-when-to-call-it-quits-or-keep-fighting</link>
			<acast:episodeId>633c2fed36e1e800132b0e9a</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-how-to-know-when-to-call-it-quits-or-keep-fighting</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfWTisQm78vjIo2yMLXT0Enw9NbQscQoqYY21dAQSuPOAXE39kOMM18092wElI1+Svuyz7JrHF8J085SyzBG2cYOYwi+oQ5YxvYScdcyX/yEC/CFsULmFUovmcvqYLoyyYk5pTak6CK+NVV0lLGjFMkxqes67LYIfBXE2qkevjNi/SWsQENdOBpZ+0D/aBx5CvT9GeMdCAGDSAa+Zf5ZOBY0zpAqpJZMTHIwHZnoPdEdYM2LQm8BmRvf4kYPPp5qFwvc2uEvJxm3XkxMXlAfqPM]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>161</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My bffs fiancé swiped right on me!</title>
			<itunes:title>Girl Talk: My bffs fiancé swiped right on me!</itunes:title>
			<pubDate>Tue, 27 Sep 2022 23:01:54 GMT</pubDate>
			<itunes:duration>1:13:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/63332a4bee550200123c5d8b/media.mp3" length="107777293" type="audio/mpeg"/>
			<guid isPermaLink="false">63332a4bee550200123c5d8b</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-bffs-fiance-swiped-right-on-me</link>
			<acast:episodeId>63332a4bee550200123c5d8b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-bffs-fiance-swiped-right-on-me</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfTxtbgheODuNLHrq0HYSrPDZr1x2CEhZXNCswZ5YPhuEW7d7BvrSpETegzPhmWsBHfyDO+/cNF/2dBSrNb/259rxEDRQYTOSBuC6hE7OhQDLKOir8ec4ivlh12XkZL9gf7CzBFgJ8ydmlJLCt+ED1JhcGjgnpSZoFlMDlN52ZrFoCMEPxP1Ly9KMnbLkp5uQ36rhp1Ynf6gQ7az3FAaTZ/aqR+Pli6MYpKwrLO59mCpUcU2aDzFJx+2Ma+dNQ2EmfeJhAhfU4BI51iZBiWl9dd]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>160</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Are we both waiting for each other!?</title>
			<itunes:title>Boy Talk: Are we both waiting for each other!?</itunes:title>
			<pubDate>Wed, 21 Sep 2022 00:01:33 GMT</pubDate>
			<itunes:duration>1:06:32</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6328f8b12802cd001364fbfa/media.mp3" length="98057388" type="audio/mpeg"/>
			<guid isPermaLink="false">6328f8b12802cd001364fbfa</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/temp</link>
			<acast:episodeId>6328f8b12802cd001364fbfa</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>temp</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcavtaGiBhnxOsrRmfk7wI422KHh+lowJjV47BlENeW/VuVSNbxJd9rQPFsvNu5GpehxCfvwKbZ38cvDcjQTsRUG5wsgRSlEKYBXEPeds0oX3CZ7YE/7EWuX+llF6gytEH0lX3aVbYVslB62BW982evy7spBr9HP9hkbSaeGJJ884zxgUENiQTZ89n1zxjQevq94DSFflGTMb7wVcMmOFGU3AfRNrLM/gMSvapD5ry+z8OY2ypbpOSZrUTcHl9Wgk6ydrmhu21HBgs3XmSlCoOn]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>159</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I want her man!!!</title>
			<itunes:title>Girl Talk: I want her man!!!</itunes:title>
			<pubDate>Tue, 13 Sep 2022 23:02:43 GMT</pubDate>
			<itunes:duration>59:48</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6320eeccd962eb0013f58b8a/media.mp3" length="86385652" type="audio/mpeg"/>
			<guid isPermaLink="false">6320eeccd962eb0013f58b8a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-i-want-her-man</link>
			<acast:episodeId>6320eeccd962eb0013f58b8a</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-i-want-her-man</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd3gy9lBaCqC6xmAPYuEpnejTV50twmXeswpZkYGFeuMnNMDVAgtzIVTXDx1aMl1z6k+vQfMaIgtMUJKYO241iKfhmySgZgUHUZ3Zk+S8wGsxvnm+mSa7W8jTlCabaomRuYgoar5xpP60fJJRqycqCmfPgIXHt+QNEaEON+xHWc1RTuxFuxl/wgxyIq6MNMalqWEG4ZAuXI2/vEHgTgxeG9mXBuO4u1sd4eVz+BNFBFgE4xIMzTSi1ir3vO1ndmrm6ChBtnJtTtiN/TmWvVJ/Pj]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>158</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Kissing colleagues!</title>
			<itunes:title>Boy Talk: Kissing colleagues!</itunes:title>
			<pubDate>Tue, 06 Sep 2022 23:01:54 GMT</pubDate>
			<itunes:duration>1:14:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6316828db5acb70014540a3d/media.mp3" length="110630911" type="audio/mpeg"/>
			<guid isPermaLink="false">6316828db5acb70014540a3d</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-kissing-colleagues</link>
			<acast:episodeId>6316828db5acb70014540a3d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-kissing-colleagues</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfMe26mxVeYvFJpaXvIxLBnxtTV32rIL3oNOwARvoj86CNvR8UYLspElSHRDuvNuXTbk0DPgwNBUq4ull4ZSq/7ppzHfQWFbUZ3NNhJGrgfiO4Sqd+3gpkprEcxEKFItmbwZTS0aaMyvVPOK4jVTYfuyUWWEKxJk9s8gP0FuaU4KcBSW7HJ4JDhMpD70vCDbtlxT+806Udum78E40P7XmSZMKVM+oVzbqljKL2fM5tFDtJa2A1mnFaeqwuU/lXSTR3NSnLr7idd04MTu4wN5vGp]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>157</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Fired from my dream job!</title>
			<itunes:title>Girl Talk: Fired from my dream job!</itunes:title>
			<pubDate>Tue, 30 Aug 2022 23:01:33 GMT</pubDate>
			<itunes:duration>1:12:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/630e770f69cfaf001367d5b3/media.mp3" length="107829213" type="audio/mpeg"/>
			<guid isPermaLink="false">630e770f69cfaf001367d5b3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-fired-from-my-dream-job</link>
			<acast:episodeId>630e770f69cfaf001367d5b3</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-fired-from-my-dream-job</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCee2JKLZZGC/P8qOeE3lmHiwnJIl6ar7RZzo91dzfPAusr0y+Uf/veMQdexLjWKerEyY6AdYQGRlJWPQ/5emNKVqIE1djb6XN9yoRXuAfTvNJxUaLMgPHI5DyrIiOWSOa/ViAQ9tCIyNjz9vZtItRShmK/gBB1KV+4OwQ4Xk2ndRNeL26QvWA0tlLfMRllI0uNqOnpwq+96xBF+bYInmIy2zFKT6dw5RzmySE8taREVDbqS+EMplbbGa8OX3e4GsVwHTWocx4QzNSAoI1b8toWq]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>156</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He came home with a love bite!!!</title>
			<itunes:title>Boy Talk: He came home with a love bite!!!</itunes:title>
			<pubDate>Tue, 23 Aug 2022 23:01:45 GMT</pubDate>
			<itunes:duration>58:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6305455a8379b8001355ead3/media.mp3" length="86851990" type="audio/mpeg"/>
			<guid isPermaLink="false">6305455a8379b8001355ead3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-he-came-home-with-a-love-bite</link>
			<acast:episodeId>6305455a8379b8001355ead3</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-he-came-home-with-a-love-bite</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcUGpnXpaAWz3AHh4UPKYLy4BDTinqOVTby40bhUPOvfZFXFKuaSrT+QE3ZxAFSDmfn8fUwsd20UGu7O+/Au6Dpszt8nVfjtdJXIto+S6RNaZYE71SuYJ8XhoRnm5UoZz5wt6kZ5UR2g/U/7qzH0a0FcNKp0jezOX1tO/rG8QwuWQ6hFPRRsmSFsJgeySLcuQ2Y1xJJXjlNJvAmwrYNc+cImpPR254MjraFcHQYq3jBySUOJ6w2t1u8hpev6XmF6/8piRwD3eMj2jfAk33pNIUZ]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>155</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Do I tell him I’m a Sugar Baby?</title>
			<itunes:title>Girl Talk: Do I tell him I’m a Sugar Baby?</itunes:title>
			<pubDate>Tue, 16 Aug 2022 23:01:58 GMT</pubDate>
			<itunes:duration>51:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62fbeea664ece300125a4fb5/media.mp3" length="75739076" type="audio/mpeg"/>
			<guid isPermaLink="false">62fbeea664ece300125a4fb5</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-do-i-tell-him-im-a-sugar-baby</link>
			<acast:episodeId>62fbeea664ece300125a4fb5</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-do-i-tell-him-im-a-sugar-baby</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCehVXw3dSp5wAV4BlazpMawWVt1LZu1obTQ+Y9V4V5GO8kYzmh+BabqY4GFQTgTVVIbLWRzPWu4Yez7UQPc+TCfyQpRcFKXgL3u579Y8y8niJoMZZFmJZZ051hUmkStAvRQDgdriXYzXC4LhCPyJQvDq+cbdOoMdN0u4+EvNdVVRC2umetL60hGgrlYtdICOBnRtPA2mn+X0v2nOhTmXpo6s56q3Wft2mzcmh/M9c4zzwW2eJONFf8Oj5cc6GZxndGhEk5Syb741KlIS0PGG++k]]></acast:settings>
			<itunes:subtitle><![CDATA[ Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>154</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p> Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p> Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Do I believe him or the girl?</title>
			<itunes:title>Boy Talk: Do I believe him or the girl?</itunes:title>
			<pubDate>Tue, 09 Aug 2022 23:01:11 GMT</pubDate>
			<itunes:duration>59:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62f250d6267f670012850ced/media.mp3" length="87753747" type="audio/mpeg"/>
			<guid isPermaLink="false">62f250d6267f670012850ced</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-do-i-believe-him-or-the-girl</link>
			<acast:episodeId>62f250d6267f670012850ced</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-do-i-believe-him-or-the-girl</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfYmlHCAxgwN2OqCAQx/NhF+v/PKIcIg0oR+/WhH4+m0QBK2njbCtB4FpOwK2rJPifcgywGXUQaKHwVFNJ26BeQg3XUxYEudQKj7/W2IxlyRBfJGNDkJ/pZE6jJFPoSckgv+6PPLptT6cb3J2SNw0Jg/BXoXFxeAt1dKOmUXLhTQpmiXW37uzZYV3V2KR2S2jfQfJ537E6VDxszR/Ms06Fs2i8HpoUDD5e2BPVc+oeosyX2/Q50fJNAuQUUtfcFXgLnPZr2N58NsCh8POOitoc9]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>153</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Ugly Duckling Syndrome</title>
			<itunes:title>Girl Talk: Ugly Duckling Syndrome</itunes:title>
			<pubDate>Tue, 02 Aug 2022 23:01:53 GMT</pubDate>
			<itunes:duration>1:06:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62e991d0807bfe0014398e56/media.mp3" length="98134804" type="audio/mpeg"/>
			<guid isPermaLink="false">62e991d0807bfe0014398e56</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-ugly-duckling-syndrome</link>
			<acast:episodeId>62e991d0807bfe0014398e56</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-ugly-duckling-syndrome</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCed5fKLPp4AvIxi1UnnpStY+D30o5de8UqLXL7rEMka1eDzo2lXThknYEFvihvagymPP2XMJ7PoXSxW0+wxCFV542HoN17/ijgGN5nmIsANaZ2wyGGQu9oVwO2MOdKifk/KLAJ7IWTAzewNDl9v269iBfyM24E/rfVBUgZAwPosj7DbYh7OyssmYEs6gdwCnqu2PTz2STDhtstzzGoOzVv2TJhm+Mqkz8rGPXN3rt8tmdBvKdHyv97xAY6tpicF+zgs+PCdznpKJm62UHhIIIZZ]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>152</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I FOUND A DIOR LIPGLOSS IN HIS ROOM!!!</title>
			<itunes:title>Boy Talk: I FOUND A DIOR LIPGLOSS IN HIS ROOM!!!</itunes:title>
			<pubDate>Tue, 26 Jul 2022 23:01:11 GMT</pubDate>
			<itunes:duration>1:01:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62e004b3a16d94001405a9b4/media.mp3" length="90520393" type="audio/mpeg"/>
			<guid isPermaLink="false">62e004b3a16d94001405a9b4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/tbc-32</link>
			<acast:episodeId>62e004b3a16d94001405a9b4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>tbc-32</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeKoG77DG5KptT1NRRf3vz5NJCTqOUxrFRIeDNGw4PgSuhyjXJdg9PkFTXnVsripVyZgC2GaMfGGJz0AxUeIMISLqcZ5fiknCyiWOJhpAhkJxAHd64BZZxutVxqj/uZy0nTEdiRG4ry24RB455e6Gjq8NM4hFtT8YiKbTR3iaSY79vVwQ1xW2ek/scKJKufAaEEGQ+4nJyqFxagINlrWf6ePf4QVKFUKieCoLGBl1OQoJ2QKRUb1Y69EvVilUNqKpW2XPVxg9Y80G2NARmxN7Yw]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>151</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My friends are trying to force me to be single…</title>
			<itunes:title>Girl Talk: My friends are trying to force me to be single…</itunes:title>
			<pubDate>Tue, 19 Jul 2022 23:01:02 GMT</pubDate>
			<itunes:duration>52:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62d6c11aa8beae0013d4fd87/media.mp3" length="77446445" type="audio/mpeg"/>
			<guid isPermaLink="false">62d6c11aa8beae0013d4fd87</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-friends-are-trying-to-force-me-to-be-single</link>
			<acast:episodeId>62d6c11aa8beae0013d4fd87</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-friends-are-trying-to-force-me-to-be-single</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcwU0JTpJgcWE71Bk9jTRnv5biXtcpS3+LQoCasUfPcgH0zWnGf0SCDel3SrIfnhXM+Mnoad1U+FDCOrRU79wRCW15mDpx8bc4T5MVAOsRyjFK2br5YKRzeOaTY/q7n4R2cbE6Kfd4B2JG9enw/M7L62yrdhoKn8b6oqAjRArxVG1K2kMerMFJPtLNFf1OsrktJiErkxp7hys2/oQXQfN4z2csuUBxccsRu0+8XvgMTuLI8xKrditIJeb5Z8i3C8qjT6jI63qyqsqkN4mNIVoeB]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>150</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Am I the F*ckboy!?</title>
			<itunes:title>Boy Talk: Am I the F*ckboy!?</itunes:title>
			<pubDate>Tue, 12 Jul 2022 23:01:07 GMT</pubDate>
			<itunes:duration>46:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62cd3d509c46dd0013f8cd07/media.mp3" length="68022626" type="audio/mpeg"/>
			<guid isPermaLink="false">62cd3d509c46dd0013f8cd07</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-am-i-the-fuckboy</link>
			<acast:episodeId>62cd3d509c46dd0013f8cd07</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-am-i-the-fuckboy</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAsDHqru9GfCbTT0D6i1pfVmd1WePqUEcbAW/nvax5/saEXfN6aXQh/m6kKdG43o+OgIsM149AGopXWzG37rNTSjxN2z10WEskivRSA6EUJsBkhtwRHGoi2gJATFqXVIABjlAOTVKgzVs1mq1s9X7Gp4NWfsZGxxzZztJRNt3XFW8+fMZmz5d17oyCgFmhEOP1xYQSJu5Gg9MuNsrdmpHdFr89kjNIt4Agafh087WB+Zz]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>149</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Bringing tinder dates to our BFF plans…</title>
			<itunes:title>Girl Talk: Bringing tinder dates to our BFF plans…</itunes:title>
			<pubDate>Tue, 05 Jul 2022 23:02:12 GMT</pubDate>
			<itunes:duration>57:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62c3558c53e6ba0013e048b2/media.mp3" length="84228705" type="audio/mpeg"/>
			<guid isPermaLink="false">62c3558c53e6ba0013e048b2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-bringing-tinder-dates-to-our-bff-plans</link>
			<acast:episodeId>62c3558c53e6ba0013e048b2</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-bringing-tinder-dates-to-our-bff-plans</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfQMjWhPrRkNOn8vchxE83nHFD8b4k30tINJWWfQHsDC1f8ejV7Ad9zXal6EOrkjAFWNGDYYS9MZMEq3GNMqHUaC2V7mJvV9FrdqfaRfg1ZFS3cvkH2YvJgjpQtCk74nDOfPRlrXe4MnqcP3Iv46AiemDrSpKr/RaARKo/jkz94H9xW8QZQqzlXQmCg61Hz8xispNoaHg8WuOdPDHjdavUE7s6b2K7JamNEMnYoIS0yQaPII1xAqy9fPKtgNUpQq/mOchde+W1zTbGFrJ5tl29a]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>148</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My Boyfriend applied for Love Island!!!</title>
			<itunes:title>Boy Talk: My Boyfriend applied for Love Island!!!</itunes:title>
			<pubDate>Tue, 28 Jun 2022 23:02:27 GMT</pubDate>
			<itunes:duration>46:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62bb81968fd9d00013be47ad/media.mp3" length="69002321" type="audio/mpeg"/>
			<guid isPermaLink="false">62bb81968fd9d00013be47ad</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-boyfriend-applied-for-love-island</link>
			<acast:episodeId>62bb81968fd9d00013be47ad</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-boyfriend-applied-for-love-island</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcSu+O7Q8z6bFNnWIfTvOYWixIkDKr9ls4hzYXytsM0d5Fie7FSZwKnt+0ut11Pfgenec5ugBX9nouMjkVcCTLPma66FC2ZIvpUhR/6DLMHgm9cDrs00wIs0Zgiu5pVXWWdLbRhQGmK26u9bcsrKjh+GPHNEngyln2Qz2aZr3ipclRLWI/fAoOoIfu2DApla9hYzW7UMLAb9oaxPBun6wmd/jrEXRHh1tkx+qOG7iq30XZvqjy3CcsgYUENdLijl4OZ/uLy+LgW1lSIjdWYinoK]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>147</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Thought I was straight but I’ve fallen for my BFF!!!</title>
			<itunes:title>Girl Talk: Thought I was straight but I’ve fallen for my BFF!!!</itunes:title>
			<pubDate>Tue, 21 Jun 2022 23:16:58 GMT</pubDate>
			<itunes:duration>47:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62b250e35513320013f59cb3/media.mp3" length="69694141" type="audio/mpeg"/>
			<guid isPermaLink="false">62b250e35513320013f59cb3</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-thought-i-was-straight-but-ive-fallen-for-my-bff</link>
			<acast:episodeId>62b250e35513320013f59cb3</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-thought-i-was-straight-but-ive-fallen-for-my-bff</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAgnWlE7idth55HZI+DQfc1jjqctKTakfWIBSGy057mvOvMVTBXlTlDrI9f8QgBrKXWYtQTctYsCkCXuWihHT5IL7EPepQ/Xs2w0JLqCq1zhDD51RqozKLvjVT4pJU1vCxD/41QXQ+4VlpTyY1GgBepnFWHg/EXdw/uBHX4xYltmawcuH2P1atAuIJhMsAL5bMzKQTJk4ZpiTuAYVeTZcIlDrqjlAX6YXh+tXGExvHMfH]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>146</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Boyfriend forgot my birthday!!!</title>
			<itunes:title>Boy Talk: Boyfriend forgot my birthday!!!</itunes:title>
			<pubDate>Tue, 14 Jun 2022 23:01:16 GMT</pubDate>
			<itunes:duration>1:00:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62a8bac045b61c0012a99c51/media.mp3" length="89118921" type="audio/mpeg"/>
			<guid isPermaLink="false">62a8bac045b61c0012a99c51</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-boyfriend-forgot-my-birthday</link>
			<acast:episodeId>62a8bac045b61c0012a99c51</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-boyfriend-forgot-my-birthday</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfJaFjB2IXcs+9RZ5pal+SWiRmcXIEVOVZRcCQeaX1nXYlY7K/PQWDClK8s9kWPuDIfhHtKgGOllX7fxn62YA7vdKg+pcsoXyZ7wtR3XSUeB92AtKSMIuAE8QuNDPXKmj8a/1HZf6AQ/23MKuw+YPfxUdzbCH2rcDfHEglhlwime0GBeFgO/sBLR1aAANZNHVppdFXJMKed6MnKw/i70j8JACxlrBN3ugh/ayZ2AdfBKTBPxCZGTJ5Hj/2sIZV+gnoUoBKKUmTx7CMaUozl2/2S]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>145</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I don’t want to go to my besties wedding…</title>
			<itunes:title>Girl Talk: I don’t want to go to my besties wedding…</itunes:title>
			<pubDate>Tue, 07 Jun 2022 23:02:32 GMT</pubDate>
			<itunes:duration>50:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/629fbd219f12fd0015cad691/media.mp3" length="74151712" type="audio/mpeg"/>
			<guid isPermaLink="false">629fbd219f12fd0015cad691</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-i-dont-want-to-go-to-my-besties-wedding</link>
			<acast:episodeId>629fbd219f12fd0015cad691</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-i-dont-want-to-go-to-my-besties-wedding</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfKZDrchXI9f9IIDpMcwKYm1bOOI7AB5rK2CXP1tW2/oJr84qL4VFAOoqojOqgoRtrN1bQwIBrpJU6f3gaDQbGWueWMC7ezimJ7dwifbIYXZmnY9VCnm1SKLnVPKkotg/KG1Ofbs32FmNYUeQL05E4Ka1JgOKls92b+7hW3w6lwKuZZktJmcEjiFKHMkycrpkiOkfTj9dpHqdBmfsVoWD7t1UW3Ro1TGfkKmYK7SjlSRCne8falTUtpdDtwmMQyHXmOGe0jqwdncvzHcJjFPPCN]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>144</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I cheated!!!</title>
			<itunes:title>Boy Talk: I cheated!!!</itunes:title>
			<pubDate>Tue, 31 May 2022 23:44:07 GMT</pubDate>
			<itunes:duration>1:03:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6296879480a1300013fce592/media.mp3" length="93987708" type="audio/mpeg"/>
			<guid isPermaLink="false">6296879480a1300013fce592</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-t</link>
			<acast:episodeId>6296879480a1300013fce592</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-t</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PArqMymHyGH+DKHCqcW3b5RuvqupfvoC3zM6WtQdKPIw0Vhv+mxSIJaECcp2QzLSiTVXOzW1cvpUjDy4SxcF/SwL+EOfLuS6XJ9xZfZigy8zGk9TJZNUasTDHBO6HGb1FuSP/bKr7wXcf3KQgd4AACEoqL4m5TIAgPgBX6S3haS7IXeZK4bdjFlalPORFkhkhEhJb6PIn6qaS37RrDJwftck=]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>143</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Are the girls worth the grovel?</title>
			<itunes:title>Girl Talk: Are the girls worth the grovel?</itunes:title>
			<pubDate>Tue, 24 May 2022 23:01:21 GMT</pubDate>
			<itunes:duration>52:26</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/628cb955afcae40015cd9086/media.mp3" length="77278676" type="audio/mpeg"/>
			<guid isPermaLink="false">628cb955afcae40015cd9086</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-are-the-girls-worth-the-grovel</link>
			<acast:episodeId>628cb955afcae40015cd9086</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-are-the-girls-worth-the-grovel</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PArW9iGMwMd43+ST9zXV3g4umnNU4Ge/2SpSRWWCcPeE+VuteUPG2sFKjdnDmMyFarVTSx02Mks90KTZEg0mb8txvwZsyHcqDGwtu4rgKkVAQ/2NsgCuTxtFivaIFQk/qOh6P+EUe0WOqbt/iyf5vQl0o+UkkAkX6y/vP34E/cVbsRmcbMw5H8SMbvzbRbDlryGM5pYoAfdBVYhkcxNlKJx8u8SFOo46IDd2r3Mj/W88M]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>142</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Is he cheating or proposing?</title>
			<itunes:title>Boy Talk: Is he cheating or proposing?</itunes:title>
			<pubDate>Tue, 17 May 2022 23:01:02 GMT</pubDate>
			<itunes:duration>1:07:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/628413684c4f5b0013df1403/media.mp3" length="98746803" type="audio/mpeg"/>
			<guid isPermaLink="false">628413684c4f5b0013df1403</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-is-he-cheating-or-proposing</link>
			<acast:episodeId>628413684c4f5b0013df1403</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-is-he-cheating-or-proposing</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcQzLagWQK16DL5OMwUI7LZJ2XnO2ZVbna29Shfx+wyxmInYUjxPuOGCWREKbkBxZl8z3lm+Do1kn7tAqVdi47SXtEV+Z2zGatFBaHT/4dF7mqrHi8JTxKaHfUhRjGKXpjpbDi/YXdf7tuHGv508KH8S+OBBP+LBTxaqJXmvbEoiy/9BwAQJXq24UiI20w6icMcKSydnS39tLYlE2QSTfAvCUFzXTFkNuxX51ix0mXeRErmNiqh6JZw8dl/3z+N44LCpYeamLFBqmhqXItd5LwU]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>141</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I ghosted her but now I want closure…</title>
			<itunes:title>Girl Talk: I ghosted her but now I want closure…</itunes:title>
			<pubDate>Tue, 10 May 2022 23:01:07 GMT</pubDate>
			<itunes:duration>53:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/627a8db607897900158274d4/media.mp3" length="78378535" type="audio/mpeg"/>
			<guid isPermaLink="false">627a8db607897900158274d4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-i-ghosted-her-but-now-i-want-closure</link>
			<acast:episodeId>627a8db607897900158274d4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-i-ghosted-her-but-now-i-want-closure</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf17ZDJ/MGRptyhJPc9WqAMzo295e7JVL2gj8QoykOg4IsdPOy4UCFXs9M3VX3MFnVCGUzHEEx5nWjblX3a/tbSoUVnlfQlI28qN6JOusBmqXJpeaAKitF8r3UVaYXcjdkNdkO0IXUMIom2vrxF//q+8VyQW/XzqhE2MXeMhq4AS2e7LDh89Tl03cKVAV1nrtYJLeqkmmzXj9ASxyFpcdIQg1LIleJ4blaFX9+IjCwpp+c/rNBLSnHlMOw+0sAU9XC5+DV2cYMzuJtHR9/LFkCR]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>140</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Why do men move on so fast?</title>
			<itunes:title>Boy Talk: Why do men move on so fast?</itunes:title>
			<pubDate>Tue, 03 May 2022 23:05:23 GMT</pubDate>
			<itunes:duration>58:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/627119fd97a98200136eff45/media.mp3" length="57904097" type="audio/mpeg"/>
			<guid isPermaLink="false">627119fd97a98200136eff45</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-why-do-men-move-on-so-fast</link>
			<acast:episodeId>627119fd97a98200136eff45</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-why-do-men-move-on-so-fast</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCc2K0tmMxFqaXeGjXXkja/m8D16SwXLHv3XI+pQw8PMaaLvyK2AyhqtuebgjqyyhrrjlKYhP11jN+L1zvWvXgS4Z9Zrpd8q4bOAA7yDe82I6bl9WHQL6RGFO8T7Zh5pBANzYdopIYgC4vunrVM48OETVr7Q2/eX/mYsiQx+tXcsrH2/9lDS1n5ep/eskYYJBtns1Ctwe+STfHK1skoZQStM2v/ITT7vt6Uw0HOVeNjwwO/l/ymGBfWDfXcMqs1w73NQPuAnwlzXdVMuIFvjbKuF]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>139</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Is it wrong to give up on her?</title>
			<itunes:title>Girl Talk: Is it wrong to give up on her?</itunes:title>
			<pubDate>Tue, 26 Apr 2022 23:05:57 GMT</pubDate>
			<itunes:duration>45:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6266da0acd615d0014fa93d8/media.mp3" length="67633419" type="audio/mpeg"/>
			<guid isPermaLink="false">6266da0acd615d0014fa93d8</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-is-it-wrong-to-give-up-on-her</link>
			<acast:episodeId>6266da0acd615d0014fa93d8</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-is-it-wrong-to-give-up-on-her</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAkyMVVDPByy8QEFWfS764AjuSVrI7E0KG1Pv4Al5YKDmjrby1WmcSSmoHNZswAD00AWT0o+ZOFSLtc7njfQgOEBl8Zvs3sAJGWSv+X2Icza2kYjSF0TfTpIh2RTfiV7K/XGXLQgxLSMm7DQpRhDrlNB1apCAY9Z+8uMfwOytcd60LEoeJqzXwhpfQhS9N0akf+5KWQttNtCV1VBhP4Uhnr53LgLxJspZP1oi4JUKP7rv]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>138</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Is it a sackable offence!?! SOS!</title>
			<itunes:title>Boy Talk: Is it a sackable offence!?! SOS!</itunes:title>
			<pubDate>Tue, 19 Apr 2022 23:05:24 GMT</pubDate>
			<itunes:duration>1:09:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/625edf39534299001200016f/media.mp3" length="68618492" type="audio/mpeg"/>
			<guid isPermaLink="false">625edf39534299001200016f</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-is-it-a-sackable-offence-sos</link>
			<acast:episodeId>625edf39534299001200016f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-is-it-a-sackable-offence-sos</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcBUr7xjTrgM+DVC/6KFDen3iZASJhYoHwmkurKq/BsPmwiScjF3jm8vn11JEBLBRfYdox/UcdxBV56Pb/MLFBNwO0xZEooo++eyAuwDYhmoDO6WKj+1UlTaUfSlULtf5gL+c0O36LalhJRl0LugEZsWxX4aaI2H7MWecxyj+M9QCEPzmfw47YfQymdsnZp5Z/5QDR2MJyPWumkjXcUTInZikDAErAfRUEyyuQ2bufkKLlgi6uq8NGx5yOrY/ziT3Gxk/vmukmQrOjuoKRxb6K8]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>137</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Is copying flattery???</title>
			<itunes:title>Girl Talk: Is copying flattery???</itunes:title>
			<pubDate>Tue, 12 Apr 2022 23:05:54 GMT</pubDate>
			<itunes:duration>42:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62557e57f25a1200130a4dbe/media.mp3" length="41566769" type="audio/mpeg"/>
			<guid isPermaLink="false">62557e57f25a1200130a4dbe</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-is-copying-flattery</link>
			<acast:episodeId>62557e57f25a1200130a4dbe</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-is-copying-flattery</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdJsevSlXLXd2BFuMMhM2VGFtjWwxk40WIDqHAgN+VbawMvK30OVKI0XNM7HO8YKc/9hHQcFoGnyN1ecOySm8PHM7BBDwIEu59Q6pnLNUTVs3PjKZnGQMfefM6X/sp06OsnpxgnCqEMP55zphjLKFXGl6ae7+hWj7Y5LvoxeDJKl62lCkkP6YH0wl2kHsV4H7DTOm7yi6YHTeafobBjVGYhcjCOhIrl4b0hFcbsFn/lC0hPAPb9XtX1jcg6kckdb5IihXqha891ql6TBbsHcRXr]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>136</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Does this mean I’m bad in bed?</title>
			<itunes:title>Boy Talk: Does this mean I’m bad in bed?</itunes:title>
			<pubDate>Tue, 05 Apr 2022 23:05:03 GMT</pubDate>
			<itunes:duration>59:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/624c1641b849d80012e82ed0/media.mp3" length="58588253" type="audio/mpeg"/>
			<guid isPermaLink="false">624c1641b849d80012e82ed0</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-does-this-mean-im-bad-in-bed</link>
			<acast:episodeId>624c1641b849d80012e82ed0</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-does-this-mean-im-bad-in-bed</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAnkh0xarVMxSXSfv5YoxiSSdr21vtRB6AQek8405+SjPjasrM8Pg1M7xEKwG05Sk6a5sfsl6o8q9kGdA5ypV2OWRkkhAg0jQpX110bMg9lWAQQLj4OF+hzQCys6oNJAqfX+5uzFHxz97cHJ0+14OfJYdZfWEEljJ4qOLMqEt7xMk3cUburJdaSDfw3b7OWeLJlQ6+TB+Ii+L23xv9LbpdwkJzTt++eZ5IiuAh3+H5VoA]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>135</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Losing respect for a best friend…</title>
			<itunes:title>Girl Talk: Losing respect for a best friend…</itunes:title>
			<pubDate>Tue, 29 Mar 2022 23:00:00 GMT</pubDate>
			<itunes:duration>58:25</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/6243f3711f3c4b0014a14b76/media.mp3" length="58082222" type="audio/mpeg"/>
			<guid isPermaLink="false">6243f3711f3c4b0014a14b76</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-losing-respect-for-a-best-friend</link>
			<acast:episodeId>6243f3711f3c4b0014a14b76</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-losing-respect-for-a-best-friend</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAphyj3MeCRSRlwkPde+fuAQyt/yGdFKFpLWkSJblWdYw6oVZ7/WnF64ZDx/03HX3PdsZsbgMsY9mFLa1ZZHvi+mSDadJKk6witGMYqf0pXVbt3WYvbgiKfqiYiE0B+2s0Bd0SEoYgs7uhcINGkGqREiwWbGEYVkQDV6NECl2XWqxFmDvZBO+kNdi6g5EfvHTjYNKXWi+egX0Y45N+T0MFjYTGDDpklnZXWfzjDH9N2WM]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>134</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My boyf is 10 YEARS older than I thought he was! Help!</title>
			<itunes:title>Boy Talk: My boyf is 10 YEARS older than I thought he was! Help!</itunes:title>
			<pubDate>Wed, 23 Mar 2022 00:00:04 GMT</pubDate>
			<itunes:duration>48:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/623902c064569d0014e1b0fa/media.mp3" length="48172531" type="audio/mpeg"/>
			<guid isPermaLink="false">623902c064569d0014e1b0fa</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-my-boyf-is-10-years-older-than-i-thought-he-was-hel</link>
			<acast:episodeId>623902c064569d0014e1b0fa</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-my-boyf-is-10-years-older-than-i-thought-he-was-hel</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCc1Py2PNP9CgXpCimL7rBIo8s79ZKnk23dFl8ULZEwlfwJ40MPvv0PSgyGp5N9ebJ93ke0o0Ahs2X5Jj6KxWq0p/WmYequs5J9ewkZz2ifNIcLorqQQ3f7/OJLpeENwyTeiLCksL6eG4LNL6rLSUpEP99lYdm6+tu0tcPHnkvL9szCALf8xxd0hYvXkzpkHjaz0usVT/S2hEADoFhV4AHcasWGue2r1gCfyW2MRoZkAwE5bPSlzds+BHSoWezV9VF0TN0sTYwcqRNfCwyJ6xQJ0]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>133</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: How do I tell him I’m a virgin?</title>
			<itunes:title>Girl Talk: How do I tell him I’m a virgin?</itunes:title>
			<pubDate>Wed, 16 Mar 2022 00:00:16 GMT</pubDate>
			<itunes:duration>42:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/623094c095b8930012a6b2d2/media.mp3" length="42577516" type="audio/mpeg"/>
			<guid isPermaLink="false">623094c095b8930012a6b2d2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-how-do-i-tell-him-im-a-virgin</link>
			<acast:episodeId>623094c095b8930012a6b2d2</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-how-do-i-tell-him-im-a-virgin</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAjfXQtKMmH49BuBrKNPPouxlCfoYr5c+eNIvleBMxxCGag5KqftZGIsHz299tGPd7Jy/Y9Zp28NzP7bwoS8jS8+W9174sCpyJbzELAXg366M/wPrjKGcmRoFDojPs0CNYyXNu5MPrGarFomlm6LnzjWRJfjQoqZYR69VHh5chpWhGarUWgfAWXwFCcYpF5PGGEnKPqrBXaDXzoi0HjaHhSom4FZwBH7ri7ODJUkxUeRu]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>132</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/f8e139f6-ba86-4fe1-ac66-1b415a373faa.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I heard him slagging me off through the wall!!!</title>
			<itunes:title>Boy Talk: I heard him slagging me off through the wall!!!</itunes:title>
			<pubDate>Wed, 09 Mar 2022 00:00:08 GMT</pubDate>
			<itunes:duration>57:23</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/622805731a31d40014ed1894/media.mp3" length="55519324" type="audio/mpeg"/>
			<guid isPermaLink="false">622805731a31d40014ed1894</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-i-heard-him-slagging-me-off-through-the-wall</link>
			<acast:episodeId>622805731a31d40014ed1894</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-i-heard-him-slagging-me-off-through-the-wall</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf5+tUD0pZEXUeCiQAx+3EYQ9sbMVk+5dilq4TsM5Mq+GCYUCQJJZ6ZwtM1yvBng5u9kaHdjhj2EKxGdjQZOfrojfQP1PqUxbz/2JgpLG4UQ69NEM1Wq0i3efedEUVL+wjsJ49Qh5GUP0fM3M9L/4nIYLXHSi2dNTYTGybPZXVMwm921ClKcxqwX21SprKT8bzsnCdckQOZ1FrRk5YWBOhe77iYxEUihdi+CJ6Ejkdf2/q/5HT/d1thnSiY/SXVjaSlDmjHkpjXd3qHea9Gzioj]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>131</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Lending friends money...</title>
			<itunes:title>Girl Talk: Lending friends money...</itunes:title>
			<pubDate>Wed, 02 Mar 2022 00:00:39 GMT</pubDate>
			<itunes:duration>57:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/621e3274deae540012482085/media.mp3" length="56614739" type="audio/mpeg"/>
			<guid isPermaLink="false">621e3274deae540012482085</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-lending-friends-money</link>
			<acast:episodeId>621e3274deae540012482085</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-lending-friends-money</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe/+hf+EwSLrz8fgnnKcyRiLsQCQo9AgktYIFI5o6QPXn7QtgH7FqCIJ3KP/Ht7ZrKiOWVoxYClYC5rylnIIP8DTQxP8cl0jLJZwaDOTzJh57JLx+en4P/CAW6pQLbbqgMlb/2qRVc2movtVnrJGGszI3Jh1zbNgK69mfIUpYhTC0p/uZKZePy7IdG4gPde25Dpx3xVrdPOjqslWihEz+INZewxhRZwW9ojbjDov/Z44l6zdpHW34jWqXnr9lRD0oByVbckR0fG3AQCda0IjL6j]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>130</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I found another girls THONG in my mans pocket!</title>
			<itunes:title>Boy Talk: I found another girls THONG in my mans pocket!</itunes:title>
			<pubDate>Wed, 23 Feb 2022 00:00:47 GMT</pubDate>
			<itunes:duration>54:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/62156b431fc6910012773dc2/media.mp3" length="65574055" type="audio/mpeg"/>
			<guid isPermaLink="false">62156b431fc6910012773dc2</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-i-found-another-girls-thong-in-my-mans-pocket</link>
			<acast:episodeId>62156b431fc6910012773dc2</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-i-found-another-girls-thong-in-my-mans-pocket</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdSYAluWGJCvi4mwfir4WDYrMFI0OpJGtaf21WTb7AcGYRBLlMGXmZcFuAlKe6vsKvJuwUiEQb7mnXl7c2q95eQMjctNz0Hv3W9IFda/DBq70IKiLTpG84Dkdvpr9sirwqg8JODNRaxBrRatbJJj6fBCfcr90WHbY7GBhEFzZ2ROc69dzJduXyY0ppkX00tGWH2v4zAdtN0+LH9HZ2+8CgB1ETdHGmbLSeJfYfpq0/pkuuRNTdx7diKORxuydK+UUAbF22KL6claGjrCW5+knk1]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>129</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: My boyfriend won't wear a condom]]></title>
			<itunes:title><![CDATA[Girl Talk: My boyfriend won't wear a condom]]></itunes:title>
			<pubDate>Wed, 16 Feb 2022 00:01:02 GMT</pubDate>
			<itunes:duration>43:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/620a41bbefc48c00120b697c/media.mp3" length="41914235" type="audio/mpeg"/>
			<guid isPermaLink="false">620a41bbefc48c00120b697c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-boyfriend-wont-wear-a-condom</link>
			<acast:episodeId>620a41bbefc48c00120b697c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-boyfriend-wont-wear-a-condom</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdTGfhvsS1uL8UK+fyUH/q3fdB/Ov2knrhfJGyiRZ0oTaOFzPL/vWhoCabRbCqxPyIny6iMhy2ldood6VZz8dn9tB2Pr+1aGYBCEpzUGRRF7MNoCcYMtDooJ0wdY5nKyBZXutVHtAF9Dx7dYaos2Q5YQAWyewPtgTDAUtd3AE3TuxnkLHY0fds9wrdeVHZvKdELYhgTRqovWWOF8kAzTtOWt5zIU/ijmgv2mujGKUD2Grl8SaLAmEevt3IAhWMZ0GSlGgqTbhE23fxixyMIGXkW]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>128</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: It’s not his baby…</title>
			<itunes:title>Boy Talk: It’s not his baby…</itunes:title>
			<pubDate>Wed, 09 Feb 2022 02:32:31 GMT</pubDate>
			<itunes:duration>50:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/620327bffd002700123cfdb4/media.mp3" length="48989806" type="audio/mpeg"/>
			<guid isPermaLink="false">620327bffd002700123cfdb4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-its-not-his-baby</link>
			<acast:episodeId>620327bffd002700123cfdb4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-its-not-his-baby</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd5h9pAhUqFM9g11E2yrV1uxWh8y9ntVk2QHfIhhSn5fjKmUkVGLwMQMy5MqN9LcR5N9ixL1h39rQLOj7uV0LwAFd36yKqk5OWW0i5TB3iJQKQiSf9rq8DpDjOZB5VYGRA8tr4KeO1VcEWkpFyhzu/LXQT9TMSVQRgcEQveKlZDa47Fr/ViPr2/q6X6G03rT52gMxWWy7H/r+R2b0D0kTmW9G1I/J3p1TZU2MaAFvGwuACDCLPYCJU19aKTW60l6cNcu//0CK6rn6gUOnk1798o]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>127</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My bff got my dream job… ouch</title>
			<itunes:title>Girl Talk: My bff got my dream job… ouch</itunes:title>
			<pubDate>Wed, 02 Feb 2022 00:00:05 GMT</pubDate>
			<itunes:duration>47:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/61f951127d0e6d00128018c1/media.mp3" length="45771457" type="audio/mpeg"/>
			<guid isPermaLink="false">61f951127d0e6d00128018c1</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-bff-got-my-dream-job-ouch</link>
			<acast:episodeId>61f951127d0e6d00128018c1</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-bff-got-my-dream-job-ouch</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdPfIRHPw5kkVU3ZjmPKXHepqpUF/s5sBTjmLRIcl1sjYj+XqWQJrCCJFauPx3srhwgJ3gctDanPnDo3Eim0H5Mrwncag41bvmKV+SB8jyiyNufjWtcOIPsMhB1PhMxjDFpExTZ6mLmWLUh30lJXTGHzW3R0OfWDirg+qNq8V4fgkDj8EAzZuOO6yBQOtiSNwkotzXtZqTVMZ7XgqcD3jir/OFAESdMSEEFlT0zESeDnLRvqehvTaiLkuFnnTjuMAV+IpCLhtMztcSyJp9P9A3g]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>126</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I’m dating a Royal!!! wtf!</title>
			<itunes:title>Boy Talk: I’m dating a Royal!!! wtf!</itunes:title>
			<pubDate>Wed, 26 Jan 2022 09:48:42 GMT</pubDate>
			<itunes:duration>53:11</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/61f118fa2d03420014e2ab4e/media.mp3" length="51405694" type="audio/mpeg"/>
			<guid isPermaLink="false">61f118fa2d03420014e2ab4e</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-im-dating-a-royal-wtf</link>
			<acast:episodeId>61f118fa2d03420014e2ab4e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-im-dating-a-royal-wtf</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCewn3Mc7bks3OHznmoRQVq1mG59VX752jcGW9DNrHLvg9+pVhuOHnIxK5a13aCdd26bKx0XgAqv3mb6euJHmJIs5sjhavacBrrCvjlVRH/sCJ0FVXQy8zD1NzaG8kasVg1ISRZc2vELbspAEUvqErv9k2aUcFvT6ULRLw3G7Dfq5XNLjfytKZsVFspzVvtdp0bO0qj/2nPHSo/k/pieVcnNTwJ4+jY4NGeap0z6MAU7pAeIHOPgzO77yO/YoO274Aqg6E/RGm+LU/WUHMwcen44]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>125</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Career vs Living my 20s!</title>
			<itunes:title>Girl Talk: Career vs Living my 20s!</itunes:title>
			<pubDate>Wed, 19 Jan 2022 00:00:28 GMT</pubDate>
			<itunes:duration>54:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/61e72b20d8346b00132d4d2a/media.mp3" length="106908009" type="audio/mpeg"/>
			<guid isPermaLink="false">61e72b20d8346b00132d4d2a</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-career-vs-living-my-20s</link>
			<acast:episodeId>61e72b20d8346b00132d4d2a</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-career-vs-living-my-20s</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAkb22B6XadnCBXYNmg8OU8k+fllPTzqVoQu+OjVZEA8lxlLrqU0icE3XusFithDQv99F7NxaEL1vsy9CUPw/EYbBE4GiqAsJjKJzlHG4r85wdCSd0ll4+8f6b17w54kykfwUJ2LQYlyIS+V9WkGyDC7qtstTIhs7rj15AC8zLpPHPJgKiW299A89e8FPpi4KnvBU9iUAOmEo2R0/yChVMQuA6dhpK1HP8gSFPX+ugqzj]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>124</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I found my boyfriends sex videos with his EX!!!</title>
			<itunes:title>Boy Talk: I found my boyfriends sex videos with his EX!!!</itunes:title>
			<pubDate>Wed, 12 Jan 2022 00:00:35 GMT</pubDate>
			<itunes:duration>44:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/61de07f4afa6910012bbc9da/media.mp3" length="44496611" type="audio/mpeg"/>
			<guid isPermaLink="false">61de07f4afa6910012bbc9da</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-i-found-my-boyfriends-sex-videos-with-his-ex</link>
			<acast:episodeId>61de07f4afa6910012bbc9da</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-i-found-my-boyfriends-sex-videos-with-his-ex</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAszDAlyBHwgMwOoenZIj/SRo2FOChBwIMfHOOVJ49FWiJRedmsdly6WYyON21UXGilASGZN4VpBpIXIetNiYvRp+LD9jv+rwa1teSDVdvC3qJkK+lGvCLoUGqjxmRqBm4PD8Slg+EbM3UetkGBcik3MiWpavr76jLeUtLsaSJwi8i5Hxz5xR9gOEj9jN0pqQjAMorzByU255xjM0GhfrFlTd/nZtCLXd4FG7ZYgteD3R]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>123</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My boyf got me fake designer for Christmas!!!</title>
			<itunes:title>Girl Talk: My boyf got me fake designer for Christmas!!!</itunes:title>
			<pubDate>Tue, 04 Jan 2022 22:04:33 GMT</pubDate>
			<itunes:duration>48:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/61d4c4718e470c001300bdcb/media.mp3" length="49209008" type="audio/mpeg"/>
			<guid isPermaLink="false">61d4c4718e470c001300bdcb</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/girl-talk-my-boyf-got-me-fake-designer-for-christmas</link>
			<acast:episodeId>61d4c4718e470c001300bdcb</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girl-talk-my-boyf-got-me-fake-designer-for-christmas</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PAlMsJXrdbbsqvhmnXPZLXKxNjZf2SHFxJQ/9vgCA6oSnjPkRzvitDYv1VvtWKsew4Rqr8eps90AJLMY9o3JnQbB0x01sY6u83hQMmJRirWn7Ey9eGSq0IwwSj0BD+CVeemjqfs1chTgNUzZF2YBveDGKdstgbacOaKb0/ZrW5BTrQu0aMJq0d8NAcBOZbKWLRXHALcbgzqAXi6iP6JB0il7Xz8BtFzwNVEi/IyTdTiUv]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before!]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>122</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1672783701743-1e306f881148b7231582c082a448b0d9.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Can I cancel Christmas at his?!</title>
			<itunes:title>Boy Talk: Can I cancel Christmas at his?!</itunes:title>
			<pubDate>Wed, 22 Dec 2021 00:09:30 GMT</pubDate>
			<itunes:duration>49:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/p/acast/s/thegirlsbathroom/e/61c26bf1dcbb9a001393573d/media.mp3" length="47543072" type="audio/mpeg"/>
			<guid isPermaLink="false">61c26bf1dcbb9a001393573d</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://shows.acast.com/thegirlsbathroom/episodes/boy-talk-can-i-cancel-christmas-at-his</link>
			<acast:episodeId>61c26bf1dcbb9a001393573d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boy-talk-can-i-cancel-christmas-at-his</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcFAe0fnxBJy/1ju4Qxy1fhqYdRqrvGtLVxH7dR094PArKSY8hPP7lV4VeRIRedUAs6druQ4lHcfl01TBgruYRerHrlfco/9YetK+1SqwFzoODSTCbKaCis3mrwgK9mopFPz0mxTSOaT8uSOppH8HKLYxcbVllNth+FSHXfOXijzIMrGUlseegixQTdQfA/Lzydm/Ceep1mT9lLrmwe3L3MQkkWgbdecoheQxxNPNwEnKz0G6h5sP3QUDi23yBs+qu899mNLOjieageKHqTjFAl]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>121</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/1640163832355-9b55f7ddf4d575c9af3ba8d29dd52a3d.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom&nbsp;</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: A bad psychic reading on your relationship… Feat. Cartia Mallan + Ashton Wood</title>
			<itunes:title>Girl Talk: A bad psychic reading on your relationship… Feat. Cartia Mallan + Ashton Wood</itunes:title>
			<pubDate>Wed, 15 Dec 2021 00:00:00 GMT</pubDate>
			<itunes:duration>50:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-abadpsychicreadingonyourrelationship-feat.cartiamallan-ashtonwood/media.mp3" length="36101072" type="audio/mpeg"/>
			<guid isPermaLink="false">3814bd6e-d4f9-44e7-9613-b1a7940bb770</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-abadpsychicreadingonyourrelationship-feat.cartiamallan-ashtonwood</link>
			<acast:episodeId>3814bd6e-d4f9-44e7-9613-b1a7940bb770</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-abadpsychicreadingonyourrelationship-feat.cartiamallan-ashtonwood</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcLpWaC07nfZI6SaJzpG7txfcx5Rn3vZmSs9NSSr4nO/TlhzmC7+Kz0WoTTBEKURd52NBR+lz0EPFRSilO5ad0A1DKm73+UUa4BktHtIky1vbt3H2gOUNFSDqa+QqDCCvgZ/BDpoHk4Elr5TB9OnKTy3baS+xWY3BzNvtqbswwUrvIN/J+hYpCzpJxUEgwP4rmNRPhycNo8GfdqSiL5nfyXHflcVEa09hOfBoWaUBp5mw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>120</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e43363.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Do I stop Only Fans for my dream guy?</title>
			<itunes:title>Boy Talk: Do I stop Only Fans for my dream guy?</itunes:title>
			<pubDate>Wed, 08 Dec 2021 00:01:00 GMT</pubDate>
			<itunes:duration>52:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-doistoponlyfansformydreamguy-/media.mp3" length="37627328" type="audio/mpeg"/>
			<guid isPermaLink="false">ef909305-33cf-4608-bf07-327de8c4dfce</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-doistoponlyfansformydreamguy-</link>
			<acast:episodeId>ef909305-33cf-4608-bf07-327de8c4dfce</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-doistoponlyfansformydreamguy-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCUvXFyQjwnZuoF8UFzP8RLy1snx0FBVj1K+Hx3EszADvgaSSPb7GXcd6lRkOh3eLgImwPuk6EjPFSZihKIcN5sdujZGgX5Tm/S3nNuL6cZXF66xrru3ahlzG9hhUB7o+BEC9gfS2bn+CfdiO/z3qV0wzbdCb6WyXhea2Hn7Xa5j6AohKHKrAbpdlPLD0JMh1GkDdZHW0O2jpZrNOJYBnBfwEMwqVm0QMBkVqc020GzOVGt3XoGEtFvQcv2fSrkKHW3LEYM9j0G8/KlrjQw02epA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>119</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e4336a.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: A letter from my ex fiancé…</title>
			<itunes:title>Girl Talk: A letter from my ex fiancé…</itunes:title>
			<pubDate>Wed, 01 Dec 2021 06:28:00 GMT</pubDate>
			<itunes:duration>51:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-aletterfrommyexfiance-/media.mp3" length="37324928" type="audio/mpeg"/>
			<guid isPermaLink="false">438f575b-ca24-4bda-a977-39d976791f9f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-aletterfrommyexfiance-</link>
			<acast:episodeId>438f575b-ca24-4bda-a977-39d976791f9f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-aletterfrommyexfiance-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC1hYEg97ZKAKa/BTF+VjMonrqvQJAnbl5Wsw1xFu6wf3JsFVTFQhIn+sWvsAu22IsUJHo4Ae61dVF7EPjDuWFxCEYF9lIRBMpTrxZpzuhX4LZqGu37hWkbdERe1NybROKRebc7kbBHARESUjRTkECuZj1JZ3cXo0Kcc2gRJRpgP2UF4jmc7VkusRs1wrDsE9I88RMB6fiOLS9/n+CIgNPOrqydMPWO2Ce116eYopO59lteBF/Z3WvbieHAhA5A/dN7rxAKEd4fbscOUWQmKbs4A==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>118</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e43371.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My boyfriend is too busy for me…</title>
			<itunes:title>Boy Talk: My boyfriend is too busy for me…</itunes:title>
			<pubDate>Wed, 24 Nov 2021 00:01:00 GMT</pubDate>
			<itunes:duration>44:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-myboyfriendistoobusyforme-/media.mp3" length="32198816" type="audio/mpeg"/>
			<guid isPermaLink="false">fcadf8f5-491e-4d7a-afed-072e217d117d</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-myboyfriendistoobusyforme-</link>
			<acast:episodeId>fcadf8f5-491e-4d7a-afed-072e217d117d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-myboyfriendistoobusyforme-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCyfbSYM5vivuR+KhgKKsuFx73168oou7J6AyH3Nu322rxtlWBgWRL7TngGMdLJJ8NLdSzUPi/Hp1zAQBpuUjnnrPrIgbltjkn92JucAuSVr/6TEZF4GQnbgHQtRfS8QPEEmaRjcvErqWAtGMMEhBliv2zetXccz8KhGQ3uYy9SsdGvvMhm7AdnFNGJhNmkXcTEswrU/Sk4VSQ9bCohYkvgoTozb1D2xxwxYKj5oUYl32ALURDAENuK0+en0nteDC9SWR5xkr4XmUwqqXG0bXLzg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>117</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e43378.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: How do I make my life less boring?</title>
			<itunes:title>Girl Talk: How do I make my life less boring?</itunes:title>
			<pubDate>Wed, 17 Nov 2021 00:01:00 GMT</pubDate>
			<itunes:duration>40:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-howdoimakemylifelessboring-/media.mp3" length="29202896" type="audio/mpeg"/>
			<guid isPermaLink="false">56a6f918-6502-46d2-9447-0d950d7b9ba2</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-howdoimakemylifelessboring-</link>
			<acast:episodeId>56a6f918-6502-46d2-9447-0d950d7b9ba2</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-howdoimakemylifelessboring-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCc9Q5OtIoAhMTHkwb9GONoion3H4Ek9N21etNUIwcJrUi3PcRvGQflulCDTskAwRskt2WCBJW7OEdPi+lsJsfHFUoltBYSp2ijlfMBxwaOb6wCQ3h2CF2GAsxHMVc3PNm8blJFV7bN8gZJfN81zYReRCSCH1lH1yEA4WePt8Aza5xOmuqieHl6dvpbD8K9ytBcPsIpgWsZ6YaJs52EQdPdjqQx3/2YYp64/l6YHvRH+6w==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>116</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e4337f.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He called me by his ex’s name!!! YIKES</title>
			<itunes:title>Boy Talk: He called me by his ex’s name!!! YIKES</itunes:title>
			<pubDate>Wed, 10 Nov 2021 00:01:00 GMT</pubDate>
			<itunes:duration>55:10</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-hecalledmebyhisex-sname-yikes/media.mp3" length="39729872" type="audio/mpeg"/>
			<guid isPermaLink="false">838eeae2-091a-4f46-a99e-630acc554c4f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-hecalledmebyhisex-sname-yikes</link>
			<acast:episodeId>838eeae2-091a-4f46-a99e-630acc554c4f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-hecalledmebyhisex-sname-yikes</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd3deysOEbWeZIvxXAG/TuQ9cum28qm4DW983imI2Btxi3lqOnCB+skKML1rdnnnM4q25nlrjrHgEhepnC+if7vcTs7aXmnW/Rrir5v8Hj0eAgzvG/pNT1FQyehyu/oOl/gw6Pdk2MkoTKOMCXaiCZYBx09fqq3a0cwwRRACk+ZEanVTVMmDjnv037Feohczd6rGuNwp+dcLbG8Va49NySSWFaH0nzOItZUTXJmmgSm+Q==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>115</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e43386.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Why is she gatekeeping my love life?</title>
			<itunes:title>Girl Talk: Why is she gatekeeping my love life?</itunes:title>
			<pubDate>Wed, 03 Nov 2021 00:01:00 GMT</pubDate>
			<itunes:duration>44:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-whyisshegatekeepingmylovelife-/media.mp3" length="32012192" type="audio/mpeg"/>
			<guid isPermaLink="false">5a2e3f37-65a3-4e11-a103-675708096a93</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-whyisshegatekeepingmylovelife-</link>
			<acast:episodeId>5a2e3f37-65a3-4e11-a103-675708096a93</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-whyisshegatekeepingmylovelife-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCgOBLtdDsJjj4g1Y4wdQZ2H/kQ/IRHrplWoi0RvhPgVnqPPock8YFEJuH8Ubwbu1uCK2OqkUSM7zeUWKvfh2uhWvHNCU9DugPoQmeMFJv7Zu0olB+cH4HQDnhgWeHmk4Q+ek2zBpBKXjn6W0DStCtoU+QZvg76dKvuWAEXkgCcjBOV4Is74P3Li2hsYhVZZpItnOqbO/ApItMDgLDf5GuhRSGl0OrgM2rfvoL8UFWH2J9hM1kWv9Kfbs8mjjc9FrU2cTBas+RiHsFq2x6xqukTw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>114</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e4338d.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: How much ‘boy time’ do boys need?</title>
			<itunes:title>Boy Talk: How much ‘boy time’ do boys need?</itunes:title>
			<pubDate>Tue, 26 Oct 2021 23:01:00 GMT</pubDate>
			<itunes:duration>48:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-howmuch-boytime-doboysneed-/media.mp3" length="34596416" type="audio/mpeg"/>
			<guid isPermaLink="false">8b1eb4fd-fbfc-4607-b9eb-4737bb26453c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-howmuch-boytime-doboysneed-</link>
			<acast:episodeId>8b1eb4fd-fbfc-4607-b9eb-4737bb26453c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-howmuch-boytime-doboysneed-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCnZ6CfEfX4oFoDk/Y6eSx4oFyea43cb7IVshjUv/72CZvzURkiuYYRTs/H3Ml9L2zVSqEMaU2nVBfdQMJknHriODwFmPesAxNtn/fcS7suoR6i1J7kvSTNnCOmC8jD6quJUhV1/ljI+28DUIzCB6iicxRootTaY+c/drw0CZ7uXI8+HvU2K+CXp8vndu+wg4gsBojphxnHE3fXLfJ66guYna49KMAuwCMxYYLFla8BfMdD94XIPB1QVuz3Wfh3J50FRbySZmuySn2SvW7OyZYJQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>113</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e43394.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Always the friend never the BEST friend</title>
			<itunes:title>Girl Talk: Always the friend never the BEST friend</itunes:title>
			<pubDate>Tue, 19 Oct 2021 23:01:00 GMT</pubDate>
			<itunes:duration>45:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-alwaysthefriendneverthebestfriend/media.mp3" length="33036032" type="audio/mpeg"/>
			<guid isPermaLink="false">0fa7dc7b-84e0-45a3-b739-d24ff95c4a20</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-alwaysthefriendneverthebestfriend</link>
			<acast:episodeId>0fa7dc7b-84e0-45a3-b739-d24ff95c4a20</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-alwaysthefriendneverthebestfriend</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCWL4RtC1UPlY2KZ/iSVbxEcaseefaJXK7wAJll04cbdVcyC7OglXYiaBAYIqwc925C+L+06zBGNHFZME6N/KTaDXNgxytndB20EWwhbxdGopwNkugGEQWlXlMF5Ekm9kmW8qM0BONN16yxFuKlFw5NEqqYGJYyP5vPXczTFpqL/Xnvv+HemNvZkK63Oyq8XkYaO6v2UspIrfUF6satqfCOYttJwdDXAT5WOa+ezxuE9BXFM7TcIAPO2NioN7k/sMyEF1kN0DLBh73GLFgYDkMoA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>112</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e4339b.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He did WHAT!!!?!?</title>
			<itunes:title>Boy Talk: He did WHAT!!!?!?</itunes:title>
			<pubDate>Tue, 12 Oct 2021 23:01:00 GMT</pubDate>
			<itunes:duration>40:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-hedidwhat-/media.mp3" length="29258192" type="audio/mpeg"/>
			<guid isPermaLink="false">2f56e875-078a-4554-88f8-24c3623d2a06</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-hedidwhat-</link>
			<acast:episodeId>2f56e875-078a-4554-88f8-24c3623d2a06</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-hedidwhat-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe+V7keZkJTcU8ynvFkLX6/ZheEezrtQEZk239ua7yyEFcm+PGGTkCzxZ81D4C4Ik8WBsRAfEYswgWRPhs9/ymCFBV3d1fnfs2WX1fvk7L+0+Q03m4vgA1R6c4vMmcQuozekZIxwtv0Axhmoag5ZfpcLcZPH4ofqmrAi7aLIGn9MJaZJg6nM8zoYroZ4/sj7C9W2BumPdTL1WBuyKiWPH+eTNi7jWE+JQjxpsaHZf+eXA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>111</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e433a2.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Is he my sugar daddy???</title>
			<itunes:title>Girl Talk: Is he my sugar daddy???</itunes:title>
			<pubDate>Tue, 05 Oct 2021 23:01:00 GMT</pubDate>
			<itunes:duration>47:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-ishemysugardaddy-/media.mp3" length="34335488" type="audio/mpeg"/>
			<guid isPermaLink="false">1973f8fc-e142-415e-ba45-960697d4799e</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-ishemysugardaddy-</link>
			<acast:episodeId>1973f8fc-e142-415e-ba45-960697d4799e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-ishemysugardaddy-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC4N7a+UF/cNWPS4gSHIAy/RiPbocRecON+NqnEoldoup37vs+aMow2E9s09st2CFxcaIRgYyzA5NToqCoBCIHEoKxKxXZpal4A2GACkXYaOWH6F9KIUCVK/0UYNXdce38OwTh/lG1AzP7Vg/nObuubBE8gsvFUKjTciybf+zZD1ZMg4tpz+UduJWTFsvEOaPD6yk2zwkALPvUXHdRdayJEK5kpLVXP3LuDM0bj1cbCwSXKdIjYzGuCX34wPQmmhUN7UVkf44vModVVKdAZ8qHgw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>110</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e433a9.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He wants to move out but stay together… WTF!</title>
			<itunes:title>Boy Talk: He wants to move out but stay together… WTF!</itunes:title>
			<pubDate>Tue, 28 Sep 2021 23:01:00 GMT</pubDate>
			<itunes:duration>44:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-hewantstomoveoutbutstaytogether-wtf-/media.mp3" length="31978928" type="audio/mpeg"/>
			<guid isPermaLink="false">2e1c8ae7-2e1b-4251-9314-f4796a027117</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-hewantstomoveoutbutstaytogether-wtf-</link>
			<acast:episodeId>2e1c8ae7-2e1b-4251-9314-f4796a027117</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-hewantstomoveoutbutstaytogether-wtf-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCvlAiKu7eW59PuVMQEKpwxb3OFnhsmPikM4MsAJUH21aeRUP0KxM9VyPcUlevh37fHSKaOk8aW/Ijp/0YC/5VC6iO/Mf4Kr3Jl7InYPgUsNGFZOROxs4dDK0AuiQPLou3Fild+b8+oXKAta3eJtziK3o86+o+9DrLize8FjjUS32RDkilRe19HNvnJS3OrJygKTETaznwP8J5hTLwFHIyN2hbnIGM9Y9lFpaFPnraaH3/HFqHMIP8+eOhadXmdzP+GNhpBNnrCCNrjdPApzQ5wA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>109</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e433b0.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: How to be a Celebrity Stylist!!! Feat. Melissa’s Wardrobe</title>
			<itunes:title>Girl Talk: How to be a Celebrity Stylist!!! Feat. Melissa’s Wardrobe</itunes:title>
			<pubDate>Tue, 21 Sep 2021 23:01:00 GMT</pubDate>
			<itunes:duration>57:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-howtobeacelebritystylist-feat.melissa-swardrobe/media.mp3" length="41112272" type="audio/mpeg"/>
			<guid isPermaLink="false">b891ea2e-604f-48bc-ac0a-9415c6b90add</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-howtobeacelebritystylist-feat.melissa-swardrobe</link>
			<acast:episodeId>b891ea2e-604f-48bc-ac0a-9415c6b90add</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-howtobeacelebritystylist-feat.melissa-swardrobe</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCa4AoDwDiDTBJwSCrVhPZcwZa9/TxT5uEtpvY5A6gxZC7JQxOHshs57u1TBDpNWpoMTs5RRJREWyafwp4RCXN1/IEYQ28Vy4E3jqMoq3dXGwWujww499HAOZw6LCdf3Nn82N88lp4H9UYnfhLySDMDRH+Zxf9/mD1rWggCkmriVcucCFLeA0ZKnLc8v6C3NVX9J3rMNHCJ2uOiuobg7ZuWBHAlW3ZPs3gLf59tH2TM7NKOSW7ZONb18VmE4eZSHlN7s69tzEPBrn+a18iWLCZdQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>108</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e433b7.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>RIP THE SINGLE FILES</title>
			<itunes:title>RIP THE SINGLE FILES</itunes:title>
			<pubDate>Tue, 14 Sep 2021 23:01:00 GMT</pubDate>
			<itunes:duration>36:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/ripthesinglesfiles/media.mp3" length="25924016" type="audio/mpeg"/>
			<guid isPermaLink="false">afbe41ad-ba97-48cd-aa2d-74a067820bc5</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/ripthesinglesfiles</link>
			<acast:episodeId>afbe41ad-ba97-48cd-aa2d-74a067820bc5</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>ripthesinglesfiles</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCLFMy+98LSeoDla0Nwl1qydkOxYbY3DEyxGA2lnNNmsKoL4Ua52pG5LiTNuP/Oj82LNgqufvwARzVzUJV/3gPiEHp+bzmVm0EJPuXIL78CqlarcyPgDN5sbP7DE/eTE9Pe7FeeYOJXLUicmNQ0UaD+eTwM9dB77qRXew1qb2iynXxMJCfukJFZ872zqd7nK/44rrNWuF+6tx656P86X38WL5vWEf8khL8sdDW5mzI+yn2Z6Ldv/NZYbJ0/7sFDO/cTNay4GrJ4JCzkCVCW/rgvg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>107</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e433be.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I chat to all 3 of my ex’s EVERYDAY!!!</title>
			<itunes:title>Boy Talk: I chat to all 3 of my ex’s EVERYDAY!!!</itunes:title>
			<pubDate>Tue, 07 Sep 2021 23:01:00 GMT</pubDate>
			<itunes:duration>49:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-ichattoall3ofmyex-severyday-/media.mp3" length="35683328" type="audio/mpeg"/>
			<guid isPermaLink="false">154e3f47-2cb6-4bbc-b42f-99053ecaafc7</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-ichattoall3ofmyex-severyday-</link>
			<acast:episodeId>154e3f47-2cb6-4bbc-b42f-99053ecaafc7</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-ichattoall3ofmyex-severyday-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCehtvmmWV2v8rA4R9bzNUhHYr8IyFf76oloDc8rZqGib97wqmE52gpi2eCWQ2jR6MM3gNd4H8wNCdmZafBjFiGctnWdW7Q8gD+4wJ5VQ0YIYqwsB/vUyKRgN9RD6B2Y3Q3YYWXO2SXCTed2Pf5nWBgTUv5369vZryrsCrA5pt+Ui8F5wysRugO9SQyJirOB7tOZHAC20q1KdwxXT/Fl1iHwB2KroMNu7EmmRf0t6QquzQLIfIJYAMPKFi7DBW5FeSTNHxMEwGeaoEpchMBFeQew==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>106</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e533f31d0014e433c5.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I’ve got Gym fright… HELP!</title>
			<itunes:title>Girl Talk: I’ve got Gym fright… HELP!</itunes:title>
			<pubDate>Tue, 31 Aug 2021 23:01:00 GMT</pubDate>
			<itunes:duration>46:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-i-vegotgymfright-help-/media.mp3" length="33381632" type="audio/mpeg"/>
			<guid isPermaLink="false">9e38916c-31ac-4e96-8686-e9317789e3a5</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-i-vegotgymfright-help-</link>
			<acast:episodeId>9e38916c-31ac-4e96-8686-e9317789e3a5</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-i-vegotgymfright-help-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCVZ1mMDnVfHUWh6P2D/Xzt/31405WVB4qZE7DeaebNvaFpgmxFdHler72pUTjLvO1v5m+zPSVqxHqIjYEqk2Ee/Ew5BHaF3rQDpG57zhhsPgz9OH9jpWJcrWZQl/YL5Dndt2GfJnpdMiwxMIeps42AMvkBsZtwQbrZl/k7+L09R+Rbt94QAo2b64qAOHlJE2/T44eH3wUxra401dLqV6uvPI+sy5T/XPnyJq3ZjZyC/D8IC2UZLWIHhccsOfKyetw1iAVKYL1JZVjdBpV5KaYOg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>105</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e433cc.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: Where's my promise ring?!!]]></title>
			<itunes:title><![CDATA[Boy Talk: Where's my promise ring?!!]]></itunes:title>
			<pubDate>Tue, 24 Aug 2021 23:01:00 GMT</pubDate>
			<itunes:duration>42:18</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-wheresmypromisering-/media.mp3" length="30466496" type="audio/mpeg"/>
			<guid isPermaLink="false">29cdc734-5a31-4ec6-b5a5-f018b4f84c45</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-wheresmypromisering-</link>
			<acast:episodeId>29cdc734-5a31-4ec6-b5a5-f018b4f84c45</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-wheresmypromisering-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzChys8PlGwIWHxXpGVrHmN6/3ifVQP8wo2xdtp4qtjin2SfXvy2UURHznFleYYuwDpxNIVX3virpYUj60cncEDruw8ER89F4HGTrwZckBDl++KcrmlQtF+QHB4k298Sfgyt4XEIlxHBw62mEyfrXectsdyfywpt+u5LRiO+xMOVE5mNqbAt5SZaTKcE3xj0ajuokzQ1B2IAaf4CeOyn0zaY5l5K/vekxfqmwGuo+3QzpfkNiMlPkJxRk15r7T78LLDRx9Bl+cz3z4WSH2ci/5d5A==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>104</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e433d3.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: BFF was supposed to marry my Boyf...</title>
			<itunes:title>Girl Talk: BFF was supposed to marry my Boyf...</itunes:title>
			<pubDate>Tue, 17 Aug 2021 23:01:00 GMT</pubDate>
			<itunes:duration>43:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-bffwassupposedtomarrymyboyf..-/media.mp3" length="31371536" type="audio/mpeg"/>
			<guid isPermaLink="false">b08fa105-5caa-46f0-82a6-a704079d87dc</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-bffwassupposedtomarrymyboyf..-</link>
			<acast:episodeId>b08fa105-5caa-46f0-82a6-a704079d87dc</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-bffwassupposedtomarrymyboyf..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcUWnM7bexe09nmfjZ6pOb1a+I6R1NVYf7vr7a9wqTvuZiJ3hnQKgBW6+d+fG1zzE01R6NKocIbi46udNvllWOr+0ik5A3ngxHeCcy1fWlmauGaOSoXl7dryOKrLdSbTx5YpMqlj9brV78ahF/IsBZProRrwhYD+6k7dsxjl1EFCXvh1iXh54KMFVsJxND1q5cQe079v1dyAcNr9iKD9+BOJX6+Kgb0hlGI5vCB5KgEeQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>103</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e433da.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE SINGLE FILES: 11</title>
			<itunes:title>THE SINGLE FILES: 11</itunes:title>
			<pubDate>Tue, 10 Aug 2021 23:01:00 GMT</pubDate>
			<itunes:duration>26:35</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thesinglefiles-11/media.mp3" length="19151552" type="audio/mpeg"/>
			<guid isPermaLink="false">47701306-edfb-46e6-b9b4-99593b00946c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thesinglefiles-11</link>
			<acast:episodeId>47701306-edfb-46e6-b9b4-99593b00946c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thesinglefiles-11</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdYsCsMFmmntKE7KIZAqZ7+GaFzVRmo+l2JGOgsd4tYLm5EJC22vjynwQk4A9g6FV2gxAEFrddp4fg70luhMnwDz3vOoXFsE3Rol+cGRp5ylXV4dSfQsQU8eW9lxsl8ubsHIm6cLnElaDk7E89gMSN1LPWbvArogOishYcz+/KfvtbaV3NRVCMowkJ4sZ+ITb97PAMnKVv9qIAJNf0eTKUctmFV7OC14RZvTt56NWpI8g==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>102</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e433e1.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He’s calling me crazy!!! Feat. Private Parts</title>
			<itunes:title>Boy Talk: He’s calling me crazy!!! Feat. Private Parts</itunes:title>
			<pubDate>Tue, 03 Aug 2021 23:01:00 GMT</pubDate>
			<itunes:duration>51:18</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-he-scallingmecrazy-feat.privateparts/media.mp3" length="36937856" type="audio/mpeg"/>
			<guid isPermaLink="false">7a13bec6-1c7a-45a6-8288-c14da963dabc</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-he-scallingmecrazy-feat.privateparts</link>
			<acast:episodeId>7a13bec6-1c7a-45a6-8288-c14da963dabc</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-he-scallingmecrazy-feat.privateparts</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf1blpNhENXCdOYwSfGf8r96zgslzwjsbv+V5ZOb2kh1PT44N1dprZBuiEbmQKu5v1/EAtHFIuUoG+Q0ceb/xmsdqJ5MYnP/p8sGsS29QdPeyx56WKSMMD8UlzVMBAsi/DDghYoMm4oEvyE5mEhzXbfllkPFpDU4k4PCG6Z5qQ4P+0HQ2OXKmSeGZgPN02ues2dqZZSC2aRBP+0urhLp2KuJikPmThFKa1hjafkHoiIZQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>101</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e433e8.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Sleeping with my dads protégée!!! Shhh</title>
			<itunes:title>Boy Talk: Sleeping with my dads protégée!!! Shhh</itunes:title>
			<pubDate>Tue, 27 Jul 2021 23:01:00 GMT</pubDate>
			<itunes:duration>52:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-sleepingwithmydadsprotegee-shhh/media.mp3" length="37944848" type="audio/mpeg"/>
			<guid isPermaLink="false">7dd9f36f-10cb-4a3c-b5ae-96ec5094845a</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-sleepingwithmydadsprotegee-shhh</link>
			<acast:episodeId>7dd9f36f-10cb-4a3c-b5ae-96ec5094845a</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-sleepingwithmydadsprotegee-shhh</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC42Mu7+Wzbw3roXHRSCQyrrYMPPJZogfSbkMzxXItYj/jTq+xwQrAmutX1Zj7bJTUlXrS1NYR1zSR7/IqDvTKAemM+DMISsvwAdaghAxM2/iEPPzT9tg0FyBlgeXr1ioXdDjNWCG8Uvl7v4qXSqiDwJdJYsZ50E6pOC0vV2Brce6LihHP4cqZemKacxhFlgd0HS5AZSazc242bMZOONyij8mzreN2qjGHvAFQWTEuaK2MDAN7FfCVVnOCbh0P+VttHM0ffr1Fb72kCbJsil191A==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>100</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e433ef.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Do I tell his new GF he’s sexting me?</title>
			<itunes:title>Girl Talk: Do I tell his new GF he’s sexting me?</itunes:title>
			<pubDate>Tue, 20 Jul 2021 23:01:00 GMT</pubDate>
			<itunes:duration>45:16</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-doitellhisnewgfhe-ssextingme-/media.mp3" length="32601872" type="audio/mpeg"/>
			<guid isPermaLink="false">a09890d5-574a-4c52-9be7-a9f4632ff2dd</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-doitellhisnewgfhe-ssextingme-</link>
			<acast:episodeId>a09890d5-574a-4c52-9be7-a9f4632ff2dd</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-doitellhisnewgfhe-ssextingme-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfBiZ8ZQbe4Oaor2PUr0qi32Be4ewDVHnbnBqMtm7MsvoAFXADjKvkmmCjJK60N6qh3/lxb5FZaktNFBbl18kl6WK8+Nv58nx4kTPe17W9POQ3hZfYv0JvyXhVHfeYN8IbnYZenEEHRyHgqzrKnNJeRdYHcmpaA8ZjVt8RF5WAmwvZXOV83W7paVjuOulYQ+BOpFzQSnbQrUqql3CVIZ1bwnonEQ3rUY/1/RFHhZycaAA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>99</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e433f6.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Is he rude or do I not get the joke?</title>
			<itunes:title>Boy Talk: Is he rude or do I not get the joke?</itunes:title>
			<pubDate>Tue, 13 Jul 2021 22:01:00 GMT</pubDate>
			<itunes:duration>47:43</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-isherudeordoinotgetthejoke-/media.mp3" length="34365728" type="audio/mpeg"/>
			<guid isPermaLink="false">dcfd214c-2152-4686-8ea2-c76383e246d8</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-isherudeordoinotgetthejoke-</link>
			<acast:episodeId>dcfd214c-2152-4686-8ea2-c76383e246d8</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-isherudeordoinotgetthejoke-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCedvvH5GYw8FM/9wSO6DaGf4Qyt1cMeQ2HfwO1u53YGnNO9BJRtXclwh0gpitomUu6JHyFpxhUuU/jzjlbBfTd974rlEjzEeD7yK/aE+ccKuJmH8K+Q/1PDo7H7sC99sOpPsOc7YzL9TTr7AU5M31egjYY3AgNxDELW49Y3vN3P0ZIUDBLCA5X31FReMP7lb6S6J67xHcl6Ni0vWywusc4cix51Zq7l74rn+DWNox2LJw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>98</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e433fd.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE SINGLE FILES: 10</title>
			<itunes:title>THE SINGLE FILES: 10</itunes:title>
			<pubDate>Tue, 06 Jul 2021 23:01:00 GMT</pubDate>
			<itunes:duration>47:46</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thesinglefiles-10/media.mp3" length="34402016" type="audio/mpeg"/>
			<guid isPermaLink="false">f29540ba-5c65-4ac1-9ba3-7f64a9d2119f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thesinglefiles-10</link>
			<acast:episodeId>f29540ba-5c65-4ac1-9ba3-7f64a9d2119f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thesinglefiles-10</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCNyHlrFgFPZNbbv9WfHu7MlHpbaKObKs5B57T6oXLMACEz8sYF10jGmwG7E89LY6Wmlew3EvdV7MTdFnXwOcrZcY1zzEra6ieh1YurgYYNS7y72fMIF6nlcrfLXbX9EW4gI08U9GBms+T9up+0skFC/kmjblGzFk9l3eolZGE+b8rOZJm3A5rOjsBPEz9DlIwkc+3bOsZGNxm+dZRa4tTUSE50EsvL3U2HQXHi/OYx4Vy+tDGhtxrFbOpZmQGND/aR4HWr8RxleZo4fEik2Nw2Q==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>97</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43404.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Am I boring without alcohol?</title>
			<itunes:title>Girl Talk: Am I boring without alcohol?</itunes:title>
			<pubDate>Tue, 29 Jun 2021 23:01:00 GMT</pubDate>
			<itunes:duration>39:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-amiboringwithoutalcohol-/media.mp3" length="28440416" type="audio/mpeg"/>
			<guid isPermaLink="false">95808d38-aa4c-463b-a079-c37520029c10</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-amiboringwithoutalcohol-</link>
			<acast:episodeId>95808d38-aa4c-463b-a079-c37520029c10</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-amiboringwithoutalcohol-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCAMW5DZkWIsLAnHqc8kRSSiougLPPA3LAT89qZYSBP/f3VaRMSIs3y90TOrbUIEof3sEhFRF9mWTA49FZ5ioix/1UJER+2A2JUI3OqWYgmgqbz0DGPTb6A6XQEnGiXZqzIkWzM3/U5gRl8F9yo4Rh9AOgPBd1G4l6Nx5MDYieR+0XcNVThD9VUVZE+L0/Jc1H1HUSpECr6dCSNkk8+swoWXHUOdbAGHdj3YyqtHCRiogMKNsV8pAkxLnLHS2IJeZoNzfKIiISM9R4gemaTPDXWg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>96</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4340b.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: 5 random girls in my Boyfs flat…</title>
			<itunes:title>Boy Talk: 5 random girls in my Boyfs flat…</itunes:title>
			<pubDate>Tue, 22 Jun 2021 23:01:00 GMT</pubDate>
			<itunes:duration>43:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-5randomgirlsinmyboyfsflat-/media.mp3" length="31104992" type="audio/mpeg"/>
			<guid isPermaLink="false">fe9c63f1-bca9-4a33-89c4-820507c5bdb8</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-5randomgirlsinmyboyfsflat-</link>
			<acast:episodeId>fe9c63f1-bca9-4a33-89c4-820507c5bdb8</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-5randomgirlsinmyboyfsflat-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCSN+zlr1xdD2dn9r1mRpzukch0lt/uPXu2/v1NVx5XU7KTnQOZvg3O69c1e1Fe04BwK6yqmjB0xEveYMFCDJ2dw6UdM/LxW719yLbFm3FMtD2c8b3EBOhYeSX8jb/0ShCvNccy9cNvwemwkxv/xrDjMkjZMKN4+Q1unH3PVk1HQ4VS8xUk8rT9LkjvlE0ENv57bf4Iag/8xefN+hDnvBNUDQQcydBHzYGl5mAdxBYMU77q4HyPRiWykGqKFK/u8CIgCPGbkKZEBKZC6OvMwK+Hw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>95</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43412.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Should I move in with my sister?</title>
			<itunes:title>Girl Talk: Should I move in with my sister?</itunes:title>
			<pubDate>Tue, 15 Jun 2021 23:01:00 GMT</pubDate>
			<itunes:duration>51:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-shouldimoveinwithmysister-/media.mp3" length="36968528" type="audio/mpeg"/>
			<guid isPermaLink="false">5653e744-3be8-4be2-8f54-4e6504fea219</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-shouldimoveinwithmysister-</link>
			<acast:episodeId>5653e744-3be8-4be2-8f54-4e6504fea219</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-shouldimoveinwithmysister-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC6eG2alZCTT/THnx1diNz/Px7IJxeuHlLn57Lapsrjbz50gfdFlQ7MZ5+Lqm7Spu2zzv5W+invmIECRT2O15cjfSJ98X2xskJCOLZ1IALkUO2XGUaFwXzgKPbfl9y+ZTdEKhoXQbfYlWSQYlUYnFciNCh92bVG+XHND83ZLn92r1SPOGWUlduKMA4F0eZDO03DiVHhaoYBODEae7r4VmDe6QKFt8ojnsM2Z7O67gDIZe4NfUvw4GlvsBe73oYn1Tg2enwBcBvfK3FZuAtUth93g==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>94</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43419.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE SINGLE FILES: 9</title>
			<itunes:title>THE SINGLE FILES: 9</itunes:title>
			<pubDate>Tue, 08 Jun 2021 23:01:00 GMT</pubDate>
			<itunes:duration>35:32</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thesinglefiles-9/media.mp3" length="25585328" type="audio/mpeg"/>
			<guid isPermaLink="false">f82bb245-9e59-4c22-a391-1421fb8120f5</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thesinglefiles-9</link>
			<acast:episodeId>f82bb245-9e59-4c22-a391-1421fb8120f5</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thesinglefiles-9</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdkDrJSvuHoDVeE9s9kfADeEEQFrr5crWSnrc5H+K8YbwvdUrqgxo/ovuwbWMy1XyNVP+38zwZIxsqXJzRupFsMkiIBfgIbzuu4yjZh7nCmof9faI/lxMZ2qwR5auNFu6RAxRWtRTsPcbskRsgDyBcdoCwWuxlkQ8gh29ODJ7r75Jf27ggwI8MsgULtjwpIu2csY3btoNHZaSyQAVBH7tgbDMyVhsQy+uH7ON/TEpKfCA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>93</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43420.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Is he trying to dump me???</title>
			<itunes:title>Boy Talk: Is he trying to dump me???</itunes:title>
			<pubDate>Tue, 01 Jun 2021 23:01:00 GMT</pubDate>
			<itunes:duration>42:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-ishetryingtodumpme-/media.mp3" length="30249700" type="audio/mpeg"/>
			<guid isPermaLink="false">4aa63f21-5f4b-485f-be50-88bffdbb98e1</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-ishetryingtodumpme-</link>
			<acast:episodeId>4aa63f21-5f4b-485f-be50-88bffdbb98e1</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-ishetryingtodumpme-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCbKDovM/3ryrekuhKXyotI69azzpzejS5GdBHiEfvsTr0dlaC5bFkaCV67BnteYvJ+icpf9rqPRHx4t8IE6onYtdHNoWARKw4lRiOHAKk+24IRno3ylxMNeCvIX3ZmGgQl7AaNmTG7gRJSDu3/bwDTNJOoN78QR9q0v0kyNC64XPQybd6+XTrTsX1CUKBkZPQNVzDmIraq+DgWQXhE4DcznRbyWvFgywaKJKI7ZplJWtNfvmKFTXM/4zZyAR/w0oez6+MRiSrUl1Mijctwwo8TA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>92</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43427.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: To ghost or not to ghost?</title>
			<itunes:title>Girl Talk: To ghost or not to ghost?</itunes:title>
			<pubDate>Tue, 25 May 2021 23:01:00 GMT</pubDate>
			<itunes:duration>40:42</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-toghostornottoghost-/media.mp3" length="29267193" type="audio/mpeg"/>
			<guid isPermaLink="false">be062c47-b7a8-4d90-ba84-fa1f6131a61d</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-toghostornottoghost-</link>
			<acast:episodeId>be062c47-b7a8-4d90-ba84-fa1f6131a61d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-toghostornottoghost-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKGtYVgHXTGAUhY+8YoDJhvBEn+xMIzQM/OVTF8/UIBYotDicF0jYc5GMGGGyp7GD9s0W0AbAJGarCCX3eVLImdgziHXF8br4JumbyYLpLz/ONMA7wOiFWO3CGN7Ol3la5oWsgpDqeGPL5XTTW9+h/AkUfzYVywYFmqSC6rt4kcgLSU/aPvVdz3Q3O4/TSfNQ+ooHJ7x6/DZoPkswFYE0J1eSXXllrjmSp4hPp1D70d+uvhCYFQmNK3uDnjzW1maePUxPq5MyIwIYMxWjD0KqmQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>91</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4342e.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Torn between 2 perfect guys... SOS!</title>
			<itunes:title>Boy Talk: Torn between 2 perfect guys... SOS!</itunes:title>
			<pubDate>Tue, 18 May 2021 23:01:00 GMT</pubDate>
			<itunes:duration>42:21</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-tornbetween2perfectguys-sos-/media.mp3" length="30450959" type="audio/mpeg"/>
			<guid isPermaLink="false">b5841edd-e223-431c-97e9-0a9929c5afcf</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-tornbetween2perfectguys-sos-</link>
			<acast:episodeId>b5841edd-e223-431c-97e9-0a9929c5afcf</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-tornbetween2perfectguys-sos-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCfqvgd+5u2wHr6ChXyI482XVGmylmh9fBSc4GH5+QILgh8uEqDM8wJe3yeECaGh3majT1XYbPDce28HEHkhJDVnbP1KMg48QutbHpM4fWv3CFqweZSKmAAz8+br1VFANGC6dn2wOCH5flhtn5zBUmxjSRL2JuGKxXuT0WrjyqpSmaNNcXYSZ4npHq7D6OgJswHDkBEei8rqe72zjvy7HTSWZCXLSvOEZQp7rs6zoXA+wRXUdKo0jCw1vEm7AFKNL5/3jPbkNVX5xOT1bjFjVwnA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>90</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43435.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Bff always takes it too far!!!</title>
			<itunes:title>Girl Talk: Bff always takes it too far!!!</itunes:title>
			<pubDate>Tue, 11 May 2021 23:01:00 GMT</pubDate>
			<itunes:duration>43:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-she-salwaysaliability..-/media.mp3" length="31450592" type="audio/mpeg"/>
			<guid isPermaLink="false">2be7f25c-a6a4-45f3-ba12-fe843ea9baef</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-she-salwaysaliability..-</link>
			<acast:episodeId>2be7f25c-a6a4-45f3-ba12-fe843ea9baef</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-she-salwaysaliability..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCiPnb56s8O3K6HNN/v29a25+lkNQB4AVBCrosUVYeSO3q/IpfDcr8LifFtxI/WSKlhf47HsijSqByyeDGWmskP0G2a3iUHfRCNX/2k5iCXxy++7sG4RWa8gaHEJmlaIbS3QQeYk3midugEeJp4hjfZtMoBxROHKiu/BtYZVav4TamquVYrOKIfwtRoVH4kGxNrO9ubU4VhG3u9yHlkpbsWiaCjGze0lBXq0Eh3uR5NpBy5lj16r/IM0v1Xps2jqN6Fr9UwNTIzo/G3tYhEVZwQA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>89</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4343c.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE SINGLE FILES: 8</title>
			<itunes:title>THE SINGLE FILES: 8</itunes:title>
			<pubDate>Tue, 04 May 2021 23:01:00 GMT</pubDate>
			<itunes:duration>44:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thesinglefiles-8/media.mp3" length="32359952" type="audio/mpeg"/>
			<guid isPermaLink="false">d7ac4e0a-0c6d-4b8f-a26c-e69f2166511e</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thesinglefiles-8</link>
			<acast:episodeId>d7ac4e0a-0c6d-4b8f-a26c-e69f2166511e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thesinglefiles-8</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCpcshRG0B5tpX9gWJY2YEoVQYqczCr2QEaDEg6jV4uXQiJrl6YGRV3Vs/gPJkpWCt9fcP30js+drE3y1URLM1RpCNKG8uvE4xM9+rK2D4vD8wkpjvRbOwD8x2Y1Eya5JXOSmrtB3guvKV+QUM7oakNkwQGVt2JMGP1D+Q7rxpZNYHLzAgI+swyMSAPY7v2ansNWQMDr+5mKUwU2uuNb76vR3U4n1us/8aOjIop0j3aMyhqgNKnvAKaN8mP3bjlzqOwOOwgjzqiEhV+SA5wIGuEQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>88</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43443.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: He’s still updating his tinder...</title>
			<itunes:title>Boy Talk: He’s still updating his tinder...</itunes:title>
			<pubDate>Tue, 27 Apr 2021 23:01:00 GMT</pubDate>
			<itunes:duration>52:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-he-sstillupdatinghistinder..-/media.mp3" length="38045936" type="audio/mpeg"/>
			<guid isPermaLink="false">c7118f1b-eca1-4703-bdb1-24dbc9f74d83</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-he-sstillupdatinghistinder..-</link>
			<acast:episodeId>c7118f1b-eca1-4703-bdb1-24dbc9f74d83</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-he-sstillupdatinghistinder..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCedb3yE1M4AYZAxxIP2ywYGc9MLMwSLEmUOw2uyvKTM0GvchNspoAM1qOx+HTj/7KNfkXuB7nNPMSvSj2oucKhkCSAm5KhlEb0/UZyix0OD05lNGMCkt3xYCIv1szgsdxRWjZEmSu5GrBkGWcKzBchl4vtnJqVg8Ngg2UWq1JszL45M7EMxpRNYsyTLGmaTSB7g+ukK8N29Qv8zsOAaHDjoBzw6fQXwnGOSHt+fRgQ3daISQ6k57pRQbmMqHhyFKzcxEYWpPQ/j5lZy7iq0MiMA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>87</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4344a.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Boyfs mum put a tracker on my car!!!</title>
			<itunes:title>Girl Talk: Boyfs mum put a tracker on my car!!!</itunes:title>
			<pubDate>Tue, 20 Apr 2021 23:01:00 GMT</pubDate>
			<itunes:duration>49:31</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-boyfsmumputatrackeronmycar-/media.mp3" length="35653952" type="audio/mpeg"/>
			<guid isPermaLink="false">13918306-fb49-4d6e-8bc8-d834182ca7fd</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-boyfsmumputatrackeronmycar-</link>
			<acast:episodeId>13918306-fb49-4d6e-8bc8-d834182ca7fd</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-boyfsmumputatrackeronmycar-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCufvUFqvIx1IGm2DaK4N/dGU9JXcUI2V9nU888je6QdV87ZtRZMwW7v7cls11qZ4KgVp3jwPrIdQ0SaSHrKpWAGqO62m5DxYN7yUUty4s7LG3E3PSQB4uNAShu1Ds5V6vwfF1PfCqyCqhCrhT8tiqAQgtKjYU5wUrKEyppzNaPawUNYZ1ukQmO0cFgVJ+87GkD42UMx9z4dpPXCuyXOGxEgPAkslucDOVuK2jHjpQpsajdahCDATZP/tkI7Fqi5KhclG0zm01pYC24Rjpbtkfjg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>86</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43451.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: A fortune teller told me I should dump him..</title>
			<itunes:title>Boy Talk: A fortune teller told me I should dump him..</itunes:title>
			<pubDate>Tue, 13 Apr 2021 23:01:00 GMT</pubDate>
			<itunes:duration>48:57</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-afortunetellertoldmeishoulddumphim.-/media.mp3" length="35248736" type="audio/mpeg"/>
			<guid isPermaLink="false">da5f475e-7250-4cf1-9198-bc1a85bffcf7</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-afortunetellertoldmeishoulddumphim.-</link>
			<acast:episodeId>da5f475e-7250-4cf1-9198-bc1a85bffcf7</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-afortunetellertoldmeishoulddumphim.-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCecio/S/Avkn68F7NHi7JD0sJNqkUe8WlVFjOR+GHA9rCLymPTxQ68Omb1eJ2AzQR39Is3L6TFqUl7OzVsZq06kxoo8HUB5qQ+DGDB1tn7fYrdLbXYbZd8aSZzI9ZR3ZceerrqJZiscfozDXpmmITWlo/SoiaiOM6EsUXwPmhQo8Z45afx8+AczzjY3cKhg/2kRVcvD630OILg+n09hnotb1xyQ7WMRf8diyNG+XBGJ6GhhV8MBjxrQl+yMrqOoMHC6o/0AgFSC1FfMI2y0wGFQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>85</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43458.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: How can I build my side hustle? Feat. Grace Beverley</title>
			<itunes:title>Girl Talk: How can I build my side hustle? Feat. Grace Beverley</itunes:title>
			<pubDate>Tue, 06 Apr 2021 23:01:00 GMT</pubDate>
			<itunes:duration>42:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-howcanibuildmysidehustle-feat.gracebeverley/media.mp3" length="30390896" type="audio/mpeg"/>
			<guid isPermaLink="false">e3203db2-890a-4e13-b5e4-1179c9af3ef0</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-howcanibuildmysidehustle-feat.gracebeverley</link>
			<acast:episodeId>e3203db2-890a-4e13-b5e4-1179c9af3ef0</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-howcanibuildmysidehustle-feat.gracebeverley</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCFY7fV7jslizASR7WVTduyeEz4j0s9N0xHnNPuzc41xzBUtgsnVhQvr0isBGJ6HCnFKSj9U836LHj+NDqf42t5J4BaImNNMlrxh0HrP3sSws6d7qpoHaXfPXThP0dzzkCWDAZYG6QSJY949RuKcWmbnhQpna7vbIR9NNY3JKFC8QX6Mtx8UDWlnV5AVTb0U1XTZbaykFMvZrBCJx5DubvXT33GfSpt+paSqeVTmbH0bDwAkA9+FJ847zP9yg8d7o5bzNLg0G1NREhRpns2D2l1Q==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>84</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4345f.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE SINGLE FILES: 7</title>
			<itunes:title>THE SINGLE FILES: 7</itunes:title>
			<pubDate>Tue, 30 Mar 2021 23:01:00 GMT</pubDate>
			<itunes:duration>47:45</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thesinglefiles-7/media.mp3" length="34391216" type="audio/mpeg"/>
			<guid isPermaLink="false">fe24446e-2420-4126-befc-70cfa22092e4</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thesinglefiles-7</link>
			<acast:episodeId>fe24446e-2420-4126-befc-70cfa22092e4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thesinglefiles-7</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd2PDrC+PaWCprtJIKTlr7Up9aXJRk/0O9MRo7omOc2PBdSABqEEiec7dUivi10epEOxb2/Horxl1s7oqn+elX2z0Ogy/XU1qRGWd7POUQRW3VGuwsTwLIZBDFQdmEMrIy2FAYrMtQOXIhZ3DODC0BN6b2fJyiVTzkNHZ1UoI5cNp8XxFXVrHA96DUBCGwyRteyr6QneBJdA2Cnnm8u9pg1i1K1IL1VkaCTR/XmrQF8hQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>83</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43466.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Has he asked me out TOO soon?!</title>
			<itunes:title>Boy Talk: Has he asked me out TOO soon?!</itunes:title>
			<pubDate>Wed, 24 Mar 2021 00:01:00 GMT</pubDate>
			<itunes:duration>56:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-hasheaskedmeouttoosoon-/media.mp3" length="40660832" type="audio/mpeg"/>
			<guid isPermaLink="false">b1aeec3a-5f2e-4b83-955d-8be3b3b7f389</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-hasheaskedmeouttoosoon-</link>
			<acast:episodeId>b1aeec3a-5f2e-4b83-955d-8be3b3b7f389</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-hasheaskedmeouttoosoon-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC6XtG6sWFjCHK8p8K8F4TZ2H4IARJokQ23LpmCEu4GAeikaDvmchWAQUxnMCgLxQqXXKj83VYVVKgKC2qoa5SpREMdjCh2jMHcoBuKckZQ8ouS/12hJ5II4yr8yQgSnOwOTs8hrzGbpcrN4RyMEiLhmvFVne3M0+4hkztr4Uzn8cXc5mzPSWRj3aNtxUEuF0NjH4OElEQiYWvFsPkkRKXYZGfMsc2I5xiQRb/dQNAb3EqK7ovudad+98QEJasHtCh+BqRcgwwguI1LJOgVTHlLw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>82</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4346d.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: It's only girl code if you know her birthday!?]]></title>
			<itunes:title><![CDATA[Girl Talk: It's only girl code if you know her birthday!?]]></itunes:title>
			<pubDate>Wed, 17 Mar 2021 00:01:00 GMT</pubDate>
			<itunes:duration>46:04</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-itsonlygirlcodeifyouknowherbirthday-/media.mp3" length="33177296" type="audio/mpeg"/>
			<guid isPermaLink="false">0c4017cf-2369-4d4b-9b51-1e3a41563c87</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-itsonlygirlcodeifyouknowherbirthday-</link>
			<acast:episodeId>0c4017cf-2369-4d4b-9b51-1e3a41563c87</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-itsonlygirlcodeifyouknowherbirthday-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf5wMSiHz4068LFH836ggKsNRxDXtorkcPnrbUQ0V+a5jPLemHT426pmHDfbC0dwiSEfLVCaVlBjC5NoyQX47HYFRWf0Hk/psSPMW28+MqLVgCMwXGACdnQYsf2yWFuDiW94UHpmBzJAS/AMPwLLUZ3yibRHmIoB9hWVjuDHWpYJJ8ddygE9zAXOLNbXbiI7lN3sbcQzFGb4KgJfBjDYnElZYIsJkWmVzNlTJ1VlJsiOA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>81</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43474.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Love or Lockdown?</title>
			<itunes:title>Boy Talk: Love or Lockdown?</itunes:title>
			<pubDate>Wed, 10 Mar 2021 00:01:00 GMT</pubDate>
			<itunes:duration>56:40</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-loveorlockdown-/media.mp3" length="40806416" type="audio/mpeg"/>
			<guid isPermaLink="false">8266ec68-b1a1-4371-bf91-13892856b32f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-loveorlockdown-</link>
			<acast:episodeId>8266ec68-b1a1-4371-bf91-13892856b32f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-loveorlockdown-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeyuocSwp4creX1UPP/V0dSdM4JJwi01NIxlJBP+apVlln4EWe64AtIGJrzNdUgFkRvu7Af1Aq8y8WdyzuhXPt09pNTPeAluSzoSj9cHZ7ZALYCe0J2lBag1NeSt9GgRjfMU7R2GybQyLWKt6+6wDbT/yc1FmIzJv10q/FfgsrOi9UxxWe/xI4tqtjShHMTwPUThRJhca2Yd8lMoP8Ou3w0VI0mf9jOqE0JM2AsDviVoA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>80</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4347b.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Drama in the office!!!</title>
			<itunes:title>Girl Talk: Drama in the office!!!</itunes:title>
			<pubDate>Wed, 03 Mar 2021 00:01:00 GMT</pubDate>
			<itunes:duration>45:53</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-dramaintheoffice-/media.mp3" length="33045536" type="audio/mpeg"/>
			<guid isPermaLink="false">d776b585-c04c-46ee-88ad-a516af5d9016</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-dramaintheoffice-</link>
			<acast:episodeId>d776b585-c04c-46ee-88ad-a516af5d9016</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-dramaintheoffice-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCegQJkKycJFayACpO7xVv+zSuKHa3Y3MKxpubz94vehqDQme7bag4UEGAYK2zgP8uKD0cin44tlfrvmvRszsoWqw0hxNq9vmic8e6VMmofdqrOVTVDhmL1ZBlBHzTm75Wfvn+S0C6Uv0XHbq2m+l+TSykfkrNGWyyIIXJCX4WJMQckgGBowi9+wF6zpH8rK7AU0j/rV/toc81OZqC/VMsEYKsohOjZm5XxcyxqXT+yZ8Q==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>79</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43482.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE SINGLE FILES: 6</title>
			<itunes:title>THE SINGLE FILES: 6</itunes:title>
			<pubDate>Wed, 24 Feb 2021 00:01:00 GMT</pubDate>
			<itunes:duration>38:32</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thesinglefiles-6/media.mp3" length="27756128" type="audio/mpeg"/>
			<guid isPermaLink="false">49c70cea-63fc-4f23-9a5c-d92d8e322e2f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thesinglefiles-6</link>
			<acast:episodeId>49c70cea-63fc-4f23-9a5c-d92d8e322e2f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thesinglefiles-6</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf31qay2ibIAICWJ3f21IGNwN82lVsrB9+9HIMTWXjWMapKv/N5HrDPz56HJLhVGfYH3709rrUFv8cjcqVVICjaKof+YXHBwhAz2MMmFurNvkqim7qKNGeGrpMpRolNzNUVc6T47QOYRzOoRhbf6tJ/LJ6kOPXhrfMImnwpbNqYhw9/5hhvQ01kYTI0HXAYVYkhULfKIxwQjLp6nYajufL0PAUt+ZfcJ6Dqj39EYjPJfQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>78</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43489.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My ex has me on his vision board... HELP!!!</title>
			<itunes:title>Boy Talk: My ex has me on his vision board... HELP!!!</itunes:title>
			<pubDate>Wed, 17 Feb 2021 00:01:00 GMT</pubDate>
			<itunes:duration>48:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-myexhasputmeonhisvisionboard...help-/media.mp3" length="35058656" type="audio/mpeg"/>
			<guid isPermaLink="false">89f415c3-8b04-49ac-a652-97e1df52f65e</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-myexhasputmeonhisvisionboard...help-</link>
			<acast:episodeId>89f415c3-8b04-49ac-a652-97e1df52f65e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-myexhasputmeonhisvisionboard...help-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfTVCPOFSBxdqH1MpZhbTTemC1Iaw14/jwTCTMKSjmG+fjV3sJ3ptBRnOnwsSIs+JCET4qJH3Igkf6XIrW54cMA/n6AMIebSx/3nwow8osIMbO4rhRIVGQFZty7Tznd+OyTFQ3ACMoTBaNC8taCC1QF6IG413OtFT7F+lwrJzxhGYrifeK4JoxS2esTgxaT9yIPFvQHHN4AG0iwQB3Y8TQSJt4xbLjqZy89a0FJKw11uQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>77</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43490.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I stole my friends date... oop</title>
			<itunes:title>Girl Talk: I stole my friends date... oop</itunes:title>
			<pubDate>Wed, 10 Feb 2021 00:01:00 GMT</pubDate>
			<itunes:duration>49:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-istolemyfriendsdate...oop/media.mp3" length="35689376" type="audio/mpeg"/>
			<guid isPermaLink="false">ac6b56fa-3684-4135-89c1-c5317bc6e504</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-istolemyfriendsdate...oop</link>
			<acast:episodeId>ac6b56fa-3684-4135-89c1-c5317bc6e504</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-istolemyfriendsdate...oop</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcHRxzgN6zgz4uAEROoqDqMjIzYrZohS7iah57gLZOoT/tOBfhuCAdFP1shWaNhaG7j8UMxOjtvt+7orJqZ2nyx3yWOXYAi7/MVSCWPzd1mXrm6jLi2o4FsJDaOoPMRtqdp9N6bcSONkWGnPYxt5sZzSFggkxicsSSEfFkrQP7y3dhpSExb9nxVgga4S/otGlVrMdXIh/t+cagvH08LcWBuPrWJTnVFKPpPkjcBU/8QYQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>76</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43497.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: In love with an INMATE!!!</title>
			<itunes:title>Boy Talk: In love with an INMATE!!!</itunes:title>
			<pubDate>Wed, 03 Feb 2021 00:01:00 GMT</pubDate>
			<itunes:duration>48:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-inlovewithaninmate-/media.mp3" length="35232752" type="audio/mpeg"/>
			<guid isPermaLink="false">1cd22bea-2fbf-4ba9-a014-43c14f563bb7</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-inlovewithaninmate-</link>
			<acast:episodeId>1cd22bea-2fbf-4ba9-a014-43c14f563bb7</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-inlovewithaninmate-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe2Ea10S0aBTfMux0Eeep3m3k8b3l57vCcMeP1DzGjTveWJERTCCtWeNnoCxTCqa1NBGiRx4jOSNgVDgL3Km1HB9xcOIX64AHqVywkP9V09F6jXxXeF4EY8DSPbdvSmPfl+MdDzeFcADV0KYxAvsqTcpD8cw5Ty+I6dAapU7KTthX6t4qSy9LxvRR6xfPZRZBmDqcTjoL9TEoV5PpxXCc5eiah3/o65k4EJZMK09tH43g==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>75</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4349e.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Single, lockdown + living alone... Help!!!</title>
			<itunes:title>Girl Talk: Single, lockdown + living alone... Help!!!</itunes:title>
			<pubDate>Wed, 27 Jan 2021 00:01:00 GMT</pubDate>
			<itunes:duration>45:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-single-lockdown-livingalone...help-/media.mp3" length="32516768" type="audio/mpeg"/>
			<guid isPermaLink="false">69883957-b665-49ea-b85f-4004af5c23bb</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-single-lockdown-livingalone...help-</link>
			<acast:episodeId>69883957-b665-49ea-b85f-4004af5c23bb</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-single-lockdown-livingalone...help-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC39NdJK11FdR6IthdfURm6ef5cbxu5yW6l4jMcsNuyzbGgTXlufVdnpIDfcEcljokRVG2FeMr+kJ4rhro4SQt0bSCui/SCkDDdguHQvFsRJNz7NzHqjr13BN+UMxEpQlCgEgl3/8It+4PhkfsjxA94YujaACNEFHoEP7WBYnAkh0+29daysutObBCvkzBaL8hC+RcnIqkAhU1ou3AvV86/DYtjIx6t7i/DPq1dkpbVcQMPmmn15duBrmsDCbU/RKfEAoeWr0bf+kieT61hPH7/g==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>74</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434a5.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE SINGLE FILES: 5</title>
			<itunes:title>THE SINGLE FILES: 5</itunes:title>
			<pubDate>Wed, 20 Jan 2021 00:01:00 GMT</pubDate>
			<itunes:duration>43:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thesinglefiles-5/media.mp3" length="31567232" type="audio/mpeg"/>
			<guid isPermaLink="false">bb0e6fd8-e72f-4f8e-a637-57d9421e1071</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thesinglefiles-5</link>
			<acast:episodeId>bb0e6fd8-e72f-4f8e-a637-57d9421e1071</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thesinglefiles-5</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdcqZbLOJEQ80CGGV9YjxhFFq/GspfQYHVPeUjD7dvbtavm4RKzU74AZIZyGo0QB8FdDizK8cbzz2aU5UW281PiWAudgR6B71jXTEbisUqPdLZPXbdtP4/Iao+cHfqq82SqB74HZ4gZ1DbEr/b54F2B6BCxS5PabhQzoEPyP4u86uHXJjSqmPgWuZ0ZhhSuaezixGKvalgssxG8GC/cIAyaPvmCZhV5Zl9M9o3vfJjQzA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>73</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434ac.jpeg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: HE BLANKED MY NUDES!!!</title>
			<itunes:title>Boy Talk: HE BLANKED MY NUDES!!!</itunes:title>
			<pubDate>Wed, 13 Jan 2021 00:01:00 GMT</pubDate>
			<itunes:duration>41:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-heblankedmynudes-/media.mp3" length="30194768" type="audio/mpeg"/>
			<guid isPermaLink="false">9e60a7fc-23e3-46cb-8d13-5c353b2c9874</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-heblankedmynudes-</link>
			<acast:episodeId>9e60a7fc-23e3-46cb-8d13-5c353b2c9874</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-heblankedmynudes-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCcHeijf688BvTBlxC8trFn4idYj+1UlmAvoh4C6mPT+pYtakcaxssR6J+/yYqqcMdcU2f60yBSM2CJ22kBO5U9YzZaeCDTUSJFZQSDBol4ldSKVOOpZTy9Fy1dYnpVMfKKRldCwC40Aq0zgeLNrPQZu/41ZJ0H1AT5naeEtslKVOk4Ti1an+nu9V1u5REw16/Cm0NJmhHiHlRMw2bbYiF4BJGOEQuEHuRy5Iod1mrcIkW6dWkFk+wrOtZ0ksQNpgOd+BvRk6Hqj6FXhgO4a280Q==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>72</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434b3.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My bff ended my relationship!!!</title>
			<itunes:title>Girl Talk: My bff ended my relationship!!!</itunes:title>
			<pubDate>Wed, 06 Jan 2021 00:01:00 GMT</pubDate>
			<itunes:duration>44:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-mybffendedmyrelationship-/media.mp3" length="32381552" type="audio/mpeg"/>
			<guid isPermaLink="false">b14b7808-1661-4bc6-9eea-5648956fd21b</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-mybffendedmyrelationship-</link>
			<acast:episodeId>b14b7808-1661-4bc6-9eea-5648956fd21b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-mybffendedmyrelationship-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfkH7F/qyjT52qrBxSuTmYhNpwVEDhTRRCPu2Uyv7fVEMBWPxydD/BCAv3wMFDFhaWBcsenNHDs+RFMpnc7Vgqj7lMglPee+S4Avv/GzbCq8g5P+sqckxs62fVER65sVCNrpH+VHIkT48CFC0uNtVwp6r2QSUTXDHHu9UhOLcmj4ysJHGYWT8MqRW07VdaGZt296MtakUSdGpuxBCIOl04X58je8sm06Ui/Tzgo/TThdg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>71</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434ba.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My tinder date is about to become a DAD!</title>
			<itunes:title>Boy Talk: My tinder date is about to become a DAD!</itunes:title>
			<pubDate>Wed, 30 Dec 2020 00:01:00 GMT</pubDate>
			<itunes:duration>45:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-ineedtogivemyboyfriendspace-/media.mp3" length="32608352" type="audio/mpeg"/>
			<guid isPermaLink="false">8b178ff1-7e4b-4b02-b8f9-a9da0e82e96b</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-ineedtogivemyboyfriendspace-</link>
			<acast:episodeId>8b178ff1-7e4b-4b02-b8f9-a9da0e82e96b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-ineedtogivemyboyfriendspace-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCGYaofaGxH4MtLEvfkCM9CMshjXrsM5WfTbBLtr2pAWjn6MFZTxVFvaWUnwm2UfLX26km8FRfP8g1XX0pgeQG05NLSuewNKF/tt7223iOiRIzmtnLlplWBHzKbiSWWrckl09MNwzHBotOMhs9qWFnwWKmeScpkPdKT6Tp8xIZywcrE4tRFCJZ2ViML/yv9bbB2NJfSyMSdX8FBF/2XgrcVFS3my/7/+KxWR0nxWaLCTnPCVEmUFighU071Es1aSqgh1e9rF0Z7KbSKCYftWHhAg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>70</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434c1.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: I'm staying the night.. HELP!]]></title>
			<itunes:title><![CDATA[Girl Talk: I'm staying the night.. HELP!]]></itunes:title>
			<pubDate>Wed, 23 Dec 2020 00:01:00 GMT</pubDate>
			<itunes:duration>51:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-imstayingthenight..help-/media.mp3" length="37140032" type="audio/mpeg"/>
			<guid isPermaLink="false">452b0dea-8fcf-4840-8d98-8f750215e1f1</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-imstayingthenight..help-</link>
			<acast:episodeId>452b0dea-8fcf-4840-8d98-8f750215e1f1</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-imstayingthenight..help-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeHA7Da62GlBRQADtl59jJ0OxX5S2w1O5JW9xIUp6BlyqobdxsMpgxatdf0L+Gq5ENlr4WdNwGY9NblJzzRqLa0qyD2nVkum158kDYfVkHCguTPPs0GGJrkuW6VX1SSLhZRKry88vThQWL68TbjPLSNrgTYQ+waXpV411tOvU4QqIcKHYkTHVCFyb+29WjI4Bw14N4s1NVBxVr5wxJ5ODIWZ8V6WN/5+/1GSYLryO2aZg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>69</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434c8.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE SINGLE FILES: 4</title>
			<itunes:title>THE SINGLE FILES: 4</itunes:title>
			<pubDate>Wed, 16 Dec 2020 00:01:00 GMT</pubDate>
			<itunes:duration>43:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thesinglefiles-4/media.mp3" length="31047536" type="audio/mpeg"/>
			<guid isPermaLink="false">b24c242b-740d-423b-893e-814c5a462b26</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thesinglefiles-4</link>
			<acast:episodeId>b24c242b-740d-423b-893e-814c5a462b26</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thesinglefiles-4</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfskOzKJT8zRbYvEmL7UabjBgkJX1R9J7S5Spo5hTynjydn0oVUne1fht2cUu68nW5GOqZKAlVtekSvSagoUQnKdd6lX2JuQyHTALTqaCfiTDRbfmFJxj+GE+4JpjE9nChvoioSyA/gPrSxYz1wplox8WEy+d0GFJK3hJZNspJUzimxl4iMiGpdnMDFHWIFbnq4fgDTptF8klDe5yOJ5lu0XN6+ujfTvJa+TWskPFyG2w==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>68</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434cf.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Stuck in the exclusive stage!!!</title>
			<itunes:title>Boy Talk: Stuck in the exclusive stage!!!</itunes:title>
			<pubDate>Wed, 09 Dec 2020 00:01:00 GMT</pubDate>
			<itunes:duration>49:01</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-stuckintheexclusivestage-/media.mp3" length="35296256" type="audio/mpeg"/>
			<guid isPermaLink="false">ad6c8b00-42ea-4861-a57f-17f87b269ba7</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-stuckintheexclusivestage-</link>
			<acast:episodeId>ad6c8b00-42ea-4861-a57f-17f87b269ba7</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-stuckintheexclusivestage-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe9s2n59g3CyB0k5qLpMMD1aykXL/m9UjvvA8eyG/SIXXVmdcHrb2zgskkMKDhyOWU+t2oklZsJlz1Vkcuj8e9df588cRazkPq/wxdhedMcpzq8r+FgKmj3/635e+JqHlDIgrjKUijlmnJ5jz83ew16yFGuzesDyl/0vsYbpVjbmkthlVk5mrtFyXLp+Bbg/mvf/7D20Nra0u+/Tg57eXyGtZ8ba/YmJVf+PXTyrORKfA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>67</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434d6.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My bff is the side chick...</title>
			<itunes:title>Girl Talk: My bff is the side chick...</itunes:title>
			<pubDate>Wed, 02 Dec 2020 00:01:00 GMT</pubDate>
			<itunes:duration>53:08</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-mybffisthesidechick..-/media.mp3" length="38266256" type="audio/mpeg"/>
			<guid isPermaLink="false">6025a83f-aa45-47bd-96e5-21b77295fec2</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-mybffisthesidechick..-</link>
			<acast:episodeId>6025a83f-aa45-47bd-96e5-21b77295fec2</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-mybffisthesidechick..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeAd24vK06EKF0jEjonrJgnoqGhze3VThSGd5kM4gmrwzxBd2VB82rSOf44zzmLBs8eBmEmcAeCe67XHKwVOQZZ+dWbQg5IgsZ5b3gDoD0D0I+sG/tUqWtMu7kAgx9w+hPKCJ+yConrC6N65V1NAo1jSudwLn1rw6ybvlmsszxJZWLkQqd/cg1vraMqzYtiZYkNAoW9AdMByD+daNJDIFRsmC3qSp2EkRl7EGp7ewZJRw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>66</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434dd.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: It's Cuffing Season!]]></title>
			<itunes:title><![CDATA[Boy Talk: It's Cuffing Season!]]></itunes:title>
			<pubDate>Wed, 25 Nov 2020 00:01:00 GMT</pubDate>
			<itunes:duration>49:00</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-itscuffingseason-/media.mp3" length="35288912" type="audio/mpeg"/>
			<guid isPermaLink="false">24324a5c-6dd5-47f3-af7d-4b62b359cfe0</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-itscuffingseason-</link>
			<acast:episodeId>24324a5c-6dd5-47f3-af7d-4b62b359cfe0</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-itscuffingseason-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCUe+phGuTLHBDUQfv5IGsOt5J+niDtnWshrSOJe8Y9KU6s0c4RTKx77oL8QAciAVEuuiufMgXbmYet205S7ykgPbCRS0+qFYfrUlR+H1FHIX0VKsSC6rsS3YSG6vkMOwWNOlThdMcEyM+VpBSws7JT27QA2VOzBnXkKp/vKUeABH+//NGVIGjMpk0U6B1d+elSAMcYVbONnnLYAW5OvIKXu0t4Pad7yCwjWXslr4KKWzeLCw+u4nWYNbG5YySHZ/bsKGZWjLRwmVtzCkf0WBtGA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>65</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434e4.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I regret ghosting him!!!</title>
			<itunes:title>Girl Talk: I regret ghosting him!!!</itunes:title>
			<pubDate>Wed, 18 Nov 2020 00:01:00 GMT</pubDate>
			<itunes:duration>51:58</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-iregretghostinghim-/media.mp3" length="37425152" type="audio/mpeg"/>
			<guid isPermaLink="false">1ddef6bf-d4b6-476e-b280-25c9922991ab</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-iregretghostinghim-</link>
			<acast:episodeId>1ddef6bf-d4b6-476e-b280-25c9922991ab</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-iregretghostinghim-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCDmKv9PBdTISgH7hZVaf+W+QG6xqWgVUg8fiFvEq8tZdBpA9fuc+ojPr+PtiH9IMQ3HCAIF2y/uwanRu2Lqvhlgj/SFGbtk6FYHf4YxiRADrxcmWWJBWeCrIpnOrOWhzHlGa4rBy8JgYGttwzAal4wFMUfljld+3vQwfT5XYdMODyhTJnJldwovlF13j9xApdRVT/w+WzUJ1itCX3uNg/woZzYWl2hgSIy11IzzlPJg19Cuk5J8J8Eg3F4kyS8uaSCTnYnxye6ekgVz5xO59vqw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>64</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434eb.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE SINGLE FILES: 3</title>
			<itunes:title>THE SINGLE FILES: 3</itunes:title>
			<pubDate>Wed, 11 Nov 2020 09:52:43 GMT</pubDate>
			<itunes:duration>42:14</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thesinglefiles-3/media.mp3" length="30412928" type="audio/mpeg"/>
			<guid isPermaLink="false">4661f77d-e488-4596-8ad5-0aec547a868d</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thesinglefiles-3</link>
			<acast:episodeId>4661f77d-e488-4596-8ad5-0aec547a868d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thesinglefiles-3</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfbgnFT0cNZmEU3h/z4u29ooOTbA0ObMBUIej8WZh1rW1bPmM0DYlPq0lUjHMXGF3TGpBTQ9QPpBBsJYsJ8+XGUT+Ae9xgNMZrkWZQhvld3JujDgSMtR6vNPlMTH/AWdE455dVMsPfZBQUF1/5RgAwQVcBJGn1LqwLdZP3jE1YUT+QxPQS1c8RYMcJRdRbjg6cq6+QMyhuljeQ4HZZ6Gh7E5uyX8PjNvpZ3xbjMV73BjA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>63</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434f2.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Will lockdown kill my new fling?</title>
			<itunes:title>Boy Talk: Will lockdown kill my new fling?</itunes:title>
			<pubDate>Wed, 04 Nov 2020 00:01:00 GMT</pubDate>
			<itunes:duration>49:27</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-willlockdownkillmynewfling-/media.mp3" length="35608592" type="audio/mpeg"/>
			<guid isPermaLink="false">f424e0dd-42fb-4d12-8791-e5725507bc45</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-willlockdownkillmynewfling-</link>
			<acast:episodeId>f424e0dd-42fb-4d12-8791-e5725507bc45</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-willlockdownkillmynewfling-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC5q70fn4JYl7T20kYdoR8iUeTAsczmU1YKvc7Zoi5t8/DmkXYFWYMg9teCDyILCyyRFDfsuqpcKwKeqMz6W7vuaInffUXiXEBMFle6i4hZPgz8cI/SMQiukiBeR1tM7WILOfrLBHGJ3hU1e4fmLjUTf7khq1dzZ6M0HyCnhA0RE7yMHVuaOH77S1ISp/qjpqUae6w4cYHDbJbD7vUM5ugXro9BI7IluWbBnZHefqPA4h5MMZWAdRIt6TL1htXdb6KI96s3Vw+lT3qqeWGdbtVrA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>62</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e434f9.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My Boss subscribed to my Only Fans!!!</title>
			<itunes:title>Girl Talk: My Boss subscribed to my Only Fans!!!</itunes:title>
			<pubDate>Wed, 28 Oct 2020 00:01:00 GMT</pubDate>
			<itunes:duration>42:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-mybosssubscribedtomyonlyfans-/media.mp3" length="30286352" type="audio/mpeg"/>
			<guid isPermaLink="false">9fe4d0ac-2f6c-47d7-9507-1dc13cf72ab4</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-mybosssubscribedtomyonlyfans-</link>
			<acast:episodeId>9fe4d0ac-2f6c-47d7-9507-1dc13cf72ab4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-mybosssubscribedtomyonlyfans-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfQUWqbwhGOreAhsXE8K28Ci1LevhWhwxEeLKCHvavf9nlRASL5AmAqamJ1w19U3JoKLxeTVg3kZdQpTKAsKlOk9H/IWMJ3njLJ9k/A2EjZDazcZR/xBA53Luv7QAyqzldM0Kt2L8WFck60/M1CVmxY3EHx/2MoWcDvsWOWluGhhMixAdH5GOaAekPztknmCZlByR59ZmsGBGaVtTOnniwjqiawTc9jLSZXgFLB5oA4VQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>61</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43500.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: He told his friends i'm NOT the one...]]></title>
			<itunes:title><![CDATA[Boy Talk: He told his friends i'm NOT the one...]]></itunes:title>
			<pubDate>Tue, 20 Oct 2020 23:01:00 GMT</pubDate>
			<itunes:duration>46:39</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-hetoldhisfriendsimnottheone..-/media.mp3" length="33596768" type="audio/mpeg"/>
			<guid isPermaLink="false">888c289a-ce87-4c3d-8185-0377f23642d7</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-hetoldhisfriendsimnottheone..-</link>
			<acast:episodeId>888c289a-ce87-4c3d-8185-0377f23642d7</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-hetoldhisfriendsimnottheone..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCWIo6PD0G6mo2oN2kqBdmKTGyiECWXWFM/RUNxfhLYdc3FYA/pKVgv5+PIAuCxuoCYpLWxvUgRApLPtt/dNl5sezj5UXFgn62yB1QULNriuHQ2YfkloDilSNF7xR0cFyrxJZY3fKEmuAa31Gz4FDU+QaZpnfJGEP63xC/ektazBYEdrQ/fiHGUgyeRKLd28xjTAKmCZCStEWM1+VaVpmSx5F3EUQSbtlVLR8F9eRLi+Vn2nq1ry25rQ2Hy9XtsblqZOXmtkVd0I5RtRqnrssFWw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>60</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43507.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: Why can't my friends just forgive me!?!]]></title>
			<itunes:title><![CDATA[Girl Talk: Why can't my friends just forgive me!?!]]></itunes:title>
			<pubDate>Tue, 13 Oct 2020 23:01:00 GMT</pubDate>
			<itunes:duration>39:45</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-whywontmyfriendsforgiveme-/media.mp3" length="28625312" type="audio/mpeg"/>
			<guid isPermaLink="false">99485a4a-1096-49d0-a26c-f71aeb03ca3f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-whywontmyfriendsforgiveme-</link>
			<acast:episodeId>99485a4a-1096-49d0-a26c-f71aeb03ca3f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-whywontmyfriendsforgiveme-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC2Ku1jiHJwqIaQX35lT5VjrvKMFhcM1JbRVpFxl2Uv2mz9Mf0GrwAmb3lgxkf0I9kATjC5vOGzhOiHHFKu9BO74X+3/6S5kOWP8PWT9If8LnVw7bYW3qLYIXws5Gu+AmhDqEaQI3gAsZ9vB467B51gksDCy6Hh49YL5/pxHHYKyG5J7PHAYQGe9EUe04bYk99KsFSwq9yqKDRyAWBX5b5NUtLQDbYthaq4Ht96Y2Dqz41YivFkjgvbnDUAnPjbNwqWmrREHYW7abTJM73ZfVK8w==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>59</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4350e.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE SINGLE FILES: 2</title>
			<itunes:title>THE SINGLE FILES: 2</itunes:title>
			<pubDate>Tue, 06 Oct 2020 23:01:00 GMT</pubDate>
			<itunes:duration>41:51</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/singlefiles-2/media.mp3" length="30141632" type="audio/mpeg"/>
			<guid isPermaLink="false">e629e530-7e68-4969-8076-141312e60a3c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/singlefiles-2</link>
			<acast:episodeId>e629e530-7e68-4969-8076-141312e60a3c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>singlefiles-2</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeSEnEHlffxq/jQqjJA9WMWSw0rdaaUtJgbyyZt5cuzM0xIw2Z+3i358O8cOZirti0+ifC1bZZ7l/kehwgBuPrFr13F79lHlgMe0D8OMpE2OORTubZ6BaGg/FVNi6voaD4Oe2q4AxeLcYLzmJjpTWjIMmjSBkEza1Ft1GcVOzcnm4hv202GLbUROMBtlL3pwdOeRNGWAJ1ukHLUzMGUm2oJRquixmcZAKYpDsst0Ha/IA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>58</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43515.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Fwb with an EX..?</title>
			<itunes:title>Boy Talk: Fwb with an EX..?</itunes:title>
			<pubDate>Tue, 29 Sep 2020 23:01:00 GMT</pubDate>
			<itunes:duration>52:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-fwbwithanex..-/media.mp3" length="37908128" type="audio/mpeg"/>
			<guid isPermaLink="false">5c41b975-f94b-4a73-a46c-bf887169a2ac</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-fwbwithanex..-</link>
			<acast:episodeId>5c41b975-f94b-4a73-a46c-bf887169a2ac</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-fwbwithanex..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCdaBR0luktH/o3+VILTx4yKx7dZeW56Q5R/zMs/n0zoUkRvRnycLkFpWhLrbzzwY8Zo8J1ARHYAyoZ1lC9Ac65BlMJuB9d13P0jtix7mXpcsF9qU1kq7q8HiX7P3vde4jpa5MJXI2OXRyk19Cl67RKom+Tiufi+RqTnE0bKfAM9W5urvKYLLAioNeyYclrmO5JLdKDyNTrVU8WtLVYnxp+Qsnl76hJpJWWSr/bA2BkUnvcOedl1Hp3Fe4z2uw6Oxh18tD/1btkVBJOBgq+JWLZQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>57</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4351c.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: Toxic Trio's...]]></title>
			<itunes:title><![CDATA[Girl Talk: Toxic Trio's...]]></itunes:title>
			<pubDate>Tue, 22 Sep 2020 23:01:00 GMT</pubDate>
			<itunes:duration>42:28</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-toxictrios..-/media.mp3" length="30583136" type="audio/mpeg"/>
			<guid isPermaLink="false">766d0c73-cf90-4afb-b66c-882a28d372b0</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-toxictrios..-</link>
			<acast:episodeId>766d0c73-cf90-4afb-b66c-882a28d372b0</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-toxictrios..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdLlhGj8wIJe0T93jJqkdqm6dzZ1Y9IW7R64XyYAN79mqeOqoMDm7h0PBUcYse4TeM2IQ0Kr05mu0deDbbKJmlsmsXp9hr0WbsQ7Fa8R/pymS3XIxRyUy1RXY1XjaBJGqVDNu4w3Zi7/AOXQdCuk71nMDBT710c3s8R3TllrxXkyDsHtAweakf8YRq5D9f2ITgOdXuR9kvMxJAwd6X3wfSmoraelrhStL8L2fPYw5cHgg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>56</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43523.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Men are from Mars!!! Feat. Private Parts</title>
			<itunes:title>Boy Talk: Men are from Mars!!! Feat. Private Parts</itunes:title>
			<pubDate>Tue, 15 Sep 2020 23:01:00 GMT</pubDate>
			<itunes:duration>46:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-menarefrommars-feat.privateparts/media.mp3" length="33839552" type="audio/mpeg"/>
			<guid isPermaLink="false">98ed40b0-0144-44c8-b363-49d3ff0c5f60</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-menarefrommars-feat.privateparts</link>
			<acast:episodeId>98ed40b0-0144-44c8-b363-49d3ff0c5f60</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-menarefrommars-feat.privateparts</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCePZjvgHJB5WZyAVxXUArlPOEDOmTBSifzDO71hjyTeBK1h6brnfN/4FFDD5NbMYnTzChf/Fr9wOqKGwgkBzAwA3pj2clgC4tAA1abUHMWU72UgoOd5gjjZ5fXpHVKZPq1Qfj0IkrgEE+5Rjh3ED1WiGIoWtnxoCBsSqTbM5Je38Pxq/zfW+nvH+X0FTHVUg+vaz5aKuDP2VD8vR/YNfrcHaeqx+9CLKwK7pnCDoKvVxcrMkJecpH7HUMEmuaN7/BaC8n6pVGEZqrL/+GtbGgTw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>55</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4352a.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: I love him but i'm not IN love with him]]></title>
			<itunes:title><![CDATA[Boy Talk: I love him but i'm not IN love with him]]></itunes:title>
			<pubDate>Tue, 08 Sep 2020 23:01:00 GMT</pubDate>
			<itunes:duration>50:56</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-ilovehimbutimnotinlovewithhim..-/media.mp3" length="36678656" type="audio/mpeg"/>
			<guid isPermaLink="false">6e13097f-f80e-4d33-847a-760f9ef54525</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-ilovehimbutimnotinlovewithhim..-</link>
			<acast:episodeId>6e13097f-f80e-4d33-847a-760f9ef54525</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-ilovehimbutimnotinlovewithhim..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCee2CBjFAzOE1kVn8ZCSSNwsTZoJCy3Ue056vetH8l+/5pxllUCACRkl0IY12vGrShFKNDB45Yd1dacC/AQOcS/VB1b4tvybwCoxPmUEHrZSn7K9p0q3VEi27OKWdVvFccaOj4gWQ6zQIg2vX53h2IEPXZT1dkIXb5qz6lw6H4K1WoPDdv3waMKDlFOKDh7unG3rQQ3Xog5wOOKbWPbXqzXiBkh4W1QDzfgzGYuXTw+YQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>54</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43531.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>THE SINGLE FILES: 1</title>
			<itunes:title>THE SINGLE FILES: 1</itunes:title>
			<pubDate>Tue, 01 Sep 2020 23:01:00 GMT</pubDate>
			<itunes:duration>45:09</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thesinglefiles-1/media.mp3" length="32511152" type="audio/mpeg"/>
			<guid isPermaLink="false">4387facc-2360-4390-aeaf-e521ebfb4809</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thesinglefiles-1</link>
			<acast:episodeId>4387facc-2360-4390-aeaf-e521ebfb4809</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thesinglefiles-1</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcV1NXa6ux2UMjxz/ltFnwhA5LgZwUtkeWsPOBASFWUbACMqui8BwIqgEKngLsWUom44bnqtNHvS9PcPl1s9iKrUpDPhnk1mavVim1D28DK+HRePfpwcaMkMpf/71YRLPckNoa+Tp4pg+EefB4qan5FffP9uZNQ/pEZtgc9/+6AlOvVgtz06IEIGBFRShNPbF+X/6klNnHOQxyezKa+DsrqkI14qb7SeoWdLdGKWbF0WQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>53</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43538.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Should I move in with my boyfriend?</title>
			<itunes:title>Girl Talk: Should I move in with my boyfriend?</itunes:title>
			<pubDate>Tue, 25 Aug 2020 23:01:00 GMT</pubDate>
			<itunes:duration>48:18</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-shouldimoveinwithmyboyfriend-/media.mp3" length="34781312" type="audio/mpeg"/>
			<guid isPermaLink="false">ff184a33-5c7d-4d45-823f-3d46043bfe63</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-shouldimoveinwithmyboyfriend-</link>
			<acast:episodeId>ff184a33-5c7d-4d45-823f-3d46043bfe63</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-shouldimoveinwithmyboyfriend-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdtEjdGclZsiSznL9+vhn/GWND3w+YBCJZBZ9xMMHXKBYmHmYJavTFKRPrMFKposvo1qTtbBPKKNFs97nP5GFZ2ErDma/X2bHZonZeZM7pKr1wxAdTfQqVMR+oNVEEbEUHKgK1/18FlpaPkfBB7hvThss9hPas5Ds8MX1T7Hdl64cIiZlArcxfRFAfiG3ANrPrXvYW2uX/f4Cz7SIvzxiTFXUMkxNB9bgAY0MW3Txa7+A==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>52</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4353f.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: French men and mixed messages!!!</title>
			<itunes:title>Boy Talk: French men and mixed messages!!!</itunes:title>
			<pubDate>Tue, 18 Aug 2020 23:01:00 GMT</pubDate>
			<itunes:duration>47:48</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-mysoulmateisengagedtosomeoneelse-/media.mp3" length="34423616" type="audio/mpeg"/>
			<guid isPermaLink="false">1b68fe3b-044a-4282-a2e9-91d5acd2f164</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-mysoulmateisengagedtosomeoneelse-</link>
			<acast:episodeId>1b68fe3b-044a-4282-a2e9-91d5acd2f164</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-mysoulmateisengagedtosomeoneelse-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCVxhGybstAHazpFByWK9LfrP49QXY3o/vABdo5H1ghbJrC0TuWRk5vXvf9r7JAl+ia08AXjtRh1DKtUWotYv4sZSbSkgx1/tLiEoIhWhAxmSYgot7k+Ys3oWeefZmo2QdYRh7S00B496VaC3PaxI6x5dJfv0o7msCRaQ4Md2Qk0KOXDhhweJ7o4WVw/x3ho5Q8DjGllTQvPXpN2Zfu/nAmyqaFsoq/VKZuMz3CNCKaAMZdjbPTdhIbupkaEFsDJRUv0GrDbaR4FLZ6PEvRQiQKg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>51</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43546.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Feeling ‘behind’ in life...</title>
			<itunes:title>Girl Talk: Feeling ‘behind’ in life...</itunes:title>
			<pubDate>Tue, 11 Aug 2020 22:01:00 GMT</pubDate>
			<itunes:duration>52:46</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-feeling-behind-inlife..-/media.mp3" length="37993232" type="audio/mpeg"/>
			<guid isPermaLink="false">c3f0cabf-044f-491f-b0a8-76902e06a8ab</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-feeling-behind-inlife..-</link>
			<acast:episodeId>c3f0cabf-044f-491f-b0a8-76902e06a8ab</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-feeling-behind-inlife..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdet1cRPMU/FYnsV+LMGOLUskFxL1C1maJUR1skONOVjE1JvKycxp8KIW/Id8K/QSMWRS2Y75x5rwyILNZe2qZENU+Nxsif2EXGKL9vVv2Jd8QEazEx+wIXNpTRxGMIfVn6oCE007KUwFbTjTuGTXCp11vCTD2PHGWx6+ERhV3AHziyqoj01hCQEEO4NRGVd8wKfp5vTRNbChif/K5ZqfDmKYFsx10YNRffbxRI7Dwi7g==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>50</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4354d.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: I've got into an entanglement with my roommate...]]></title>
			<itunes:title><![CDATA[Boy Talk: I've got into an entanglement with my roommate...]]></itunes:title>
			<pubDate>Tue, 04 Aug 2020 23:01:00 GMT</pubDate>
			<itunes:duration>50:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-ivegotintoanentanglementwithmyroommate..-/media.mp3" length="36453152" type="audio/mpeg"/>
			<guid isPermaLink="false">9cbb588f-c869-4e6f-9d20-2929fd273977</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-ivegotintoanentanglementwithmyroommate..-</link>
			<acast:episodeId>9cbb588f-c869-4e6f-9d20-2929fd273977</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-ivegotintoanentanglementwithmyroommate..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCqKVA/5LsL4WzY4OTO1mIcncdK9IfvSmqB1vU0IvtGI9o3T+oSo/mmSnpPcK9RmI28R5kSX0+29AyUlGbPfxa7rffEP5SsOBKHxJ3In8ftXf915KbDnNP8JWUSqyc9kSPhg3c85Fd3SPN9M5yF/8yCjAUVxZ8V494tgXxOQTJpOXSUJpVR4Z5NPKTWDj32PwfDnjs7iZG7rZBIXtFcPE8NLYxMwObS1s9yKNUDC+1Oge/d8Hj34OMRKgajyQDzidlnNX64dlnxwDJpDe1Af/C1w==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>49</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43554.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Single after 6 years.. now what?</title>
			<itunes:title>Girl Talk: Single after 6 years.. now what?</itunes:title>
			<pubDate>Tue, 28 Jul 2020 23:01:00 GMT</pubDate>
			<itunes:duration>45:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-singleafter6years..nowwhat-/media.mp3" length="32838176" type="audio/mpeg"/>
			<guid isPermaLink="false">39d1caf9-46f7-49ef-95ae-0b1a5f123fd1</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-singleafter6years..nowwhat-</link>
			<acast:episodeId>39d1caf9-46f7-49ef-95ae-0b1a5f123fd1</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-singleafter6years..nowwhat-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdEl9viRUztbAeU6T5h3rGSH5KtTxSk7EGEyv0F5J57wgIktZ0FIwyH2uhtejB7e6n2OrHW69Lqywbz7I7roHZRgm/Hk3vBGH/b7y4FES09QLGN2fuQWMXNhMHePvRxQtOudrtCeWaWF82N34nE2tqHuFytbMCFBujoNLTfDvapjUKHNR0k5a4lDndQKO61xf2UEbfzXW7EfDS8ozrQVhH3dc/IssPkrLJixfgadKK7Zw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>48</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4355b.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Please slide in my dms!!! Feat. Harry Jowsey</title>
			<itunes:title>Boy Talk: Please slide in my dms!!! Feat. Harry Jowsey</itunes:title>
			<pubDate>Tue, 21 Jul 2020 23:01:00 GMT</pubDate>
			<itunes:duration>44:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-pleaseslideinmydms-feat.harryjowsey/media.mp3" length="31773728" type="audio/mpeg"/>
			<guid isPermaLink="false">b9824857-cd3a-45d9-9f93-8e1956c4ded3</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-pleaseslideinmydms-feat.harryjowsey</link>
			<acast:episodeId>b9824857-cd3a-45d9-9f93-8e1956c4ded3</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-pleaseslideinmydms-feat.harryjowsey</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCevucwUw1ltpaRNMcFRq930b/RAAYZaqrPV03Gry3dt6uh0egxinKXzTX5fdg9aJ3paJGHG0Obd/R6DW52/uYCyyVYskOgipsAcoCKo8ZMtUnVsYl7rTyVBOxIHK93mA2/ErAB61WmQePmaabtq3RxFCq70s94DUn/mTaHXO3p3fqz2w98tag9U5PGKVlUnyqNXX6mR4u1Rgze3Vbimzny1E6ypnXMQ0CC5m5qDjl/V+w==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>47</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43562.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I found out my boyf is on a dating site...</title>
			<itunes:title>Boy Talk: I found out my boyf is on a dating site...</itunes:title>
			<pubDate>Tue, 14 Jul 2020 23:01:00 GMT</pubDate>
			<itunes:duration>45:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-ifoundoutmyboyfisonadatingsite..-/media.mp3" length="33029552" type="audio/mpeg"/>
			<guid isPermaLink="false">e8c16bcc-edfc-4f64-a218-7e1f9ea80f01</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-ifoundoutmyboyfisonadatingsite..-</link>
			<acast:episodeId>e8c16bcc-edfc-4f64-a218-7e1f9ea80f01</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-ifoundoutmyboyfisonadatingsite..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfnIZzKTKu+rSOX0bsHqpM6zwsHXAVtzfnNPWQPmX9T6IKKDa7Zsarj0YGpUsRRzfE1pIUaMY5GIySzC/caZRwmyvk1mumnJkqq4zFo0H/8UQUBtt7skP69RFc6Az7CWyaLtenrU/wgoJ2tgpi0LnoNFZu+IsSEOs6PE1JTx2z5v7xcDJV5ch8pBCjYHJ+VHcWj2W70OwPNaAIOy1nQmsCa8LrpB+5oiHRmP8Wf0ulpTg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>46</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43569.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Bff using MY EX as her rebound!</title>
			<itunes:title>Girl Talk: Bff using MY EX as her rebound!</itunes:title>
			<pubDate>Tue, 07 Jul 2020 23:01:00 GMT</pubDate>
			<itunes:duration>50:30</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-bffusingmyexasherrebound-/media.mp3" length="36362432" type="audio/mpeg"/>
			<guid isPermaLink="false">80acce42-837b-416b-a153-58c52e56146a</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-bffusingmyexasherrebound-</link>
			<acast:episodeId>80acce42-837b-416b-a153-58c52e56146a</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-bffusingmyexasherrebound-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf2N+ogKPQ5eiqtUFXokPD5TeLhJe7ndqQ76oC4Chyre7U8ybLPwAHw83fxeatnwfC1zDX7WscWR6QjNMROZiMKne8NVq5y3YyoOgKlttA7NGaeiiRYEUVO7nP3obEggVxY49xzPr97g3WXWTTuBmRY4L20i09/vqE79dSGlPyExzjgJ0RpV+drUEKSw1zKJFDF+TSAKHZrNZeKYVS+HogLJuSotsfu18u4JWKBObe/xQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>45</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43570.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Im in love with two people! SOS!</title>
			<itunes:title>Boy Talk: Im in love with two people! SOS!</itunes:title>
			<pubDate>Tue, 30 Jun 2020 23:01:00 GMT</pubDate>
			<itunes:duration>50:54</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-iminlovewithtwopeople-sos-/media.mp3" length="36650576" type="audio/mpeg"/>
			<guid isPermaLink="false">a601ce21-d92c-4173-b2c0-7d8a507e2691</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-iminlovewithtwopeople-sos-</link>
			<acast:episodeId>a601ce21-d92c-4173-b2c0-7d8a507e2691</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-iminlovewithtwopeople-sos-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCg8W+yBJabTHPXfGKzciBYAu6GEZnUbNLDsvM2n25H+lPW4CtW7++DiD+XSFobsBSUyCGRXKRHHrRmeLDjEaYYOCvOZ40o2Bws5Y36z74704EPzTJhvHs6pNPbQpCnL3hFTuXvLQ2aUmRFkklDiwuJYZQSz+GPBe6LS8AFLHB9Jo3NVsljCOFKNtnHpa8ysXmNwbxX6GBWq41P+HsSqZalK5juI/OO4iDj3J1jOBJKJFM1PUgJ0AlDZtXqvbqIO3D46OEiK5nJ7T5B9UJTjl6Kg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>44</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43577.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Going to uni a virgin!</title>
			<itunes:title>Girl Talk: Going to uni a virgin!</itunes:title>
			<pubDate>Tue, 23 Jun 2020 23:01:00 GMT</pubDate>
			<itunes:duration>51:02</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-goingtouniavirgin-/media.mp3" length="36754256" type="audio/mpeg"/>
			<guid isPermaLink="false">f8147fd5-1189-4394-946f-8e571efdf301</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-goingtouniavirgin-</link>
			<acast:episodeId>f8147fd5-1189-4394-946f-8e571efdf301</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-goingtouniavirgin-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCdaick4dWVK7aQoKWdtrz4m5lwYpxjNe+vGiaOrHJXOjeUj5b6xe4ZvgYk+XgHjt2EP8eVVAqEm89w8XRLSyf1vWNt6eBeQngvgGZOh4vC4e0pAXlwQzRl6prGTHWVVTTLZICVgObOtwUP0ypLdeZZD04L9YYb2lb0cZ3UMzQ0rdRzotTPuR9wFhifW79cnd2oNWVVZPRpYsWB/Z96e7xcSKGu82Ix6lyeOtO96wd8z1A==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>43</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4357e.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Do I date my ex boyfriends brother?</title>
			<itunes:title>Boy Talk: Do I date my ex boyfriends brother?</itunes:title>
			<pubDate>Tue, 16 Jun 2020 23:01:00 GMT</pubDate>
			<itunes:duration>53:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-doidatemyexboyfriendsbrother-/media.mp3" length="38309888" type="audio/mpeg"/>
			<guid isPermaLink="false">ac6fdb10-8bd6-478f-9fbd-d13f4138e67f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-doidatemyexboyfriendsbrother-</link>
			<acast:episodeId>ac6fdb10-8bd6-478f-9fbd-d13f4138e67f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-doidatemyexboyfriendsbrother-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfuLEjBm4iLu7NeeHYRp1HGn/FLfU8gZsf+bMuUPht811qSTmW894vU6zcVCQLvAPatXv2vefq3KUXgEf8fBEa01oWPbKrmPJSpSOWaUGxf2BD1e/8RZkx8a2/HoqmJ8XeQYKRpKXikd7iNoxRK1nde5t5VoU3dBI8vqDQUQw/f1YYHMBC1MQ7MxRUIIA8iXMwXUrf3QiA5wlVNbTBPbQaXQ2r3xzjXtIS2WCS/WYJd0Q==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>42</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43585.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Girl code or follow your heart?</title>
			<itunes:title>Girl Talk: Girl code or follow your heart?</itunes:title>
			<pubDate>Tue, 09 Jun 2020 23:15:16 GMT</pubDate>
			<itunes:duration>50:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-girlcodeorfollowyourheart-/media.mp3" length="36403472" type="audio/mpeg"/>
			<guid isPermaLink="false">b2ccc936-a1c0-42ab-a04b-a55526eba8db</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-girlcodeorfollowyourheart-</link>
			<acast:episodeId>b2ccc936-a1c0-42ab-a04b-a55526eba8db</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-girlcodeorfollowyourheart-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCf+zI7OeUaPIxK/ypi0JhXzHcThAebBn0rgbQmviftiv7cSpz+lp/AHKKDzY9nTO9T22yqbGRfxvYdz57rB611gK7rUTl800RUrcvd8/t2yBo7ZXYHPzLdi0cA47kaj6q3AJOBmVLZFrHfDYIaP5EPGXpG4upcS8xlDo3tnppGKlmJSyD8aASNJq1h3oG4YxNltImLcjUKxvrUIBGRfGexF0uPfZR01K6IpuPm8GO0etA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>41</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4358c.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Hot girl summer or settle down?</title>
			<itunes:title>Boy Talk: Hot girl summer or settle down?</itunes:title>
			<pubDate>Tue, 02 Jun 2020 23:01:00 GMT</pubDate>
			<itunes:duration>51:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-hotgirlsummerorsettledown-/media.mp3" length="37295552" type="audio/mpeg"/>
			<guid isPermaLink="false">de0d38f2-5ee4-47f5-a8b6-80d8a5553a49</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-hotgirlsummerorsettledown-</link>
			<acast:episodeId>de0d38f2-5ee4-47f5-a8b6-80d8a5553a49</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-hotgirlsummerorsettledown-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCWSdB5gIFZkA/y/Xlp261pirBpif9LhuGcZPV4G4qzAL2jdlE9muRCgb1NmvGUN3i0vQ/Cd1n4W9B6jJeC2haT2v6e4034c3Ozv5uztGFlEv0HGMhxnYqw9LnNqgAEZXh0Rtv6cRtAaaBGfwc6TthEu9HBD5j/Xg5P97fcBnax64dqN8i+RafJVNeo3uTU+tmUkoLaTal0eW5gyzLWgmANxfVSqhl8BsiS+qYvegEaLEyZHQeQqrJ2pFhj3sxgFxe0dsTu+su3HkWACvLB7894Q==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>40</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43593.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My best friend is dating my soul-mate!</title>
			<itunes:title>Girl Talk: My best friend is dating my soul-mate!</itunes:title>
			<pubDate>Tue, 26 May 2020 23:01:00 GMT</pubDate>
			<itunes:duration>52:24</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-mybestfriendisdatingmysoul-mate-/media.mp3" length="37736192" type="audio/mpeg"/>
			<guid isPermaLink="false">8d2ba1d5-d855-4db8-b00e-c1e98f9e8f43</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-mybestfriendisdatingmysoul-mate-</link>
			<acast:episodeId>8d2ba1d5-d855-4db8-b00e-c1e98f9e8f43</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-mybestfriendisdatingmysoul-mate-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcXPA+h2tMJ7UTIgTDKHdnwW3gxDp0irXiVqDiDwFnW1h9ZJvXsHn49ylfW24YuShgdrh8DSP1ApnY8h6BfjIT8k4+a0Wct+3FcEXt0MnQPzOGLg4IlDz+orxFZg6YrO8inahX1wmvfW9b32xsG7GcpahhEpCLPf8lHY6Dg7pUjnzrc3HurVaBUItT3PsuB+ON2SA6m7LPGqkFzrpxTBn1XcFFfbkB7GqLmrSOk6MOXhA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>39</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4359a.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Do I tell my boyf about my Ibiza mistakes?!</title>
			<itunes:title>Boy Talk: Do I tell my boyf about my Ibiza mistakes?!</itunes:title>
			<pubDate>Tue, 19 May 2020 23:01:00 GMT</pubDate>
			<itunes:duration>58:38</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-doitellmyboyfaboutmyibizamistakes-/media.mp3" length="42216896" type="audio/mpeg"/>
			<guid isPermaLink="false">85344c98-181f-4614-a219-3be7a31c1881</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-doitellmyboyfaboutmyibizamistakes-</link>
			<acast:episodeId>85344c98-181f-4614-a219-3be7a31c1881</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-doitellmyboyfaboutmyibizamistakes-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC9Op7vi0TJGJOTI0L239HEtma67YerMc3xOAJafUs4jamFASndKSnAsDC1t+lnF64vUMVSrxwtxEaevrmbV7d6ZmrYopULAoqusaucDztYcdLjiUsmOK0+vLQGLkYCJv+mpUFMlT3oMHNzlRG9Fn4aYbM9WpUF4q3mvY++qgQJJyEuAdw5s2XWvrkH38n8d/9snQ1jX2vejDOQ4mSXjQSi5iF/77IwbDmhx09UJYDXAYrf3rmpXRu3GcdNQ/31VCDUkxvWm+C3Gf7XdVi+Ao4Tg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>38</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435a1.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I ruined my surprise proposal!!!</title>
			<itunes:title>Girl Talk: I ruined my surprise proposal!!!</itunes:title>
			<pubDate>Tue, 12 May 2020 23:01:00 GMT</pubDate>
			<itunes:duration>55:32</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-ourfriendsarecopyingourdreams-/media.mp3" length="39992528" type="audio/mpeg"/>
			<guid isPermaLink="false">6302d957-8b13-495c-ba29-95078eb6c36c</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-ourfriendsarecopyingourdreams-</link>
			<acast:episodeId>6302d957-8b13-495c-ba29-95078eb6c36c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-ourfriendsarecopyingourdreams-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCiD3qOl3Zq9HyOYZ1txrRA8fyyxxGoiHNU3Q0VyM12/W/XHk6kSbZ9CtHXzYR4ehg5addlVgVVovceoS7kjIZXRRoeq489adNVbC9KWVQ+0uRSfu9s5qwLe/zWFyaY+L1ANdTEdxyrFyG+tL2T49DnwjotYlE2nmLlXThMqsmDTrEjuRrVGe4DPX6yBxFa6ZKJf4YMmhwLPqS1nnqVvMjlaabThoFoUt+SB6OiXbcRcUFBQaCJ4eBzKlLAWZkgZVrtHzbDsSQIWJtoSaA+XeQxw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>37</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435a8.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk:  I punished my boyf for cheating but I secretly cheated too!</title>
			<itunes:title>Boy Talk:  I punished my boyf for cheating but I secretly cheated too!</itunes:title>
			<pubDate>Tue, 05 May 2020 23:01:00 GMT</pubDate>
			<itunes:duration>48:52</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-ishetooooonice-/media.mp3" length="35188256" type="audio/mpeg"/>
			<guid isPermaLink="false">4eb8d8a9-8dde-4632-ab5d-11bbd86495de</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-ishetooooonice-</link>
			<acast:episodeId>4eb8d8a9-8dde-4632-ab5d-11bbd86495de</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-ishetooooonice-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcnY5Vo54Jkq2Sgl0jqfHT1Mqb82fe2EIQjznFxngh9AFy6yjyPrc3hBgNxFnPjrwHwS51M69edqS/ZU3n3i/kkqYpcggxrKJNEBZg901t0/VAWZjvZRxQzO5rI1RL2T3AL++CpejLoos6KGCH8MOB3M64ICn8qJflhhIpr3ILT8OeosqW2M/5m2OrRN6lLM4QtxIo/8Fk621fH21DmZgK4ZifAMzTI5Tq4IyJkqSCTQA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>36</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435af.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I read my best friends diary and she betrayed me</title>
			<itunes:title>Girl Talk: I read my best friends diary and she betrayed me</itunes:title>
			<pubDate>Tue, 28 Apr 2020 23:01:00 GMT</pubDate>
			<itunes:duration>57:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-ireadmybestfriendsdiaryandshebetrayedme/media.mp3" length="41750336" type="audio/mpeg"/>
			<guid isPermaLink="false">8625ba43-9231-45c9-b79d-ea7eb23e7bd7</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-ireadmybestfriendsdiaryandshebetrayedme</link>
			<acast:episodeId>8625ba43-9231-45c9-b79d-ea7eb23e7bd7</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-ireadmybestfriendsdiaryandshebetrayedme</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC0O64IROLsfzDvcrHjxGvJDarqcmHw5Q0SWVvoFNJ7vShaUSCgJV1Z6K9B36KWr8T0lV6wfe5Yg5jNg/ZIiFdPZUgZUv3nK+AZa/hIm4lvbvyQOL7tiM/u5I3gfgIQZcc4SOQ56jQ6Z6L5z1j06St87A1gwOzOIFEXwlejR+A8xhGPQd2EYTICTIKw8x2sB3trobNu+wrEkx8e31kFxA4naXK7MbZtbuqUa8VgTYj4SqcGu8w+LZJVNUSq7NTTAo7m38kwFCcyhZaQK5NttkIYg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>35</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435b6.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Dumped out of the blue in isolation!</title>
			<itunes:title>Boy Talk: Dumped out of the blue in isolation!</itunes:title>
			<pubDate>Tue, 21 Apr 2020 23:01:00 GMT</pubDate>
			<itunes:duration>53:49</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-dumpedoutoftheblueinisolation-/media.mp3" length="38751392" type="audio/mpeg"/>
			<guid isPermaLink="false">5f621672-ba74-4a39-858d-2b073c2f50d9</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-dumpedoutoftheblueinisolation-</link>
			<acast:episodeId>5f621672-ba74-4a39-858d-2b073c2f50d9</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-dumpedoutoftheblueinisolation-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcbcjH8pXBpTgnnOpu2ZZ/jqwl+6VltT6FuMheRthZgrAbAz4gMf+1pB6Dszg//ZDlin2A9dUdk+/ZFAsKxGLnTH+8IIo7s1RzCtLCiKkgW7zxQsCri2WGNJRUz6XUzCbZOvgLdHUOC7Sv5e6kj9bQSqXG6vHbjjAdJE4Erv+5hUt4sJe3cpcHlHho11WcEXbUO0VPO/QjETybFBWwxownHyHjvSwPlEHJ4Mh0vJs2NAg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>34</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435bd.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Single life suffering in quarantine</title>
			<itunes:title>Girl Talk: Single life suffering in quarantine</itunes:title>
			<pubDate>Tue, 14 Apr 2020 23:01:00 GMT</pubDate>
			<itunes:duration>57:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-singlelifesufferinginquarantine/media.mp3" length="41704112" type="audio/mpeg"/>
			<guid isPermaLink="false">55183854-c71f-4a65-b20b-623bad921d23</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-singlelifesufferinginquarantine</link>
			<acast:episodeId>55183854-c71f-4a65-b20b-623bad921d23</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-singlelifesufferinginquarantine</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfL+2MaB7YeB8YbkPOj8gpK4rsK9a/UoKzP/nWwEDW+Sfmg1BnPOWp6vjN/0lU0fDUf02+9Vw05yoit1ho/gH5B/Mi9fVNHfVLffaYvgL6RL956tSrTW89YHrgUOvzrs7La2/9Qr1ts8uCHYWK8j7hmK8eKYTWiX9jR73gVZPNRXswpZDSDCsaWT5bxyRN1xvVTmJw6yocejIyK183Wma/4v2ruO7rWf4+EYBhyP8FHsQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>33</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435c4.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: Sleeping with my PT.. it's got complicated]]></title>
			<itunes:title><![CDATA[Boy Talk: Sleeping with my PT.. it's got complicated]]></itunes:title>
			<pubDate>Tue, 07 Apr 2020 23:01:00 GMT</pubDate>
			<itunes:duration>53:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-sleepingwithmypthasgotcomplicated..-/media.mp3" length="38204912" type="audio/mpeg"/>
			<guid isPermaLink="false">c76a375e-acd9-42e7-bd5e-e1b1bed0b117</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-sleepingwithmypthasgotcomplicated..-</link>
			<acast:episodeId>c76a375e-acd9-42e7-bd5e-e1b1bed0b117</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-sleepingwithmypthasgotcomplicated..-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCmDOsZk6+Pvw0CGrBR+cQa1yBjYZ0fxGk0rh9A4y2GMwFQAiQ0EQ58fObZNI2K6RGgEFOEjvpYYMyQsREX/INS8RGz+A+FU+4dGKy72qoV+r+4By3lqy0mjFwANN0GBRQ2QAV4qgwfcdCJB83gmHgaYeoGziLl9p+xBoyCGKSY/AvWuJnh+X5rne6GU3KDNoiHYED8T1eg0RghDECJ3BP/drTtyUyrz7It9LM/OdVxZ8Q59nC+6erNwkPjCvTMbvBKXpvMHeYuRtDKeDWa1LWUg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>32</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435cb.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I need to ghost my BFFs...</title>
			<itunes:title>Girl Talk: I need to ghost my BFFs...</itunes:title>
			<pubDate>Tue, 31 Mar 2020 23:01:00 GMT</pubDate>
			<itunes:duration>54:06</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-shouldhisbodycountputmeoff-/media.mp3" length="38952272" type="audio/mpeg"/>
			<guid isPermaLink="false">daea2797-d049-4868-b727-047d4c912388</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-shouldhisbodycountputmeoff-</link>
			<acast:episodeId>daea2797-d049-4868-b727-047d4c912388</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-shouldhisbodycountputmeoff-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd4bb5/QClJLsuawhlm2cFB3ppw4xwQh6hvBzVNQsOcl4HRb4JrVd5/HQmCUVNk0GL1RZEJ1xjgvI/1Wzw6DRdOOugPwEit832cDuP/c6euks3R+uRZ8N02z6NUKZs60dTu2CQ+6VNu3Uu1LNmVxwIdZIJyCGj8XiAqXoxlkJq+Wgr94zmn7PfNGeqHQ+1OqEC5j8U6OMZobQGagxj1jms8nNxih8h5ArrOpG6wHGPTiQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>31</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435d2.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: I fell in love with a catfish!!!</title>
			<itunes:title>Boy Talk: I fell in love with a catfish!!!</itunes:title>
			<pubDate>Wed, 25 Mar 2020 00:01:00 GMT</pubDate>
			<itunes:duration>46:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-ifellinlovewithacatfish-/media.mp3" length="33205808" type="audio/mpeg"/>
			<guid isPermaLink="false">10d1b1be-3601-43af-bd6b-28a2725388c7</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-ifellinlovewithacatfish-</link>
			<acast:episodeId>10d1b1be-3601-43af-bd6b-28a2725388c7</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-ifellinlovewithacatfish-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeYtiBxgglSav6hnAoagyc9fuMZ5hqSGUlQKhn0SqxMkKJAdc1FFPn5f1s+jynJqN0REK3dTt8rWWkRQsE/KRxEuweUP2iKyDYcquBjqyxo6ydBOZ3yJXfibJ55Y+vZfZnwJuO1TO40vcUuC6sWZZOvd58WLUqOfRqNrhxgi3oXx1uRdS1d11Wy3DdnT6WS6eVYMMrL7NdX8bGgHrBD9hMcaNmExd0ERHUvChI2Cn779w==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>30</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435d9.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: Bff bought me a holiday I didn't want..?]]></title>
			<itunes:title><![CDATA[Girl Talk: Bff bought me a holiday I didn't want..?]]></itunes:title>
			<pubDate>Wed, 18 Mar 2020 00:01:00 GMT</pubDate>
			<itunes:duration>45:50</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-isittimetogiveuponbeingablogger-/media.mp3" length="33005792" type="audio/mpeg"/>
			<guid isPermaLink="false">38e4ca56-e88e-44a0-ac81-6bb2bcb94456</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-isittimetogiveuponbeingablogger-</link>
			<acast:episodeId>38e4ca56-e88e-44a0-ac81-6bb2bcb94456</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-isittimetogiveuponbeingablogger-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCwNkJ3F1TdwUYmZt7C1teaJFH7DqzrU4ydCZ3Xbp9yT+ozMDded9x0LucOkA0g6aL5tdX4vWKOP2JR90bf8SRIHDZ2AYLUDF4HeQtvEjjC4kUIzz2X2V3ZM7I885MXjauYZFuxnedqHvvAC8hJqjusPeU/gVy+k/DNf1Mdtb6Ad5c64jpoZwADMSBG29TbkPVmI85VX1yF2c/kBVhar7C/8s43ofJypMT9fEjqPeXCQ0474nQssJ+ZIL4z8GF+QY4rH6LFMl6k7Fr6jeZR+53gQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>29</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435e0.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: WE WERE ON A BREAK!!!</title>
			<itunes:title>Boy Talk: WE WERE ON A BREAK!!!</itunes:title>
			<pubDate>Wed, 11 Mar 2020 00:01:00 GMT</pubDate>
			<itunes:duration>52:20</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-wewereonabreak-/media.mp3" length="37682192" type="audio/mpeg"/>
			<guid isPermaLink="false">6f8d9097-1f55-44a6-8e42-31124d425cc4</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-wewereonabreak-</link>
			<acast:episodeId>6f8d9097-1f55-44a6-8e42-31124d425cc4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-wewereonabreak-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCQFoqRp7pWRxqUAj+7YlqZ7wM84Z3RTIdQbe7b4FgfAz2nfYGLl8EzOfSg8nkQGhwYSQSuPCSSifpWSVqAWKlznA9kVqJc28AHglbm0aFSJMJGReuMwLHrJFgRehR29OQ2FnQA+7vb7XMCVwFOpWOKbVfAJOqUR5t4/sclVFC5qjJn5dVFzoElsdnfuRYnS5+3aiEvaIooe4MRNT6dm8t3eJ5JveaiTxLaP6NK1fMl83aV1mExmsA5+0WVQwWkFQoF23Kov92TOCuKvI9c01Yog==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>28</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435e7.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: How do I tell my bestie I want to move out? Feat. Erika Costell</title>
			<itunes:title>Girl Talk: How do I tell my bestie I want to move out? Feat. Erika Costell</itunes:title>
			<pubDate>Wed, 04 Mar 2020 00:01:00 GMT</pubDate>
			<itunes:duration>39:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-howdoitellmybestieiwanttomoveout-feat.erikacostell/media.mp3" length="28235216" type="audio/mpeg"/>
			<guid isPermaLink="false">5c83575f-a1d3-455b-b072-70b58e93dfa8</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-howdoitellmybestieiwanttomoveout-feat.erikacostell</link>
			<acast:episodeId>5c83575f-a1d3-455b-b072-70b58e93dfa8</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-howdoitellmybestieiwanttomoveout-feat.erikacostell</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCxsfWhYZP7OpEUxCVESxmhJuf1+McdLMxdl28ZSARIYabBPbj2towBhEJwFdo2rN7IY2UijqR6GMLWsWIXxF0KfxGhkmPIcCQvJohrVDMyANkf0Pp5evEIMBjgAQ4IptJjriBE9eWT8Ua7agRWt/vAbtZtK41KAZ88bU+9O6W6oFmEphLaoUbEsxgNJ/6zkhsos5GpI3gKTV7sB51HuL9FHSCUOyz64157ifZI03ZanC2NsQvS0LtHExalTJjQ4VXrG7Ong/FyxtGhX41bh2UGA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>27</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435ee.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: 5 months in and still no date?! wtf!</title>
			<itunes:title>Boy Talk: 5 months in and still no date?! wtf!</itunes:title>
			<pubDate>Wed, 26 Feb 2020 00:01:00 GMT</pubDate>
			<itunes:duration>42:55</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-imdenyingfeelings-/media.mp3" length="30900656" type="audio/mpeg"/>
			<guid isPermaLink="false">b2c405d9-5e30-4176-bd5f-242a679a7f56</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-imdenyingfeelings-</link>
			<acast:episodeId>b2c405d9-5e30-4176-bd5f-242a679a7f56</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-imdenyingfeelings-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCclUysIH3aAq3WgiTGLrG+fB4HXIw/BhkOuicZ3cuOgKWpjqKDrGIwDIr/Xa7tzXHHvR/QsqdWs0bjWR7Zh8su0JmA5w0cICHXf9TrKC3IESshOh5RrhhCn2eqVG9H8v2Ls+vJJdwMvErRX5ZN36bD7rmPxMIVfkuONKGUgPbpRewLMpH4kVl2jw4Q+F7OD1y0ClQRPyKLP/qdxj9wk3AsAUZyQZj4M8O0nbfnqM+U9rg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>26</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435f5.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: Be in a relationship to marry or shouldn't be in one at all?]]></title>
			<itunes:title><![CDATA[Girl Talk: Be in a relationship to marry or shouldn't be in one at all?]]></itunes:title>
			<pubDate>Wed, 19 Feb 2020 00:01:00 GMT</pubDate>
			<itunes:duration>46:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-beinarelationshiptomarryorshouldntbeinoneatall-/media.mp3" length="33692672" type="audio/mpeg"/>
			<guid isPermaLink="false">ade749e4-09b5-4f27-8612-06a76fcd9414</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-beinarelationshiptomarryorshouldntbeinoneatall-</link>
			<acast:episodeId>ade749e4-09b5-4f27-8612-06a76fcd9414</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-beinarelationshiptomarryorshouldntbeinoneatall-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCvTywX/mLqi+mHZOf5C/lglQ/E5wAO8nzlz9v/oMKPhTa87z8eMHCMq8X25pH+ngtINYAedskXKUDR/evQHbfQI9imxgq4RzKMj9hgaS26Fin9geZ3xMj4P6LzKGcQHeu6oNm6nyqWn3B5FXXQw7m5dwtXkAE6mrfyRi8YGJ7A3Ycmj4lxE8weizsDQziRJPPdYkg/Ss6EHtbMx7ejRVQDFO+l52VWnKyuInYOWzOkebMdX58jdNrmTTBYGrAxUJep/uj1hxahtRrI1NNNNV3jA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>25</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e435fc.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Is my boyfriend isolating me?!</title>
			<itunes:title>Boy Talk: Is my boyfriend isolating me?!</itunes:title>
			<pubDate>Wed, 12 Feb 2020 00:01:00 GMT</pubDate>
			<itunes:duration>54:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-ismyboyfriendisolatingme-/media.mp3" length="39279296" type="audio/mpeg"/>
			<guid isPermaLink="false">b79deb87-78ab-4d04-8e95-ad80d30ba6a1</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-ismyboyfriendisolatingme-</link>
			<acast:episodeId>b79deb87-78ab-4d04-8e95-ad80d30ba6a1</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-ismyboyfriendisolatingme-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCNglqcVC8mg+iYwvDi6TN15D2kHOuk1dDbyQG399UzQkp4TL+f1o/Qz7Pk9G1Dv7Ailj8JkzjFwvhjbw4eiVLvqRll8YiwYd8o/tmf1ByhKW1uU7/iM29hWpsCzNwFKqHNUxhLSmSXU56BKZxUWTxKS0zXhUqZ6hLp+xI5IWin6FdNo/hgcM6oFPW9OgRPVf1XgeceKv2sawBD02z3Yj29wBFpYgGhPodV0VxrC6u8O40sFHtxTmcFH09MShlMIvXWym9Xze7FWyJp6KnlEfbzA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>24</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43603.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: How do I build my business?</title>
			<itunes:title>Girl Talk: How do I build my business?</itunes:title>
			<pubDate>Wed, 05 Feb 2020 08:01:00 GMT</pubDate>
			<itunes:duration>44:51</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-howdoibuildmybusiness-/media.mp3" length="32299472" type="audio/mpeg"/>
			<guid isPermaLink="false">f6d87737-2ce6-444c-9517-227586dc3813</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-howdoibuildmybusiness-</link>
			<acast:episodeId>f6d87737-2ce6-444c-9517-227586dc3813</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-howdoibuildmybusiness-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCc9Wo9wdX/9rw0zOWknkuEWVC88ZI23v++/lEe5dLQ3W5Yx/F337/1ynsPlEk3sRTE/dZnTvpd2AfP4QVoTdDVUShGwUTMYTPKAdsV01WgRBth62Kz0mADxF6HKkHo1KBzeuXQ378kBQVK5nLT+fySCqM0i0HC+ZLolY8Xkf/lzmqg4G6hAkRzxe2YfGxb+PKuw03mD4eovDCaTO7No1OFM7186eyV8An67M1i5xJTSxA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>23</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4360a.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: 2 months dating but still no kiss...?!!</title>
			<itunes:title>Boy Talk: 2 months dating but still no kiss...?!!</itunes:title>
			<pubDate>Wed, 29 Jan 2020 00:01:00 GMT</pubDate>
			<itunes:duration>46:03</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-2monthsdatingbutstillnokiss...-/media.mp3" length="33159152" type="audio/mpeg"/>
			<guid isPermaLink="false">5aa1d066-538b-4784-ba9e-2394622e21d1</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-2monthsdatingbutstillnokiss...-</link>
			<acast:episodeId>5aa1d066-538b-4784-ba9e-2394622e21d1</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-2monthsdatingbutstillnokiss...-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCc1Bo6KLMfXEIJ5tdCpyqOdIUDF8cjvyb+dzfSDWRiYGOoyLPWXwv3exzpGT2f1MLQbrKWuh+p5rGAU2aiQA80hEVbpDP9DKApq+5snkjtM5CZox8AxVfr4wB7aUcap7/ebh3EBbP1ZwWeLbwRINT+b5aNpn+wGiRXqtfLBZdMOUM7tQVqN5mW8lT4tYESkCSckmxJJMJ1VVRUftzt7MrAJI90TiguoZ/BGwdYF+keB/g==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>22</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43611.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Bonus Ep: The Live Show!!!</title>
			<itunes:title>Bonus Ep: The Live Show!!!</itunes:title>
			<pubDate>Wed, 25 Dec 2019 00:01:00 GMT</pubDate>
			<itunes:duration>1:20:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/bonusep-theliveshow-/media.mp3" length="58171952" type="audio/mpeg"/>
			<guid isPermaLink="false">3aedb38d-6341-431e-9c4d-10d4c09bb46f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/bonusep-theliveshow-</link>
			<acast:episodeId>3aedb38d-6341-431e-9c4d-10d4c09bb46f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>bonusep-theliveshow-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCnwguhmEkoVIuEqp1s4UAOPPYfrtsgZ/r7e4lU8hGeALVrtUEtR3xu8TMhkDHifJHtzY52UDRs8Bux8MAl4f/8G7/p6RZOphCdLbeyUJhkC9FUEHPfGeacyFHpc0ZJN7AX7BSn08pYd5MZAPKSBGijyCGxOEp6tG0HRmKQQC/vLoTQ/r0/sb8bYJ70LwhDDPBhV/oNE8bANKErrd8kF5GsS6e9TY+qcE2u2EpazrDstftoovvudAqVwWzGk1R1CkvysubvP5MWEUUnLD8rc6dGg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>bonus</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>21</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43618.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Not going to uni and worried about FOMO!!! Feat. The Mums</title>
			<itunes:title>Girl Talk: Not going to uni and worried about FOMO!!! Feat. The Mums</itunes:title>
			<pubDate>Wed, 11 Dec 2019 00:01:00 GMT</pubDate>
			<itunes:duration>43:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-ismissingoutonuniworththefomo-feat-themums/media.mp3" length="31460096" type="audio/mpeg"/>
			<guid isPermaLink="false">59b92703-753a-4cc5-91aa-425201a2955e</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-ismissingoutonuniworththefomo-feat-themums</link>
			<acast:episodeId>59b92703-753a-4cc5-91aa-425201a2955e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-ismissingoutonuniworththefomo-feat-themums</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCXt/2ley2cAKZ4hwp/WHYJcDY/+PRQhGSOE2pDF0Zb+lg75o2z7fqCWsfxSRy6322Nm8t2RwmpNnLIOabr/bR3JmNVwXJ1E6OXpIBAjDkniTqyp5ywTntQBO6y3slWeTTApSx3QR5erwr202V78WsU71JZkH+PplcXj3lhKqyZ0u8inAUItHxLgyIlLkjAP0cELJp5GukrCUUUmDEQrETz3YrG/eek1xmNrBKIqlPnXAU7HNrw/Ao7kUp2FZ+AW8JA9VJIInjLsHOo5ZjGtXHHg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>20</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4361f.png"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: All girls fall in love with me!!! Feat. Joey Essex</title>
			<itunes:title>Boy Talk: All girls fall in love with me!!! Feat. Joey Essex</itunes:title>
			<pubDate>Wed, 04 Dec 2019 00:01:00 GMT</pubDate>
			<itunes:duration>34:36</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-allgirlsfallinlovewithme-feat.joeyessex/media.mp3" length="24918752" type="audio/mpeg"/>
			<guid isPermaLink="false">a71a71a7-09c3-418f-bad9-e44cbbd3b709</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-allgirlsfallinlovewithme-feat.joeyessex</link>
			<acast:episodeId>a71a71a7-09c3-418f-bad9-e44cbbd3b709</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-allgirlsfallinlovewithme-feat.joeyessex</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC+bVzSF0bWJDrUfHz0seap86DWdurlIyHBFO2RJ/fQApBEdZdFk2ZX5+z8rsgHglhZkzZvUsspCogif29OuLgm5MSnnsxFQRplWZirVDH4Vq1/ILOxcJDPpmRYmpcKo3fS6H8ziV3xu6TVzwfavcxGc+6XQrfLe3LVrur84s0il6X9bTADkU9medegxaUTGUAXPk6c9Kt2m6AahXK9/dKYAU04RP5JgsuVrVfQNYPVWefWkvrBiCCj8ZjZMLRbGNV32iKprbVfG/wh8R1UGZoNA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>19</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43626.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: I want to pursue my passion but I have bills to pay! Feat. Conna Walker</title>
			<itunes:title>Girl Talk: I want to pursue my passion but I have bills to pay! Feat. Conna Walker</itunes:title>
			<pubDate>Wed, 27 Nov 2019 00:01:00 GMT</pubDate>
			<itunes:duration>52:41</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-iwanttopursuemypassionbutihavebillstopay-feat.connawalker/media.mp3" length="37937072" type="audio/mpeg"/>
			<guid isPermaLink="false">f5036acc-8882-4d69-8755-b76d5022c8c4</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-iwanttopursuemypassionbutihavebillstopay-feat.connawalker</link>
			<acast:episodeId>f5036acc-8882-4d69-8755-b76d5022c8c4</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-iwanttopursuemypassionbutihavebillstopay-feat.connawalker</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeQRfs1KUk3H7mRceU34Iz6C01+aJNOxnyD1nN0R8Gy+cNeAk5pG17NfhfQh9WauURkohaEp7U1LF/IrbZ8oT89xFH1CCu+kI7PBYDDtzXcZMq4ILr72Uj6f7E70wOS/A/oiBmin5InFKlrVSMhIbJ6rR+0Bnb4HJHbXkxTxBYvg7um4FcvCQ2HK76jwiCj42ngKHbrqO9VdNmOIBINaIoPBs9NNhd7olKSvOFccKRfyg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>18</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4362d.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: We're exclusive but he doesn't want a girlfriend... feat. Jamie Laing]]></title>
			<itunes:title><![CDATA[Boy Talk: We're exclusive but he doesn't want a girlfriend... feat. Jamie Laing]]></itunes:title>
			<pubDate>Wed, 20 Nov 2019 00:01:00 GMT</pubDate>
			<itunes:duration>53:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-wereexclusivebuthedoesntwantagirlfriend...feat.jamielaing/media.mp3" length="38369072" type="audio/mpeg"/>
			<guid isPermaLink="false">c389ed37-462c-4a25-9912-b146b0c38789</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-wereexclusivebuthedoesntwantagirlfriend...feat.jamielaing</link>
			<acast:episodeId>c389ed37-462c-4a25-9912-b146b0c38789</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-wereexclusivebuthedoesntwantagirlfriend...feat.jamielaing</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCe6lzGEczM/mlI7W8WL5x9VebDEpP12trKMhpaUjRaIki+yv/yr4GY7CwJt9687cF6ZReT+HbRNZ+cTK/hqAtCZYqRXblhZvl3uXbD68CVSgm2zBF/PDD/S7T0GnyOnCMiy636Aa0Dr0akOHt3xlAXQ/2Z/ql9EDHx/6rea2ihDJ1X8xXODKw1pmLeHltw+c3PUFYNbB++Z6Zr3kfKEBTh2yXCcVJSO14JPOq2eVCR2ag==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>17</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43634.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Is popularity worth the toxic friends?</title>
			<itunes:title>Girl Talk: Is popularity worth the toxic friends?</itunes:title>
			<pubDate>Wed, 13 Nov 2019 00:01:00 GMT</pubDate>
			<itunes:duration>50:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-ispopularityworththetoxicfriends-/media.mp3" length="36189632" type="audio/mpeg"/>
			<guid isPermaLink="false">50e32501-5cae-491e-bac8-49af7bb281a7</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-ispopularityworththetoxicfriends-</link>
			<acast:episodeId>50e32501-5cae-491e-bac8-49af7bb281a7</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-ispopularityworththetoxicfriends-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCNCL/V8t4wjzjxKxjDXSYgu8PYZtL28uUlEM5o9j51/lB6xS/TDpCUrXhti9nSe7/zAWruxxk9EhLPzosErECcuPdSsxdsSf+KCZn0IiZ8t8o9iGJ/mXnb7qJk2YdwJZb1sZQaIVsOoteaM33ejQK3gPwccQHJxzFijjHa8AoG4EGfYRuzzFnx4uGbunABIGW1aDuCGr97gjTgLcA1TZ61wkxw2nibgbxx+PWvKUmPNbrDI6LvUBFmwv81/cZg274lsV+km9nP13KAhxb5mT9Yg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>16</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4363b.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Saving myself for marriage feat. The Persian Babe</title>
			<itunes:title>Boy Talk: Saving myself for marriage feat. The Persian Babe</itunes:title>
			<pubDate>Wed, 06 Nov 2019 00:01:00 GMT</pubDate>
			<itunes:duration>47:07</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-savingmyselfformarriagefeat.thepersianbabe/media.mp3" length="33930272" type="audio/mpeg"/>
			<guid isPermaLink="false">1dda641e-256c-48eb-9e6a-c898b5dcaf37</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-savingmyselfformarriagefeat.thepersianbabe</link>
			<acast:episodeId>1dda641e-256c-48eb-9e6a-c898b5dcaf37</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-savingmyselfformarriagefeat.thepersianbabe</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfnbBXCBN4ZlmiPQFZ6gPbppwkRgIputcBfBjYRyuG2/hOfurs0TKSwOadpsug2Uu2/8sIXAueMlP7tyskex3sICKfvTqDjk8apXHtI79rQ6io/0JYGp+Dr0RRwvq7itKlczuvkRowhFjYRyyApCBbVEmBX9caQ8qK49ej6xCkqetxIc83A3OP850YxfshzyYU51iLxIOzYwXgYRocmsoup9i/PjD28EMqrQsezhaEiCw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>15</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43642.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Girl Talk: I'm the only single girl in my friendship group]]></title>
			<itunes:title><![CDATA[Girl Talk: I'm the only single girl in my friendship group]]></itunes:title>
			<pubDate>Wed, 30 Oct 2019 00:01:00 GMT</pubDate>
			<itunes:duration>1:00:33</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-imtheonlysinglegirlinmyfriendshipgroup/media.mp3" length="43601456" type="audio/mpeg"/>
			<guid isPermaLink="false">b411164a-9374-400a-805a-e19ccbb893fb</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-imtheonlysinglegirlinmyfriendshipgroup</link>
			<acast:episodeId>b411164a-9374-400a-805a-e19ccbb893fb</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-imtheonlysinglegirlinmyfriendshipgroup</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCXC52Yof5Pr1Zfkc4zuUkA/Ua5v/JaHpeaO1J0qH1XV3XMRPqsS68wZxJVK2T4tliLBb5Te+Isky/nTshFJvfzZNoO2j6WgGq1iZy90voSxlwHsHNW8wx64dE0eT6N2ie9qLl7C9XR0YNU/XjpRe3BXlh3ONXr9SUlAQFy58avIWuo6DNHfquLpChvGAkWrFP9jPdLIYlA2hE2z3r4NSXtSwJoO5yamXNHxD7Rdz7GserVXp4CHfD7NV6jFeQytuj3j8S998TXXTRj9Cq6pORMQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>14</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43649.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title><![CDATA[Boy Talk: Why won't he move in with me?!]]></title>
			<itunes:title><![CDATA[Boy Talk: Why won't he move in with me?!]]></itunes:title>
			<pubDate>Tue, 22 Oct 2019 23:01:00 GMT</pubDate>
			<itunes:duration>56:12</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-whywonthemoveinwithme-/media.mp3" length="40470752" type="audio/mpeg"/>
			<guid isPermaLink="false">cc41d73f-40b8-4213-a8da-98fa9dd77dd6</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-whywonthemoveinwithme-</link>
			<acast:episodeId>cc41d73f-40b8-4213-a8da-98fa9dd77dd6</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-whywonthemoveinwithme-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC+iy0QHm7fcUVz7whV3huFBRfe+U5JGJtroqEWRdrm+lHt7nVz4AZHUj7CgD+SvCxQuQfC7Oeo+QnMk7JB44vZu5sV7EtMO5cV/xEeuA9MFXyOKb02dq25XrfOAlxK+3ROVV/Sxfr4LFAZV6ALKbSen/R+W3tKUY6PgNOwg2CXOQLOXWH0V2c2aFFzQUxkrqtGPKEFtanYD7FHPghYMu1oWXzhViyfqSsp4fpZbf3NTWM+68xPdAiwPHaJhJqH3szyzeTuEqjumJbsQZ2QRV2nA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>13</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43650.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My bff demoted me as her bridesmaid!</title>
			<itunes:title>Girl Talk: My bff demoted me as her bridesmaid!</itunes:title>
			<pubDate>Tue, 15 Oct 2019 23:01:00 GMT</pubDate>
			<itunes:duration>43:19</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-mybffdemotedmeasherbridesmaid-/media.mp3" length="31197872" type="audio/mpeg"/>
			<guid isPermaLink="false">668c377b-2e8d-4f01-8c5f-8a08a7ffd179</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-mybffdemotedmeasherbridesmaid-</link>
			<acast:episodeId>668c377b-2e8d-4f01-8c5f-8a08a7ffd179</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-mybffdemotedmeasherbridesmaid-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeLRfZ9la+/JcTz3my06r5KdccrfTaJAzMwtmvexR2PDRuY/SkgVFS9kdXqcdKBwnGxqgKdOAGgC9io97L6RXBQx8m4MiVJyca4DvccLICLbBCQ6yGW3geSrEM/CIOzKXPAtnITQ70k2DC7tI42AB7+sUE2q8UF4vubm/2xwH+cRhNDdm5zk8G/fRr4n/SMVCMiE44Q4PlEFbjJ/OqjesgN6Me1M+0O8mvxKu6HEScbVg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>12</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43657.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My boyfriend pretended to cheat on me?!</title>
			<itunes:title>Boy Talk: My boyfriend pretended to cheat on me?!</itunes:title>
			<pubDate>Tue, 08 Oct 2019 23:01:00 GMT</pubDate>
			<itunes:duration>41:54</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/boytalk-myboyfriendpretendedtocheatonme-/media.mp3" length="30178352" type="audio/mpeg"/>
			<guid isPermaLink="false">d092bced-21d8-4bfe-9510-62a84734a643</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/boytalk-myboyfriendpretendedtocheatonme-</link>
			<acast:episodeId>d092bced-21d8-4bfe-9510-62a84734a643</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>boytalk-myboyfriendpretendedtocheatonme-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcElBgMmwWHsvdS50Egy+Bh5bUh+9ZI54tsapZpy/rvA5djUh2e50bs20U2I3sjmIu6AF4MkKBmdXSfSvke1ApK1l+KdVMQzbuRhJTIkeOv8EuX6yuuFAadTaQlLZo9NITbkqFM2SWOKgNPuPsn19QHKL8grMG+jVGqyS0zBh/BAbjOYxYFDRSzzWCdlLt+5EU0chTZIQLnHeHZXgCJZjNC0DVgh/qmOuJq2Ndx0q4zVg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>11</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4365e.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Everyone is someone’s ex!!</title>
			<itunes:title>Girl Talk: Everyone is someone’s ex!!</itunes:title>
			<pubDate>Tue, 16 Jul 2019 23:01:00 GMT</pubDate>
			<itunes:duration>55:34</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/ep.10-girltalk/media.mp3" length="40008512" type="audio/mpeg"/>
			<guid isPermaLink="false">2c068a40-a621-4ac9-9f9e-5acfa443adca</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/ep.10-girltalk</link>
			<acast:episodeId>2c068a40-a621-4ac9-9f9e-5acfa443adca</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>ep.10-girltalk</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCd6DUT5VJm8YX5xNtdkFDkyhmqOWtz9dpDm6Syzl+nkzTVDmAkUcbWmcWC/6sCTs2VZi982DFFO3AU8lNX7yhmtdxP8IBiQ5JZinKyHcavW1VnBlL5QdM2DnTGWFIjuHHDYurPnE8TxYTi/ozyB7Wqj96/k1gLd0/3SnrNCOYTBaxMRuF5Szwg1049Nut521+MSq0okPMXQaIhjWD2Lbct8rOCPrVKlvzFWYw5aqOO4JA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>10</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43665.png"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Am I the rebound girl!?</title>
			<itunes:title>Boy Talk: Am I the rebound girl!?</itunes:title>
			<pubDate>Tue, 09 Jul 2019 23:01:00 GMT</pubDate>
			<itunes:duration>41:32</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/ep.9boytalk-/media.mp3" length="29909216" type="audio/mpeg"/>
			<guid isPermaLink="false">7667a388-3329-4ba1-9e7d-9f1ad8262624</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/ep.9boytalk-</link>
			<acast:episodeId>7667a388-3329-4ba1-9e7d-9f1ad8262624</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>ep.9boytalk-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC1/l5mnFGEDSSCS75tHC0WfrBTT5Gh8PkppgcAXXovgKhvSYH3WX3fpkwNEHGOKY6fOCtbR/jrPwyFTSTRoomyrSiRfOAbRyCSSUHca+rThcW1Uuxfy1UTesiEfY6uqt/3yjNO1e9O7j5QTXjyjOscsdKfmyLzWQJeWSCleTFZIqkxnaNAgGa1I11KGU8ecmE8ezkbIVu3ywuOynHCBDqAVkHHYboqjeP1Vbd/eM6nLUMRYnWqF16rXShoCmR/MSkVEeFNKYY6AgxghtvOtZ9Ow==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>9</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4366c.png"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: My bff and my boyf have become too close</title>
			<itunes:title>Girl Talk: My bff and my boyf have become too close</itunes:title>
			<pubDate>Tue, 02 Jul 2019 23:01:00 GMT</pubDate>
			<itunes:duration>1:01:15</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/ep.8girltalk-/media.mp3" length="44103872" type="audio/mpeg"/>
			<guid isPermaLink="false">5141c575-fab4-417e-a5c6-f1f88301d6d2</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/ep.8girltalk-</link>
			<acast:episodeId>5141c575-fab4-417e-a5c6-f1f88301d6d2</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>ep.8girltalk-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCxXng/Hzk5Z8X8nxQzDBNnJRPR+Sb5XnDY3sft2+acmdcEmlR3qEgLzyklyDttkEULtdn/TVTLqiTXCubdz18vexkDsx6QkkOGfgQn6dpKfC5m04kQoXwRiHhCgtzWi5fb6ik4SoTW6LaCJt+4jwQIA2SJei2ncBGj07QwDlKWbnXW7G2ILDgROnpW907Du0qY1ZE+hxOxaOux4+sXwu6pL0PBRPAX5IzddTJXRUaaGNULvtwWowHZSmVY88rnzYj+UtFrYY3G6cYyLtQtyX4LA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>8</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43673.png"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: When should I sleep with him?</title>
			<itunes:title>Boy Talk: When should I sleep with him?</itunes:title>
			<pubDate>Tue, 25 Jun 2019 23:01:00 GMT</pubDate>
			<itunes:duration>48:59</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/ep.7/media.mp3" length="35278112" type="audio/mpeg"/>
			<guid isPermaLink="false">a907a145-de43-416f-9666-69fd01b6ab5d</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/ep.7</link>
			<acast:episodeId>a907a145-de43-416f-9666-69fd01b6ab5d</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>ep.7</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCc5gly0sO67mV1E1hgz9UHKSZLSgaGjm7huEKqbHBZwvR70kLpH8uUgsyA/awYE2tEGd8ywdw3qJRy8oFbke1FrZrD8YFIpdnrPV1KaignZei7PnqdxXrC9bnIvRdHAhFmNtP8Hc2uGDWbuAxm0rdVMvVvGUTofA/mg1ypVqLvfDxCAxYl35avzb9t1dXnNKYpMvXCzQUbWRqqP+5ii0Sh/qLVUPZXB7nTv8XExm/VhPg==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>7</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4367a.png"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Following my head or my heart?</title>
			<itunes:title>Girl Talk: Following my head or my heart?</itunes:title>
			<pubDate>Tue, 18 Jun 2019 23:01:00 GMT</pubDate>
			<itunes:duration>32:47</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/ep.6-tbc-soldout/media.mp3" length="23614112" type="audio/mpeg"/>
			<guid isPermaLink="false">ab7bb2fa-830d-46c3-bc6c-3d54521d80b2</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/ep.6-tbc-soldout</link>
			<acast:episodeId>ab7bb2fa-830d-46c3-bc6c-3d54521d80b2</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>ep.6-tbc-soldout</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCfDIYkPzxvKDYa1mWZWICVGStQH1bYgez9gsAm979Ra+/E4DLd9+HGSJO5k7rTaN/QtaxogakMCptEaQJy72pElbaEh6aGVgin0bR3F1V4TmYAQVxuS3IqKTpo9RmI51cPyjitRs8cTLkEy4x5rhUmNluda7Tw23G8TdbFFEqGsRbiscK+ZVLePjrNkrt2JK2Nkr7XFKZptd5NvxI6jQZ3eQWTXFXyotnZF32TF3HMPeA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>6</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43681.png"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: Is flirting cheating?</title>
			<itunes:title>Boy Talk: Is flirting cheating?</itunes:title>
			<pubDate>Tue, 11 Jun 2019 23:01:00 GMT</pubDate>
			<itunes:duration>56:17</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/ep.5/media.mp3" length="40526048" type="audio/mpeg"/>
			<guid isPermaLink="false">4b1e8ff4-fc64-4ac2-9ed9-92bdb8a6870e</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/ep.5</link>
			<acast:episodeId>4b1e8ff4-fc64-4ac2-9ed9-92bdb8a6870e</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>ep.5</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCeOxflkA0wc6Sw3+SM/F8X4ytKnmnWLfwxUIYHDwIhwh7pis/6wYsyiUWgywbMn2exIpI9DKZ+e2FslVYVvVDuviKP9ZnO0XFYGxL1saRUTrCko89uVSOYJBU3h89cOtNvwVDGrUvKQk8YhGSKa33Segdfule3JxXLh7jbT5KeYvUf1p1rBDDskaf57p9wsHDpuUoCmEtUGPDM/t5OITJ+acDHsqSXiyO/GEDuGFme5fQ==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before! I...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>5</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43688.png"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before! In our podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before! In our podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Am I wrong to snoop?</title>
			<itunes:title>Girl Talk: Am I wrong to snoop?</itunes:title>
			<pubDate>Tue, 04 Jun 2019 23:01:00 GMT</pubDate>
			<itunes:duration>39:37</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/episode4/media.mp3" length="28525952" type="audio/mpeg"/>
			<guid isPermaLink="false">6df7e417-c11e-4d4a-a044-24d84837b84a</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/episode4</link>
			<acast:episodeId>6df7e417-c11e-4d4a-a044-24d84837b84a</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>episode4</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKO7r7G3tfVCmc+bMES98S4RzlKYqu1OMP3xU9hThs8yRIpQ8UWNkllEcT1n6CjUzgVWjK/DHxvgK1fa3UOCEG7sdYrkXIZhM6M2BWEVux9/mfSIjvvhOVXSh10D98C3fHLXTamc4C8OE19PI08xYRFjLG9Kt1tsi+DRTTfbOJfRPV50g3vj3w7USzKxqfANrFOCDEXGiClxNiwXpLgg3/GxG1ibUDROdxZTNexUMNHadiliNsT6dS7j6wu60NQW9NeUXbVydbiFezt9H8HzZGA==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>4</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4368f.png"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My boyfriend is best friends with my ex!</title>
			<itunes:title>Boy Talk: My boyfriend is best friends with my ex!</itunes:title>
			<pubDate>Tue, 28 May 2019 23:01:00 GMT</pubDate>
			<itunes:duration>41:54</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/girltalk-myboyfriendisbestfriendswithmyex-/media.mp3" length="30175328" type="audio/mpeg"/>
			<guid isPermaLink="false">5d5442d6-4427-44a9-974c-2e25db5e6a1b</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/girltalk-myboyfriendisbestfriendswithmyex-</link>
			<acast:episodeId>5d5442d6-4427-44a9-974c-2e25db5e6a1b</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>girltalk-myboyfriendisbestfriendswithmyex-</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCespF0sm5uAkHME5mQrfE0DA2YYAfVQSrQ6KZq9Qbtlb6M/uNZQc1BQpOGKMpJ+tYmqteya6vvjLKmRa6hnBEue+uZUckUVIaEU0hCxjLcF5p9JO2gvKYkLlKieOmQ1vvMrtsxTxxUPTZG6VRSAXUBqMlw+tm1JZJ+sEyRxwCnwmHKuUfyLa2NtS3N/PuB84Tz6RdyPwVClFat1VJewWDWGypaYmdX7Usdx20HCC2tz+A==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before! I...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>3</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e43696.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before! In our podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before! In our podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Girl Talk: Is my best friend asking too much of me?</title>
			<itunes:title>Girl Talk: Is my best friend asking too much of me?</itunes:title>
			<pubDate>Tue, 21 May 2019 23:01:00 GMT</pubDate>
			<itunes:duration>41:31</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thegirlsbathroom-8f20cb2c/media.mp3" length="29872480" type="audio/mpeg"/>
			<guid isPermaLink="false">cc052342-c6c5-43b5-bc75-6ae2385a1176</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thegirlsbathroom-8f20cb2c</link>
			<acast:episodeId>cc052342-c6c5-43b5-bc75-6ae2385a1176</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thegirlsbathroom-8f20cb2c</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCt/TfiDz0RNbLIoZAezTl4e7pcaTzQUUrbAh0aamSqdROsH4nKP/AMbsQpfXaxz/A/SVPIU5/tl/GOWtn9EBDYnbopQXSEhYpKaIi82gOCkSqE0H5zHiVrE+o87HZ2Bw12sgTktnUagQZtp1UOnJQ2bSyZzES1KFenY2PMhZFgd6+NUiu2mm0lTXzn2PtbbomKZTQ4zEWd4+Ay/hpk8pQh5NEuRXlqwGCrKF6gLtGknKSd5S9uYPlWBSKdoNuYf7ScTztrxZX02/R4R4RyPrDSw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before! I...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>2</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e4369d.jpg"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer : we can't promise we'll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer : we can't promise we'll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Boy Talk: My boyfriend downloaded Grindr</title>
			<itunes:title>Boy Talk: My boyfriend downloaded Grindr</itunes:title>
			<pubDate>Tue, 14 May 2019 23:01:00 GMT</pubDate>
			<itunes:duration>38:13</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/thegirlsbathroom/media.mp3" length="27502814" type="audio/mpeg"/>
			<guid isPermaLink="false">7693f423-281a-4ac6-848a-11d478420b7f</guid>
			<itunes:explicit>true</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/thegirlsbathroom</link>
			<acast:episodeId>7693f423-281a-4ac6-848a-11d478420b7f</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>thegirlsbathroom</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzC/dhWkdZTyhyFO4MlHWu/mXt8hUjluQ6oADaVz00jayWG9yzKifxgvw1IVIlIkAXTVsOSAB9bX2FsSEGnyov5bslpChH/PEJ0pzVuIhlctiY+9Zyxeu3OqgJluV1dbx+ViPaMloy3JFgqA9Z97NdJ3XcgFQpLpmxyy8JI1YG4S5I6aLE1so5R+varvZoBrGAwRIFOnMxgHN22p/eJmaozK8IcM6CVZ3jhwI/38GsStUnjgxobAoiv7sFgx4BTZJZfG1QGnw7XsrdcnBI9mMTUmw==]]></acast:settings>
			<itunes:subtitle><![CDATA[Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! ...]]></itunes:subtitle>
			<itunes:episodeType>full</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:episode>1</itunes:episode>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e436a4.png"/>
			<description><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip, and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<item>
			<title>Trailer</title>
			<itunes:title>Trailer</itunes:title>
			<pubDate>Sun, 28 Apr 2019 23:00:00 GMT</pubDate>
			<itunes:duration>3:05</itunes:duration>
			<enclosure url="https://sphinx.acast.com/thegirlsbathroom/trailer/media.mp3" length="2227577" type="audio/mpeg"/>
			<guid isPermaLink="false">7f855e7f-0d66-4a47-9816-3cee3adef68c</guid>
			<itunes:explicit>false</itunes:explicit>
			<link>https://play.acast.com/s/thegirlsbathroom/trailer</link>
			<acast:episodeId>7f855e7f-0d66-4a47-9816-3cee3adef68c</acast:episodeId>
			<acast:showId>bd38ad29-6b25-4be0-8796-a310aded9b55</acast:showId>
			<acast:episodeUrl>trailer</acast:episodeUrl>
			<acast:settings><![CDATA[FYjHyZbXWHZ7gmX8Pp1rmbKbhgrQiwYShz70Q9/ffXZMTtedvdcRQbP4eiLMjXzCKLPjEYLpGj+NMVKa+5C8pL4u/EOj1Vw4h5MMJYp0lCcLJ2/mkBhCS4ow0TTKRw8HQdtFYk4K/EFG9IuLNFVCRnnTtR3ToCa1kNhY1konDZDsJBbICu/ZgPC4R3y95H75mqUWVYrbusSdr+cVFDYN1GWvOjOjlY4tYMh1Bd4DhjUVZRLbSrOOjr8MU2+bieAgCDdE59DSTN0bevuuFn08hEUQKk8alMAq4A4i4ZvXcB8=]]></acast:settings>
			<itunes:subtitle><![CDATA[Subscribe for free now and listen to the very first episode of The Girls Bathroom before anyone else - coming Weds May 15th. Welcome to The Girls Bathroom! We’re Sophia & Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is ...]]></itunes:subtitle>
			<itunes:episodeType>trailer</itunes:episodeType>
			<itunes:season>1</itunes:season>
			<itunes:image href="https://assets.pippa.io/shows/61b9f3c11a8cbe59823cedd0/61b9f3e633f31d0014e436ab.png"/>
			<description><![CDATA[<p>Subscribe for free now and listen to the very first episode of The Girls Bathroom before anyone else - coming Weds May 15th. Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></description>
			<itunes:summary><![CDATA[<p>Subscribe for free now and listen to the very first episode of The Girls Bathroom before anyone else - coming Weds May 15th. Welcome to The Girls Bathroom! We’re Sophia &amp; Cinzia, life-long besties who share a YouTube channel. The Girls Bathroom is a place we all know to be full of girl chat and gossip and the place we often confide in girls we’ve never even met before! In this podcast we want to help you with your dilemmas, by trying to make sense of these boys wasting our time, the girls trying to make our lives difficult and all the things in between. So come join us for a fun but real chat in the girls bathroom! Disclaimer: we can’t promise we’ll stay on topic!! Follow us on Instagram: @thegirlsbathroom</p><p>New episodes every Wednesday! Email us your dilemma at hello@thegirlsbathroom.com</p><br><p>Follow us on instagram @thegirlsbathroom</p><br><p>Join us on Patreon for an extra ep every week!! <a href="https://www.patreon.com/TheGirlsBathroom" rel="noopener noreferrer" target="_blank">https://www.patreon.com/TheGirlsBathroom</a></p><hr><p style='color:grey; font-size:0.75em;'> Hosted on Acast. See <a style='color:grey;' target='_blank' rel='noopener noreferrer' href='https://acast.com/privacy'>acast.com/privacy</a> for more information.</p>]]></itunes:summary>
		</item>
		<itunes:category text="Society &amp; Culture">
			<itunes:category text="Relationships"/>
		</itunes:category>
    	<itunes:category text="Society &amp; Culture"/>
    	<itunes:category text="Comedy"/>
    </channel>
</rss>
